3W7FA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with farnesyl thiopyrophosphate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dehydrosqualene synthase
publication title A cholesterol biosynthesis inhibitor blocks Staphylococcus aureus virulence.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 116
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2013-02-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3w7fA00
5DGMF 5DIQF 1WMWA 5B0MA 4XQRF 3TFVA 1N1ZA 4KKMA 3UCAA 1YQ7A 3Q2ZA 3N1VF 4MC8A 3M01A 3LK5A 2E92A 2ONHA 1V4HA 1YV5A 3TC1A 5B0KA 3NPKA 1DI1A 4LOBA 2H8OA 1EZFA 1V4IA 5ILZA 1HM7A 3QKCA 3KRFA 2Z50A 2F7MF 3OACB 3VJBA 4OKZA 4LXWA 3WCLA 5AHUB 3ADZA 4NFKF 3IPIA 5A0JA 5IN8A 1YYTA 3ZOUA 5EASA 4DEMF 5HNAA 1YYSA 3N5HF 4KQUA 3WJNA 4F62A 3AE0A 4EA0A 2ZCQA 3ICMA 3Q2QA 4GP2A 3WEJA 3N6KF 3LZ9A 4DWBA 3VJDA 5IMPA 2J5CA 2Q9YA 2P1CA 5DGNF 5ILDA 1YHKA 4EA2A 2E8TA 5E8LA 3KROB 3LGKA 1YYRA 5B0JA 4DZWA 5HN9A 4KVIA 1HXAA 5DZ2A 4LUUA 4DHDA 1UBVA 3ACXA 4KQSA 3VJAA 4JZXA 5ILKA 1DGPA 3KRAB 3WCCA 2VF6A 3M9UA 1JFGA 4F6VA 2F9KF 5A0IA 5AELA 2E93A 4LPGF 3N1WF 2PS5A 4MC3A 5JV0F 5HN7A 3VJCA 3ICNA 5H9DA 3LJIA 4N9UA 3CP6A 3KRCA 3N45F 3SAEA 2F89F 1WL3A 1YHMA 2PS4A 4Q23A 3MAVA 1WL2A 2F8CF 3CKEA 3KRPB 5IVGA 2DH4A 1UBXA 2AEKA 5IK6A 3N3DA 4FJQA 1YHLA 3ICZA 3ZMCA 1V4EA 3N46F 5ERMA 3WJKA 4N1ZF 1WKZA 4GAXA 4RXCA 2Z7HA 4H5CF 5IK9A 5ILJA 4OMGA 4KQ5A 4KPJA 4KWDA 4OMHA 3TS7A 3WCJA 3WCFA 1V4JA 4P0VA 4NKEA 4KVWA 5B00A 1UBYA 3P5RA 1N21A 2OPNA 5B03A 3N49F 2J1OA 3AQBB 3TFNA 3PH7A 2Z4VA 5B02A 4QXSF 3N0FA 3WCDA 5C05A 2AZLA 4LLSA 3WEIA 2E8UA 3LMDA 2PS6A 3IBAA 4LZ3A 3N5JF 3G4DA 3SDTA 3WCEA 2AZKA 3AQ0A 5AYPA 2RAHA 1PS1A 5DJVF 4NUAA 5JA0F 4E1EA 3VJ8A 2AELA 3ZL6A 3KRAA 3P41A 3WEKA 2F8ZF 3PYAA 1ZW5A 2AETA 3P5PA 4H5DF 5IMIA 2Z4YA 1KIYA 5E8HA 3LVSA 5B01A 2Z4ZA 1RQJA 3WCMA 3RYEA 1RQIA 1VG2A 4JYXA 4LZCA 2PS7A 2ZCOA 4JVJF 4NFIF 3ACWA 1N20A 3WSAA 2E91A 4NG6A 5JUZF 