3W7FA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with farnesyl thiopyrophosphate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title A cholesterol biosynthesis inhibitor blocks Staphylococcus aureus virulence.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 116
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3w7fA00
3WCDA 5B00A 1JFGA 5AHUB 1YHLA 2E8UA 4LIXA 3LVSA 4LA6A 2Q9ZA 1WMWA 3LDWA 3VJBA 3MZVA 3WEHA 2Q80A 1UBVA 4NFJF 3QQVA 4DHDA 2FTZA 3UCAA 3W7FA 5HN7A 2PS4A 1PS1A 3WCBA 3V1VA 5HN9A 4LFEA 2F94F 2RAHA 3IPIA 4OGUA 5EASA 2H8OA 3WCJA 3RYWA 4QPFA 4XQSF 4OKZA 2I19A 2VF6A 4WK5A 5A0IA 5IN8A 3LGZB 2OPMA 1YJ4A 3KRAA 3PH7A 2OA6A 3N3LF 5ERNA 1EZFA 4JZBA 3BNYA 3OABA 4KQUA 2Q9YA 3WJOA 3WCGA 4RNQA 3MAVA 5ILDA 3ICZA 2E90A 1V4KA 3P5PA 1YHKA 3N1WF 4LOBA 2PS7A 4L2XF 4LTZA 4JXNA 2E94A 3ZMBA 4DWGA 4KKMA 3PYBA 3ADZA 4NUAA 5ER8A 3M0GA 3S9VA 3M02A 3LMDA 3WSAA 4UMJA 3SDVA 3EFQA 3WE9A 3KRCB 2ZCQA 3LLWA 5IMPA 3RBMA 4EA2A 2F7MF 5HN8A 5IL8A 5DW7A 3LOMA 2Z4XA 4RXEA 4KVYA 5AYPA 3PDEA 3Q2ZA 4DI5A 3KRFA 2E4OA 3TC1A 4P0XA 2ZCSA 3QKCA 2AZKA 4JXYA 5JV0F 4RXCA 1YYRA 3ZCDA 3VJCA 4KK2A 3TFVA 5JUZF 3WCMA 1WY0A 4GAXA 5IK6A 4DZWA 2E92A 4Q23A 4LLTA 2ZCRA 2ONGA 1N23A 3N5JF 2Z4VA 3ZL6A 4NKFA 1V4IA 3CP6A 1YYQA 1VG4A 3CKEA 4N9UA 5ILHA 4K10A 4LFVF 4E1EA 2Z52A 3P8RA 4RXAA 4P0VA 5JA0F 1VG2A 3ID0A 4MC0A 1RQJA 3WEGA 4LZ0A 3BNXA 3CC9A 1HM7A 3WJKA 4XQTF 5ERMA 4LXWA 2E95A 4F6XA 5DHKA 3WCLA 5IVGA 3SDTA 4LPHF 3WEKA 1FPSA 1YYSA 5HNAA 3N0GA 5DHIA 3WCCA 2AETA 5IM1A 5B01A 3EZ3A 4KWDA 2PS6A 3RMGA 4E9UA 2F8CF 2ZY1A 5DGSF 5ILYA 1DGPA 5B02A 5H9DA 5DGNF 3M9UA 4MC3A 5DZ2A 4N1ZF 5ILKA 3KRPB 1KIYA 3V66A 4LA5A 2PS5A 5E8HA 3KRFB 5E8KA 3OACB 5IKHA 1HXAA 4H5DF 3S4JA 3WJNA 5DJVF 5E8LA 1ZW5A 1RTRA 3WCHA 3TFPA 2Z50A 4FJQA 5B0JA 5IKAA 3ASXA 2ZEUA 4NG6A 4KVWA 2E93A 3N5HF 1V4EA 3SDUA 4KFAA 3P5RA 2P1CA 1N21A 1YQ7A 3WCFA 1HM4A 4KPJA 2QISA 3G4DA 4LFGA 1JFAA 1KIZA 3KBKA 5AELA 4KQ5A 4F6VA 3N46F 3DYGA 3M00A 3AQBB 5IK9A 5DJRF 3KB9A 2E91A 4KPDA 4KVDA 3APZA 1UBXA 4LZCA 2F8ZF 3P41A 2ZCOA 5B0KA 3PYAA 2OPNA 5I1UA 1VG6A 3ICNA 5A0KA 3SDRA 2Z7HA 1UBYA 4NKEA 4XQRF 3Q30A 4KUXA 1N20A 4DXJA 5B03A 3N6KF 3RYEA 1N22A 3WCAA 3KRAB 1N24A 5DGMF 5ILIA 3ACWA 3OABB 5AFXA 5EROA 5JV2F 3N3DA 3WEJA 4LPGF 4LZ3A 5B0LA 1VG7A 3WC9A 3NPRA 2Q58A 3TS7A 4DWBA 2Z7IA 5ILJA 3PKOA 3TFNA 3N1VF 3WEFA 4H5EF 3N0FA 4PVXF 2OGDA 2AZLA 3N49F 3SAEA 3LK5A 3M01A 1UBWA 5C05A 2DH4A 2FORA 3LG5A 3IBAA 3KRCA 3ACYA 3ACXA 4NFIF 4EA0A 2ONHA 5EATA 1YYTA 2E8VA 3KROA 4OMHA 3NF2A 2F92F 3P8LA 2E8WA 3ZMCA 3G4FA 5CG6A 1HXGA 2ZEVA 4EA1A 4P0WA 2PS8A 4RYPA 3VJ8A 4JZXA 1N1BA 1N1ZA 3V1XA 4F62A 4GP1A 1WL2A 4JYXA 4LTVA 5JV1F 1HX9A 3AE0A 2J1OA 5IL3A 3VJ9A 2AZJA 3VJAA 3EGTA 3ZOUA 3WEIA 3OYRA 3VJDA 3VJEA 2E8XA 4KQSA 4KVIA 1YYUA 1WL0A 3LZ9A 3WCEA 3AQ0A 2Z78A 2AEKA 3LGKA 3LSNA 5IK0A 5KSXF 3DYHA 3WSBA 1V4HA 4LLSA 3B7LA 2Z4YA 2AELA 3ICKA 4RXDA 3N45F 3AQCB 4QXSF 5EAUA 4MC8A 4HD1A 3SDQA 2F89F 1DI1A 2Z4WA 1WL1A 4PVYF 3Q2QA 5IMNA 1RQIA 4ZQ8A 5DJPF 2J1PA 1HXCA 3KRPA 2E8TA 1V4JA 5B0MA 2F9KF 3Q1OA 1YHMA 3NRIA 3OACA 3KROB 3LEEA 2EWGA 2J5CA 2O1OA 3DYFA 4FP4A 4DEMF 4GA3A 1YV5A 5CG5A 5ILZA 4E9ZA 4LUUA 4H5CF 3NPKA 4JVJF 5B0IA 5IMIA 3WCIA 5DIQF 1VG3A 4OMGA 5A0JA 4OKMA 3LJIA 4GP2A 1WKZA 1WL3A 2Z4ZA 3ICMA 4NFKF
chains in the Genus database with same CATH superfamily
3WCDA 5B00A 1JFGA 5AHUB 1YHLA 2E8UA 4LIXA 3LVSA 4LA6A 2Q9ZA 1WMWA 3LDWA 3VJBA 3MZVA 3WEHA 2Q80A 1UBVA 4NFJF 3QQVA 4DHDA 2FTZA 3UCAA 3W7FA 5HN7A 2PS4A 1PS1A 3WCBA 3V1VA 5HN9A 4LFEA 2F94F 2RAHA 3IPIA 4OGUA 5EASA 2H8OA 3WCJA 3RYWA 4QPFA 4XQSF 4OKZA 2I19A 2VF6A 4WK5A 5A0IA 5IN8A 3LGZB 2OPMA 1YJ4A 3KRAA 3PH7A 2OA6A 3N3LF 5ERNA 1EZFA 4JZBA 3BNYA 3OABA 4KQUA 2Q9YA 3WJOA 3WCGA 4RNQA 3MAVA 5ILDA 3ICZA 2E90A 1V4KA 3P5PA 1YHKA 3N1WF 4LOBA 2PS7A 4L2XF 4LTZA 4JXNA 2E94A 3ZMBA 4DWGA 4KKMA 3PYBA 3ADZA 4NUAA 5ER8A 3M0GA 3S9VA 3M02A 3LMDA 3WSAA 4UMJA 3SDVA 3EFQA 3WE9A 3KRCB 2ZCQA 3LLWA 5IMPA 3RBMA 4EA2A 2F7MF 5HN8A 5IL8A 5DW7A 3LOMA 2Z4XA 4RXEA 4KVYA 5AYPA 3PDEA 3Q2ZA 4DI5A 3KRFA 2E4OA 3TC1A 4P0XA 2ZCSA 3QKCA 2AZKA 4JXYA 5JV0F 4RXCA 1YYRA 3ZCDA 3VJCA 4KK2A 3TFVA 5JUZF 3WCMA 1WY0A 4GAXA 5IK6A 4DZWA 2E92A 4Q23A 4LLTA 2ZCRA 2ONGA 1N23A 3N5JF 2Z4VA 3ZL6A 4NKFA 1V4IA 3CP6A 1YYQA 1VG4A 3CKEA 4N9UA 5ILHA 4K10A 4LFVF 4E1EA 2Z52A 3P8RA 4RXAA 4P0VA 5JA0F 1VG2A 3ID0A 4MC0A 1RQJA 3WEGA 4LZ0A 3BNXA 3CC9A 1HM7A 3WJKA 4XQTF 5ERMA 4LXWA 2E95A 4F6XA 5DHKA 3WCLA 5IVGA 3SDTA 4LPHF 3WEKA 1FPSA 1YYSA 5HNAA 3N0GA 5DHIA 3WCCA 2AETA 5IM1A 5B01A 3EZ3A 4KWDA 2PS6A 3RMGA 4E9UA 2F8CF 2ZY1A 5DGSF 5ILYA 1DGPA 5B02A 5H9DA 5DGNF 3M9UA 4MC3A 5DZ2A 4N1ZF 5ILKA 3KRPB 1KIYA 3V66A 4LA5A 2PS5A 5E8HA 3KRFB 5E8KA 3OACB 5IKHA 1HXAA 4H5DF 3S4JA 3WJNA 5DJVF 5E8LA 1ZW5A 1RTRA 3WCHA 3TFPA 2Z50A 4FJQA 5B0JA 5IKAA 3ASXA 2ZEUA 4NG6A 4KVWA 2E93A 3N5HF 1V4EA 3SDUA 4KFAA 3P5RA 2P1CA 1N21A 1YQ7A 3WCFA 1HM4A 4KPJA 2QISA 3G4DA 4LFGA 1JFAA 1KIZA 3KBKA 5AELA 4KQ5A 4F6VA 3N46F 3DYGA 3M00A 3AQBB 5IK9A 5DJRF 3KB9A 2E91A 4KPDA 4KVDA 3APZA 1UBXA 4LZCA 2F8ZF 3P41A 2ZCOA 5B0KA 3PYAA 2OPNA 5I1UA 1VG6A 3ICNA 5A0KA 3SDRA 2Z7HA 1UBYA 4NKEA 4XQRF 3Q30A 4KUXA 1N20A 4DXJA 5B03A 3N6KF 3RYEA 1N22A 3WCAA 3KRAB 1N24A 5DGMF 5ILIA 3ACWA 3OABB 5AFXA 5EROA 5JV2F 3N3DA 3WEJA 4LPGF 4LZ3A 5B0LA 1VG7A 3WC9A 3NPRA 2Q58A 3TS7A 4DWBA 2Z7IA 5ILJA 3PKOA 3TFNA 3N1VF 3WEFA 4H5EF 3N0FA 4PVXF 2OGDA 2AZLA 3N49F 3SAEA 3LK5A 3M01A 1UBWA 5C05A 2DH4A 2FORA 3LG5A 3IBAA 3KRCA 3ACYA 3ACXA 4NFIF 4EA0A 2ONHA 5EATA 1YYTA 2E8VA 3KROA 4OMHA 3NF2A 2F92F 3P8LA 2E8WA 3ZMCA 3G4FA 5CG6A 1HXGA 2ZEVA 4EA1A 4P0WA 2PS8A 4RYPA 3VJ8A 4JZXA 1N1BA 1N1ZA 3V1XA 4F62A 4GP1A 1WL2A 4JYXA 4LTVA 