2Z78A 2E94A 3DYHA 4LTZA 3M02A 5IL8A 4DWGA 2E8XA 5DHIA 5I1UA 2ZCRA 3KRFB 3PYBA 3MZVA 3WSBA 4P0XA 1YYUA 2O1OA 2Q58A 3OYRA 3G4FA 3ZMBA 3OABA 2E8WA 1N1BA 5IKAA 3V1XA 4MC0A 5IMNA 4KVDA 4ZQ8A 3RYWA 4F6XA 5CG6A 3M0GA 3BNYA 3N0GA 5ILYA 3WCAA 3WE9A 4JXYA 4KVYA 5AFXA 3SDQA 3B7LA 2OA6A 3RBMA 5EROA 1VG4A 3EFQA 3NRIA 1JFAA 5CG5A 4KUXA 5E8KA 3W7FA 4E9ZA 4RXDA 1FPSA 1YYQA 3WEGA 4KPDA 3RMGA 4DI5A 1N22A 2E95A 1N23A 3LG5A 4KFAA 3OACA 3PKOA 2OGDA 3VJ9A 4PVYF 5DJRF 2F92F 5DJPF 5EAUA 4JXNA 5ILIA 5KSXF 4KK2A 4LIXA 1WL1A 5DHKA 3M00A 3KRCB 4UMJA 2ONGA 3P8RA 3AQCB 3ASXA 4LLTA 3SDRA 3ICKA 4XQSF 2F94F 5IKHA 3EZ3A 2E4OA 3WCHA 2J1PA 1HXGA 3ID0A 4LFVF 4FP4A 4WK5A 3LEEA 3LSNA 4RNQA 1HXCA 3WCGA 3KBKA 3VJEA 2Q80A 1HX9A 5DW7A 5ER8A 5IL3A 3KROA 4NKFA 1WL0A 2Z4WA 2QISA 5EATA 4K10A 3EGTA 2Z4XA 4H5EF 4RXAA 3V66A 3ZCDA 4LPHF 5JV2F 3Q30A 4RXEA 4LA6A 1V4KA 2Z7IA 1WY0A 5IM1A 4NFJF 2FTZA 4XQTF 3SDVA 3NPRA 5A0KA 5HN8A 2Q9ZA 3ACYA 2Z52A 3Q1OA 1HM4A 3NF2A 3KB9A 1VG3A 3TFPA 1KIZA 2ZCSA 5JV1F 3LLWA 3S9VA 3WEHA 2FORA 4PVXF 3V1VA 5DGSF 3KRPA 5IK0A 4LTVA 5ILHA 5B0IA 4LA5A 4JZBA 5B0LA 3LDWA 4OGUA 1UBWA 4E9UA 1VG6A 4RYPA 3CC9A 3WJOA 2E90A 3WCBA 4LZ0A 1RTRA 2I19A 3LGZB 4EA1A 3BNXA 4P0WA 4LFEA 3DYGA 1YJ4A 3WEFA 3APZA 3WC9A 4LFGA 4GP1A 4GA3A 2ZEUA 3N3LF 3WCIA 1N24A 3QQVA 4OKMA 2AZJA 2EWGA 5ERNA 3S4JA 4L2XF 3DYFA 2ZEVA 3OABB 3P8LA 4DXJA 4QPFA 2ZY1A 2E8VA 4HD1A 3LOMA 2PS8A 1VG7A 3PDEA 2OPMA 3SDUA
chains in the Genus database with same CATH superfamily
5DGMF 5DIQF 1WMWA 5B0MA 4XQRF 3TFVA 1N1ZA 4KKMA 3UCAA 1YQ7A 3Q2ZA 3N1VF 4MC8A 3M01A 3LK5A 2E92A 2ONHA 1V4HA 1YV5A 3TC1A 5B0KA 3NPKA 1DI1A 4LOBA 2H8OA 1EZFA 1V4IA 5ILZA 1HM7A 3QKCA 3KRFA 2Z50A 2F7MF 3OACB 3VJBA 4OKZA 4LXWA 3WCLA 5AHUB 3ADZA 4NFKF 3IPIA 5A0JA 5IN8A 1YYTA 3ZOUA 5EASA 4DEMF 5HNAA 1YYSA 3N5HF 4KQUA 3WJNA 4F62A 3AE0A 4EA0A 2ZCQA 3ICMA 3Q2QA 4GP2A 3WEJA 3N6KF 3LZ9A 4DWBA 3VJDA 5IMPA 2J5CA 2Q9YA 2P1CA 5DGNF 5ILDA 1YHKA 4EA2A 