5JV1F 1HX9A 3AE0A 2J1OA 5IL3A 3VJ9A 2AZJA 3VJAA 3EGTA 3ZOUA 3WEIA 3OYRA 3VJDA 3VJEA 2E8XA 4KQSA 4KVIA 1YYUA 1WL0A 3LZ9A 3WCEA 3AQ0A 2Z78A 2AEKA 3LGKA 3LSNA 5IK0A 5KSXF 3DYHA 3WSBA 1V4HA 4LLSA 3B7LA 2Z4YA 2AELA 3ICKA 4RXDA 3N45F 3AQCB 4QXSF 5EAUA 4MC8A 4HD1A 3SDQA 2F89F 1DI1A 2Z4WA 1WL1A 4PVYF 3Q2QA 5IMNA 1RQIA 4ZQ8A 5DJPF 2J1PA 1HXCA 3KRPA 2E8TA 1V4JA 5B0MA 2F9KF 3Q1OA 1YHMA 3NRIA 3OACA 3KROB 3LEEA 2EWGA 2J5CA 2O1OA 3DYFA 4FP4A 4DEMF 4GA3A 1YV5A 5CG5A 5ILZA 4E9ZA 4LUUA 4H5CF 3NPKA 4JVJF 5B0IA 5IMIA 3WCIA 5DIQF 1VG3A 4OMGA 5A0JA 4OKMA 3LJIA 4GP2A 1WKZA 1WL3A 2Z4ZA 3ICMA 4NFKF
chains in the Genus database with same CATH topology
3WCDA 5B00A 1JFGA 5AHUB 1YHLA 2E8UA 4LIXA 3LVSA 4LA6A 2Q9ZA 1WMWA 3LDWA 3VJBA 3MZVA 3WEHA 2Q80A 1UBVA 4NFJF 3QQVA 4DHDA 2FTZA 3UCAA 3W7FA 5HN7A 2PS4A 1PS1A 3WCBA 3V1VA 5HN9A 4LFEA 2F94F 2RAHA 3IPIA 4OGUA 5EASA 2H8OA 3WCJA 3RYWA 4QPFA 4XQSF 4OKZA 2I19A 2VF6A 4WK5A 5A0IA 5IN8A 3LGZB 2OPMA 1YJ4A 3KRAA 3PH7A 2OA6A 3N3LF 5ERNA 1EZFA 4JZBA 3BNYA 3OABA 4KQUA 2Q9YA 3WJOA 3WCGA 4RNQA 3MAVA 5ILDA 3ICZA 2E90A 1V4KA 3P5PA 1YHKA 3N1WF 4LOBA 2PS7A 4L2XF 4LTZA 4JXNA 2E94A 3ZMBA 4DWGA 4KKMA 3PYBA 3ADZA 4NUAA 5ER8A 3M0GA 3S9VA 3M02A 3LMDA 3WSAA 4UMJA 3SDVA 3EFQA 3WE9A 3KRCB 2ZCQA 3LLWA 5IMPA 3RBMA 4EA2A 2F7MF 5HN8A 5IL8A 5DW7A 3LOMA 2Z4XA 4RXEA 4KVYA 5AYPA 3PDEA 3Q2ZA 4DI5A 3KRFA 2E4OA 3TC1A 4P0XA 2ZCSA 3QKCA 2AZKA 4JXYA 5JV0F 4RXCA 1YYRA 3ZCDA 3VJCA 4KK2A 3TFVA 5JUZF 3WCMA 1WY0A 4GAXA 5IK6A 4DZWA 2E92A 4Q23A 4LLTA 2ZCRA 2ONGA 1N23A 3N5JF 2Z4VA 3ZL6A 4NKFA 1V4IA 3CP6A 1YYQA 1VG4A 3CKEA 4N9UA 5ILHA 4K10A 4LFVF 4E1EA 2Z52A 3P8RA 4RXAA 4P0VA 5JA0F 1VG2A 3ID0A 4MC0A 1RQJA 3WEGA 4LZ0A 3BNXA 3CC9A 1HM7A 3WJKA 4XQTF 5ERMA 4LXWA 2E95A 4F6XA 5DHKA 3WCLA 5IVGA 3SDTA 4LPHF 3WEKA 1FPSA 1YYSA 5HNAA 3N0GA 5DHIA 3WCCA 2AETA 5IM1A 5B01A 3EZ3A 4KWDA 2PS6A 3RMGA 4E9UA 2F8CF 2ZY1A 5DGSF 5ILYA 1DGPA 5B02A 5H9DA 5DGNF 3M9UA 4MC3A 5DZ2A 4N1ZF 5ILKA 3KRPB 1KIYA 3V66A 4LA5A 2PS5A 5E8HA 3KRFB 5E8KA 3OACB 5IKHA 1HXAA 4H5DF 3S4JA 3WJNA 5DJVF 5E8LA 1ZW5A 1RTRA 3WCHA 3TFPA 2Z50A 4FJQA 5B0JA 5IKAA 3ASXA 2ZEUA 4NG6A 4KVWA 2E93A 3N5HF 1V4EA 3SDUA 4KFAA 3P5RA 2P1CA 1N21A 1YQ7A 3WCFA 1HM4A 4KPJA 2QISA 3G4DA 4LFGA 1JFAA 1KIZA 3KBKA 5AELA 4KQ5A 4F6VA 3N46F 3DYGA 3M00A 3AQBB 5IK9A 5DJRF 3KB9A 2E91A 4KPDA 4KVDA 3APZA 1UBXA 4LZCA 2F8ZF 3P41A 2ZCOA 5B0KA 3PYAA 2OPNA 5I1UA 1VG6A 3ICNA 5A0KA 3SDRA 2Z7HA 1UBYA 4NKEA 4XQRF 3Q30A 4KUXA 1N20A 4DXJA 5B03A 3N6KF 3RYEA 1N22A 3WCAA 3KRAB 1N24A 5DGMF 5ILIA 3ACWA 3OABB 5AFXA 5EROA 5JV2F 3N3DA 3WEJA 4LPGF 4LZ3A 5B0LA 1VG7A 3WC9A 3NPRA 2Q58A 3TS7A 4DWBA 2Z7IA 5ILJA 3PKOA 3TFNA 3N1VF 3WEFA 4H5EF 3N0FA 4PVXF 2OGDA 2AZLA 3N49F 3SAEA 3LK5A 3M01A 1UBWA 5C05A 2DH4A 2FORA 3LG5A 3IBAA 3KRCA 3ACYA 3ACXA 4NFIF 4EA0A 2ONHA 5EATA 1YYTA 2E8VA 3KROA 4OMHA 3NF2A 2F92F 3P8LA 2E8WA 3ZMCA 3G4FA 5CG6A 1HXGA 2ZEVA 4EA1A 4P0WA 2PS8A 4RYPA 3VJ8A 4JZXA 1N1BA 1N1ZA 3V1XA 4F62A 4GP1A 1WL2A 4JYXA 4LTVA 5JV1F 1HX9A 3AE0A 2J1OA 5IL3A 3VJ9A 2AZJA 3VJAA 3EGTA 3ZOUA 3WEIA 3OYRA 3VJDA 3VJEA 2E8XA 4KQSA 4KVIA 1YYUA 1WL0A 3LZ9A 3WCEA 3AQ0A 2Z78A 2AEKA 3LGKA 3LSNA 5IK0A 5KSXF 3DYHA 3WSBA 1V4HA 4LLSA 3B7LA 2Z4YA 2AELA 3ICKA 4RXDA 3N45F 3AQCB 4QXSF 5EAUA 4MC8A 4HD1A 3SDQA 2F89F 1DI1A 2Z4WA 1WL1A 4PVYF 3Q2QA 5IMNA 1RQIA 4ZQ8A 5DJPF 2J1PA 1HXCA 3KRPA 2E8TA 1V4JA 5B0MA 2F9KF 3Q1OA 1YHMA 3NRIA 3OACA 3KROB 3LEEA 2EWGA 2J5CA 2O1OA 3DYFA 4FP4A 4DEMF 4GA3A 1YV5A 5CG5A 5ILZA 4E9ZA 4LUUA 4H5CF 3NPKA 4JVJF 5B0IA 5IMIA 3WCIA 5DIQF 1VG3A 4OMGA 5A0JA 4OKMA 3LJIA 4GP2A 1WKZA 1WL3A 2Z4ZA 3ICMA 4NFKF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCD A;  5B00 A;  1JFG A;  5AHU B;  1YHL A;  2E8U A;  4LIX A;  3LVS A;  4LA6 A;  2Q9Z A;  1WMW A;  3LDW A;  3VJB A;  3MZV A;  3WEH A;  2Q80 A;  1UBV A;  4NFJ F;  3QQV A;  4DHD A;  2FTZ A;  3UCA A;  3W7F A;  5HN7 A;  2PS4 A;  1PS1 A;  3WCB A;  3V1V A;  5HN9 A;  4LFE A;  2F94 F;  2RAH A;  3IPI A;  4OGU A;  5EAS A;  2H8O A;  3WCJ A;  3RYW A;  4QPF A;  4XQS F;  4OKZ A;  2I19 A;  2VF6 A;  4WK5 A;  5A0I A;  5IN8 A;  3LGZ B;  2OPM A;  1YJ4 A;  3KRA A;  3PH7 A;  2OA6 A;  3N3L F;  5ERN A;  1EZF A;  4JZB A;  3BNY A;  3OAB A;  4KQU A;  2Q9Y A;  3WJO A;  3WCG A;  4RNQ A;  3MAV A;  5ILD A;  3ICZ A;  2E90 A;  1V4K A;  3P5P A;  1YHK A;  3N1W F;  4LOB A;  2PS7 A;  4L2X F;  4LTZ A;  4JXN A;  2E94 A;  3ZMB A;  4DWG A;  4KKM A;  3PYB A;  3ADZ A;  4NUA A;  5ER8 A;  3M0G A;  3S9V A;  3M02 A;  3LMD A;  3WSA A;  4UMJ A;  3SDV A;  3EFQ A;  3WE9 A;  3KRC B;  2ZCQ A;  3LLW A;  5IMP A;  3RBM A;  4EA2 A;  2F7M F;  5HN8 A;  5IL8 A;  5DW7 A;  3LOM A;  2Z4X A;  4RXE A;  4KVY A;  5AYP A;  3PDE A;  3Q2Z A;  4DI5 A;  3KRF A;  2E4O A;  3TC1 A;  4P0X A;  2ZCS A;  3QKC A;  2AZK A;  4JXY A;  5JV0 F;  4RXC A;  1YYR A;  3ZCD A;  3VJC A;  4KK2 A;  3TFV A;  5JUZ F;  3WCM A;  1WY0 A;  4GAX A;  5IK6 A;  4DZW A;  2E92 A;  4Q23 A;  4LLT A;  2ZCR A;  2ONG A;  1N23 A;  3N5J F;  2Z4V A;  3ZL6 A;  4NKF A;  1V4I A;  3CP6 A;  1YYQ A;  1VG4 A;  3CKE A;  4N9U A;  5ILH A;  4K10 A;  4LFV F;  4E1E A;  2Z52 A;  3P8R A;  4RXA A;  4P0V A;  5JA0 F;  1VG2 A;  3ID0 A;  4MC0 A;  1RQJ A;  3WEG A;  4LZ0 A;  3BNX A;  3CC9 A;  1HM7 A;  3WJK A;  4XQT F;  5ERM A;  4LXW A;  2E95 A;  4F6X A;  5DHK A;  3WCL A;  5IVG A;  3SDT A;  4LPH F;  3WEK A;  1FPS A;  1YYS A;  5HNA A;  3N0G A;  5DHI A;  3WCC A;  2AET A;  5IM1 A;  5B01 A;  3EZ3 A;  4KWD A;  2PS6 A;  3RMG A;  4E9U A;  2F8C F;  2ZY1 A;  5DGS F;  5ILY A;  1DGP A;  5B02 A;  5H9D A;  5DGN F;  3M9U A;  4MC3 A;  5DZ2 A;  4N1Z F;  5ILK A;  3KRP B;  1KIY A;  3V66 A;  4LA5 A;  2PS5 A;  5E8H A;  3KRF B;  5E8K A;  3OAC B;  5IKH A;  1HXA A;  4H5D F;  3S4J A;  3WJN A;  5DJV F;  5E8L A;  1ZW5 A;  1RTR A;  3WCH A;  3TFP A;  2Z50 A;  4FJQ A;  5B0J A;  5IKA A;  3ASX A;  2ZEU A;  4NG6 A;  4KVW A;  2E93 A;  3N5H F;  1V4E A;  3SDU A;  4KFA A;  3P5R A;  2P1C A;  1N21 A;  1YQ7 A;  3WCF A;  1HM4 A;  4KPJ A;  2QIS A;  3G4D A;  4LFG A;  1JFA A;  1KIZ A;  3KBK A;  5AEL A;  4KQ5 A;  4F6V A;  3N46 F;  3DYG A;  3M00 A;  3AQB B;  5IK9 A;  5DJR F;  3KB9 A;  2E91 A;  4KPD A;  4KVD A;  3APZ A;  1UBX A;  4LZC A;  2F8Z F;  3P41 A;  2ZCO A;  5B0K A;  3PYA A;  2OPN A;  5I1U A;  1VG6 A;  3ICN A;  5A0K A;  3SDR A;  2Z7H A;  1UBY A;  4NKE A;  4XQR F;  3Q30 A;  4KUX A;  1N20 A;  4DXJ A;  5B03 A;  3N6K F;  3RYE A;  1N22 A;  3WCA A;  3KRA B;  1N24 A;  5DGM F;  5ILI A;  3ACW A;  3OAB B;  5AFX A;  5ERO A;  5JV2 F;  3N3D A;  3WEJ A;  4LPG F;  4LZ3 A;  5B0L A;  1VG7 A;  3WC9 A;  3NPR A;  2Q58 A;  3TS7 A;  4DWB A;  2Z7I A;  5ILJ A;  3PKO A;  3TFN A;  3N1V F;  3WEF A;  4H5E F;  3N0F A;  4PVX F;  2OGD A;  2AZL A;  3N49 F;  3SAE A;  3LK5 A;  3M01 A;  1UBW A;  5C05 A;  2DH4 A;  2FOR A;  3LG5 A;  3IBA A;  3KRC A;  3ACY A;  3ACX A;  4NFI F;  4EA0 A;  2ONH A;  5EAT A;  1YYT A;  2E8V A;  3KRO A;  4OMH A;  3NF2 A;  2F92 F;  3P8L A;  2E8W A;  3ZMC A;  3G4F A;  5CG6 A;  1HXG A;  2ZEV A;  4EA1 A;  4P0W A;  2PS8 A;  4RYP A;  3VJ8 A;  4JZX A;  1N1B A;  1N1Z A;  3V1X A;  4F62 A;  4GP1 A;  1WL2 A;  4JYX A;  4LTV A;  5JV1 F;  1HX9 A;  3AE0 A;  2J1O A;  5IL3 A;  3VJ9 A;  2AZJ A;  3VJA A;  3EGT A;  3ZOU A;  3WEI A;  3OYR A;  3VJD A;  3VJE A;  2E8X A;  4KQS A;  4KVI A;  1YYU A;  1WL0 A;  3LZ9 A;  3WCE A;  3AQ0 A;  2Z78 A;  2AEK A;  3LGK A;  3LSN A;  5IK0 A;  5KSX F;  3DYH A;  3WSB A;  1V4H A;  4LLS A;  3B7L A;  2Z4Y A;  2AEL A;  3ICK A;  4RXD A;  3N45 F;  3AQC B;  4QXS F;  5EAU A;  4MC8 A;  4HD1 A;  3SDQ A;  2F89 F;  1DI1 A;  2Z4W A;  1WL1 A;  4PVY F;  3Q2Q A;  5IMN A;  1RQI A;  4ZQ8 A;  5DJP F;  2J1P A;  1HXC A;  3KRP A;  2E8T A;  1V4J A;  5B0M A;  2F9K F;  3Q1O A;  1YHM A;  3NRI A;  3OAC A;  3KRO B;  3LEE A;  2EWG A;  2J5C A;  2O1O A;  3DYF A;  4FP4 A;  4DEM F;  4GA3 A;  1YV5 A;  5CG5 A;  5ILZ A;  4E9Z A;  4LUU A;  4H5C F;  3NPK A;  4JVJ F;  5B0I A;  5IMI A;  3WCI A;  5DIQ F;  1VG3 A;  4OMG A;  5A0J A;  4OKM A;  3LJI A;  4GP2 A;  1WKZ A;  1WL3 A;  2Z4Z A;  3ICM A;  4NFK F; 
#chains in the Genus database with same CATH topology
 3WCD A;  5B00 A;  1JFG A;  5AHU B;  1YHL A;  2E8U A;  4LIX A;  3LVS A;  4LA6 A;  2Q9Z A;  1WMW A;  3LDW A;  3VJB A;  3MZV A;  3WEH A;  2Q80 A;  1UBV A;  4NFJ F;  3QQV A;  4DHD A;  2FTZ A;  3UCA A;  3W7F A;  5HN7 A;  2PS4 A;  1PS1 A;  3WCB A;  3V1V A;  5HN9 A;  4LFE A;  2F94 F;  2RAH A;  3IPI A;  4OGU A;  5EAS A;  2H8O A;  3WCJ A;  3RYW A;  4QPF A;  4XQS F;  4OKZ A;  2I19 A;  2VF6 A;  4WK5 A;  5A0I A;  5IN8 A;  3LGZ B;  2OPM A;  1YJ4 A;  3KRA A;  3PH7 A;  2OA6 A;  3N3L F;  5ERN A;  1EZF A;  4JZB A;  3BNY A;  3OAB A;  4KQU A;  2Q9Y A;  3WJO A;  3WCG A;  4RNQ A;  3MAV A;  5ILD A;  3ICZ A;  2E90 A;  1V4K A;  3P5P A;  1YHK A;  3N1W F;  4LOB A;  2PS7 A;  4L2X F;  4LTZ A;  4JXN A;  2E94 A;  3ZMB A;  4DWG A;  4KKM A;  3PYB A;  3ADZ A;  4NUA A;  5ER8 A;  3M0G A;  3S9V A;  3M02 A;  3LMD A;  3WSA A;  4UMJ A;  3SDV A;  3EFQ A;  3WE9 A;  3KRC B;  2ZCQ A;  3LLW A;  5IMP A;  3RBM A;  4EA2 A;  2F7M F;  5HN8 A;  5IL8 A;  5DW7 A;  3LOM A;  2Z4X A;  4RXE A;  4KVY A;  5AYP A;  3PDE A;  3Q2Z A;  4DI5 A;  3KRF A;  2E4O A;  3TC1 A;  4P0X A;  2ZCS A;  3QKC A;  2AZK A;  4JXY A;  5JV0 F;  4RXC A;  1YYR A;  3ZCD A;  3VJC A;  4KK2 A;  3TFV A;  5JUZ F;  3WCM A;  1WY0 A;  4GAX A;  5IK6 A;  4DZW A;  2E92 A;  4Q23 A;  4LLT A;  2ZCR A;  2ONG A;  1N23 A;  3N5J F;  2Z4V A;  3ZL6 A;  4NKF A;  1V4I A;  3CP6 A;  1YYQ A;  1VG4 A;  3CKE A;  4N9U A;  5ILH A;  4K10 A;  4LFV F;  4E1E A;  2Z52 A;  3P8R A;  4RXA A;  4P0V A;  5JA0 F;  1VG2 A;  3ID0 A;  4MC0 A;  1RQJ A;  3WEG A;  4LZ0 A;  3BNX A;  3CC9 A;  1HM7 A;  3WJK A;  4XQT F;  5ERM A;  4LXW A;  2E95 A;  4F6X A;  5DHK A;  3WCL A;  5IVG A;  3SDT A;  4LPH F;  3WEK A;  1FPS A;  1YYS A;  5HNA A;  3N0G A;  5DHI A;  3WCC A;  2AET A;  5IM1 A;  5B01 A;  3EZ3 A;  4KWD A;  2PS6 A;  3RMG A;  4E9U A;  2F8C F;  2ZY1 A;  5DGS F;  5ILY A;  1DGP A;  5B02 A;  5H9D A;  5DGN F;  3M9U A;  4MC3 A;  5DZ2 A;  4N1Z F;  5ILK A;  3KRP B;  1KIY A;  3V66 A;  4LA5 A;  2PS5 A;  5E8H A;  3KRF B;  5E8K A;  3OAC B;  5IKH A;  1HXA A;  4H5D F;  3S4J A;  3WJN A;  5DJV F;  5E8L A;  1ZW5 A;  1RTR A;  3WCH A;  3TFP A;  2Z50 A;  4FJQ A;  5B0J A;  5IKA A;  3ASX A;  2ZEU A;  4NG6 A;  4KVW A;  2E93 A;  3N5H F;  1V4E A;  3SDU A;  4KFA A;  3P5R A;  2P1C A;  1N21 A;  1YQ7 A;  3WCF A;  1HM4 A;  4KPJ A;  2QIS A;  3G4D A;  4LFG A;  1JFA A;  1KIZ A;  3KBK A;  5AEL A;  4KQ5 A;  4F6V A;  3N46 F;  3DYG A;  3M00 A;  3AQB B;  5IK9 A;  5DJR F;  3KB9 A;  2E91 A;  4KPD A;  4KVD A;  3APZ A;  1UBX A;  4LZC A;  2F8Z F;  3P41 A;  2ZCO A;  5B0K A;  3PYA A;  2OPN A;  5I1U A;  1VG6 A;  3ICN A;  5A0K A;  3SDR A;  2Z7H A;  1UBY A;  4NKE A;  4XQR F;  3Q30 A;  4KUX A;  1N20 A;  4DXJ A;  5B03 A;  3N6K F;  3RYE A;  1N22 A;  3WCA A;  3KRA B;  1N24 A;  5DGM F;  5ILI A;  3ACW A;  3OAB B;  5AFX A;  5ERO A;  5JV2 F;  3N3D A;  3WEJ A;  4LPG F;  4LZ3 A;  5B0L A;  1VG7 A;  3WC9 A;  3NPR A;  2Q58 A;  3TS7 A;  4DWB A;  2Z7I A;  5ILJ A;  3PKO A;  3TFN A;  3N1V F;  3WEF A;  4H5E F;  3N0F A;  4PVX F;  2OGD A;  2AZL A;  3N49 F;  3SAE A;  3LK5 A;  3M01 A;  1UBW A;  5C05 A;  2DH4 A;  2FOR A;  3LG5 A;  3IBA A;  3KRC A;  3ACY A;  3ACX A;  4NFI F;  4EA0 A;  2ONH A;  5EAT A;  1YYT A;  2E8V A;  3KRO A;  4OMH A;  3NF2 A;  2F92 F;  3P8L A;  2E8W A;  3ZMC A;  3G4F A;  5CG6 A;  1HXG A;  2ZEV A;  4EA1 A;  4P0W A;  2PS8 A;  4RYP A;  3VJ8 A;  4JZX A;  1N1B A;  1N1Z A;  3V1X A;  4F62 A;  4GP1 A;  1WL2 A;  4JYX A;  4LTV A;  5JV1 F;  1HX9 A;  3AE0 A;  2J1O A;  5IL3 A;  3VJ9 A;  2AZJ A;  3VJA A;  3EGT A;  3ZOU A;  3WEI A;  3OYR A;  3VJD A;  3VJE A;  2E8X A;  4KQS A;  4KVI A;  1YYU A;  1WL0 A;  3LZ9 A;  3WCE A;  3AQ0 A;  2Z78 A;  2AEK A;  3LGK A;  3LSN A;  5IK0 A;  5KSX F;  3DYH A;  3WSB A;  1V4H A;  4LLS A;  3B7L A;  2Z4Y A;  2AEL A;  3ICK A;  4RXD A;  3N45 F;  3AQC B;  4QXS F;  5EAU A;  4MC8 A;  4HD1 A;  3SDQ A;  2F89 F;  1DI1 A;  2Z4W A;  1WL1 A;  4PVY F;  3Q2Q A;  5IMN A;  1RQI A;  4ZQ8 A;  5DJP F;  2J1P A;  1HXC A;  3KRP A;  2E8T A;  1V4J A;  5B0M A;  2F9K F;  3Q1O A;  1YHM A;  3NRI A;  3OAC A;  3KRO B;  3LEE A;  2EWG A;  2J5C A;  2O1O A;  3DYF A;  4FP4 A;  4DEM F;  4GA3 A;  1YV5 A;  5CG5 A;  5ILZ A;  4E9Z A;  4LUU A;  4H5C F;  3NPK A;  4JVJ F;  5B0I A;  5IMI A;  3WCI A;  5DIQ F;  1VG3 A;  4OMG A;  5A0J A;  4OKM A;  3LJI A;  4GP2 A;  1WKZ A;  1WL3 A;  2Z4Z A;  3ICM A;  4NFK F; 
#chains in the Genus database with same CATH homology
 3WCD A;  5B00 A;  1JFG A;  5AHU B;  1YHL A;  2E8U A;  4LIX A;  3LVS A;  4LA6 A;  2Q9Z A;  1WMW A;  3LDW A;  3VJB A;  3MZV A;  3WEH A;  2Q80 A;  1UBV A;  4NFJ F;  3QQV A;  4DHD A;  2FTZ A;  3UCA A;  3W7F A;  5HN7 A;  2PS4 A;  1PS1 A;  3WCB A;  3V1V A;  5HN9 A;  4LFE A;  2F94 F;  2RAH A;  3IPI A;  4OGU A;  5EAS A;  2H8O A;  3WCJ A;  3RYW A;  4QPF A;  4XQS F;  4OKZ A;  2I19 A;  2VF6 A;  4WK5 A;  5A0I A;  5IN8 A;  3LGZ B;  2OPM A;  1YJ4 A;  3KRA A;  3PH7 A;  2OA6 A;  3N3L F;  5ERN A;  1EZF A;  4JZB A;  3BNY A;  3OAB A;  4KQU A;  2Q9Y A;  3WJO A;  3WCG A;  4RNQ A;  3MAV A;  5ILD A;  3ICZ A;  2E90 A;  1V4K A;  3P5P A;  1YHK A;  3N1W F;  4LOB A;  2PS7 A;  4L2X F;  4LTZ A;  4JXN A;  2E94 A;  3ZMB A;  4DWG A;  4KKM A;  3PYB A;  3ADZ A;  4NUA A;  5ER8 A;  3M0G A;  3S9V A;  3M02 A;  3LMD A;  3WSA A;  4UMJ A;  3SDV A;  3EFQ A;  3WE9 A;  3KRC B;  2ZCQ A;  3LLW A;  5IMP A;  3RBM A;  4EA2 A;  2F7M F;  5HN8 A;  5IL8 A;  5DW7 A;  3LOM A;  2Z4X A;  4RXE A;  4KVY A;  5AYP A;  3PDE A;  3Q2Z A;  4DI5 A;  3KRF A;  2E4O A;  3TC1 A;  4P0X A;  2ZCS A;  3QKC A;  2AZK A;  4JXY A;  5JV0 F;  4RXC A;  1YYR A;  3ZCD A;  3VJC A;  4KK2 A;  3TFV A;  5JUZ F;  3WCM A;  1WY0 A;  4GAX A;  5IK6 A;  4DZW A;  2E92 A;  4Q23 A;  4LLT A;  2ZCR A;  2ONG A;  1N23 A;  3N5J F;  2Z4V A;  3ZL6 A;  4NKF A;  1V4I A;  3CP6 A;  1YYQ A;  1VG4 A;  3CKE A;  4N9U A;  5ILH A;  4K10 A;  4LFV F;  4E1E A;  2Z52 A;  3P8R A;  4RXA A;  4P0V A;  5JA0 F;  1VG2 A;  3ID0 A;  4MC0 A;  1RQJ A;  3WEG A;  4LZ0 A;  3BNX A;  3CC9 A;  1HM7 A;  3WJK A;  4XQT F;  5ERM A;  4LXW A;  2E95 A;  4F6X A;  5DHK A;  3WCL A;  5IVG A;  3SDT A;  4LPH F;  3WEK A;  1FPS A;  1YYS A;  5HNA A;  3N0G A;  5DHI A;  3WCC A;  2AET A;  5IM1 A;  5B01 A;  3EZ3 A;  4KWD A;  2PS6 A;  3RMG A;  4E9U A;  2F8C F;  2ZY1 A;  5DGS F;  5ILY A;  1DGP A;  5B02 A;  5H9D A;  5DGN F;  3M9U A;  4MC3 A;  5DZ2 A;  4N1Z F;  5ILK A;  3KRP B;  1KIY A;  3V66 A;  4LA5 A;  2PS5 A;  5E8H A;  3KRF B;  5E8K A;  3OAC B;  5IKH A;  1HXA A;  4H5D F;  3S4J A;  3WJN A;  5DJV F;  5E8L A;  1ZW5 A;  1RTR A;  3WCH A;  3TFP A;  2Z50 A;  4FJQ A;  5B0J A;  5IKA A;  3ASX A;  2ZEU A;  4NG6 A;  4KVW A;  2E93 A;  3N5H F;  1V4E A;  3SDU A;  4KFA A;  3P5R A;  2P1C A;  1N21 A;  1YQ7 A;  3WCF A;  1HM4 A;  4KPJ A;  2QIS A;  3G4D A;  4LFG A;  1JFA A;  1KIZ A;  3KBK A;  5AEL A;  4KQ5 A;  4F6V A;  3N46 F;  3DYG A;  3M00 A;  3AQB B;  5IK9 A;  5DJR F;  3KB9 A;  2E91 A;  4KPD A;  4KVD A;  3APZ A;  1UBX A;  4LZC A;  2F8Z F;  3P41 A;  2ZCO A;  5B0K A;  3PYA A;  2OPN A;  5I1U A;  1VG6 A;  3ICN A;  5A0K A;  3SDR A;  2Z7H A;  1UBY A;  4NKE A;  4XQR F;  3Q30 A;  4KUX A;  1N20 A;  4DXJ A;  5B03 A;  3N6K F;  3RYE A;  1N22 A;  3WCA A;  3KRA B;  1N24 A;  5DGM F;  5ILI A;  3ACW A;  3OAB B;  5AFX A;  5ERO A;  5JV2 F;  3N3D A;  3WEJ A;  4LPG F;  4LZ3 A;  5B0L A;  1VG7 A;  3WC9 A;  3NPR A;  2Q58 A;  3TS7 A;  4DWB A;  2Z7I A;  5ILJ A;  3PKO A;  3TFN A;  3N1V F;  3WEF A;  4H5E F;  3N0F A;  4PVX F;  2OGD A;  2AZL A;  3N49 F;  3SAE A;  3LK5 A;  3M01 A;  1UBW A;  5C05 A;  2DH4 A;  2FOR A;  3LG5 A;  3IBA A;  3KRC A;  3ACY A;  3ACX A;  4NFI F;  4EA0 A;  2ONH A;  5EAT A;  1YYT A;  2E8V A;  3KRO A;  4OMH A;  3NF2 A;  2F92 F;  3P8L A;  2E8W A;  3ZMC A;  3G4F A;  5CG6 A;  1HXG A;  2ZEV A;  4EA1 A;  4P0W A;  2PS8 A;  4RYP A;  3VJ8 A;  4JZX A;  1N1B A;  1N1Z A;  3V1X A;  4F62 A;  4GP1 A;  1WL2 A;  4JYX A;  4LTV A;  5JV1 F;  1HX9 A;  3AE0 A;  2J1O A;  5IL3 A;  3VJ9 A;  2AZJ A;  3VJA A;  3EGT A;  3ZOU A;  3WEI A;  3OYR A;  3VJD A;  3VJE A;  2E8X A;  4KQS A;  4KVI A;  1YYU A;  1WL0 A;  3LZ9 A;  3WCE A;  3AQ0 A;  2Z78 A;  2AEK A;  3LGK A;  3LSN A;  5IK0 A;  5KSX F;  3DYH A;  3WSB A;  1V4H A;  4LLS A;  3B7L A;  2Z4Y A;  2AEL A;  3ICK A;  4RXD A;  3N45 F;  3AQC B;  4QXS F;  5EAU A;  4MC8 A;  4HD1 A;  3SDQ A;  2F89 F;  1DI1 A;  2Z4W A;  1WL1 A;  4PVY F;  3Q2Q A;  5IMN A;  1RQI A;  4ZQ8 A;  5DJP F;  2J1P A;  1HXC A;  3KRP A;  2E8T A;  1V4J A;  5B0M A;  2F9K F;  3Q1O A;  1YHM A;  3NRI A;  3OAC A;  3KRO B;  3LEE A;  2EWG A;  2J5C A;  2O1O A;  3DYF A;  4FP4 A;  4DEM F;  4GA3 A;  1YV5 A;  5CG5 A;  5ILZ A;  4E9Z A;  4LUU A;  4H5C F;  3NPK A;  4JVJ F;  5B0I A;  5IMI A;  3WCI A;  5DIQ F;  1VG3 A;  4OMG A;  5A0J A;  4OKM A;  3LJI A;  4GP2 A;  1WKZ A;  1WL3 A;  2Z4Z A;  3ICM A;  4NFK F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...