2E8TA 5E8LA 3KROB 3LGKA 1YYRA 5B0JA 4DZWA 5HN9A 4KVIA 1HXAA 5DZ2A 4LUUA 4DHDA 1UBVA 3ACXA 4KQSA 3VJAA 4JZXA 5ILKA 1DGPA 3KRAB 3WCCA 2VF6A 3M9UA 1JFGA 4F6VA 2F9KF 5A0IA 5AELA 2E93A 4LPGF 3N1WF 2PS5A 4MC3A 5JV0F 5HN7A 3VJCA 3ICNA 5H9DA 3LJIA 4N9UA 3CP6A 3KRCA 3N45F 3SAEA 2F89F 1WL3A 1YHMA 2PS4A 4Q23A 3MAVA 1WL2A 2F8CF 3CKEA 3KRPB 5IVGA 2DH4A 1UBXA 2AEKA 5IK6A 3N3DA 4FJQA 1YHLA 3ICZA 3ZMCA 1V4EA 3N46F 5ERMA 3WJKA 4N1ZF 1WKZA 4GAXA 4RXCA 2Z7HA 4H5CF 5IK9A 5ILJA 4OMGA 4KQ5A 4KPJA 4KWDA 4OMHA 3TS7A 3WCJA 3WCFA 1V4JA 4P0VA 4NKEA 4KVWA 5B00A 1UBYA 3P5RA 1N21A 2OPNA 5B03A 3N49F 2J1OA 3AQBB 3TFNA 3PH7A 2Z4VA 5B02A 4QXSF 3N0FA 3WCDA 5C05A 2AZLA 4LLSA 3WEIA 2E8UA 3LMDA 2PS6A 3IBAA 4LZ3A 3N5JF 3G4DA 3SDTA 3WCEA 2AZKA 3AQ0A 5AYPA 2RAHA 1PS1A 5DJVF 4NUAA 5JA0F 4E1EA 3VJ8A 2AELA 3ZL6A 3KRAA 3P41A 3WEKA 2F8ZF 3PYAA 1ZW5A 2AETA 3P5PA 4H5DF 5IMIA 2Z4YA 1KIYA 5E8HA 3LVSA 5B01A 2Z4ZA 1RQJA 3WCMA 3RYEA 1RQIA 1VG2A 4JYXA 4LZCA 2PS7A 2ZCOA 4JVJF 4NFIF 3ACWA 1N20A 3WSAA 2E91A 4NG6A 5JUZF 2Z78A 2E94A 3DYHA 4LTZA 3M02A 5IL8A 4DWGA 2E8XA 5DHIA 5I1UA 2ZCRA 3KRFB 3PYBA 3MZVA 3WSBA 4P0XA 1YYUA 2O1OA 2Q58A 3OYRA 3G4FA 3ZMBA 3OABA 2E8WA 1N1BA 5IKAA 3V1XA 4MC0A 5IMNA 4KVDA 4ZQ8A 3RYWA 4F6XA 5CG6A 3M0GA 3BNYA 3N0GA 5ILYA 3WCAA 3WE9A 4JXYA 4KVYA 5AFXA 3SDQA 3B7LA 2OA6A 3RBMA 5EROA 1VG4A 3EFQA 3NRIA 1JFAA 5CG5A 4KUXA 5E8KA 3W7FA 4E9ZA 4RXDA 1FPSA 1YYQA 3WEGA 4KPDA 3RMGA 4DI5A 1N22A 2E95A 1N23A 3LG5A 4KFAA 3OACA 3PKOA 2OGDA 3VJ9A 4PVYF 5DJRF 2F92F 5DJPF 5EAUA 4JXNA 5ILIA 5KSXF 4KK2A 4LIXA 1WL1A 5DHKA 3M00A 3KRCB 4UMJA 2ONGA 3P8RA 3AQCB 3ASXA 4LLTA 3SDRA 3ICKA 4XQSF 2F94F 5IKHA 3EZ3A 2E4OA 3WCHA 2J1PA 1HXGA 3ID0A 4LFVF 4FP4A 4WK5A 3LEEA 3LSNA 4RNQA 1HXCA 3WCGA 3KBKA 3VJEA 2Q80A 1HX9A 5DW7A 5ER8A 5IL3A 3KROA 4NKFA 1WL0A 2Z4WA 2QISA 5EATA 4K10A 3EGTA 2Z4XA 4H5EF 4RXAA 3V66A 3ZCDA 4LPHF 5JV2F 3Q30A 4RXEA 4LA6A 1V4KA 2Z7IA 1WY0A 5IM1A 4NFJF 2FTZA 4XQTF 3SDVA 3NPRA 5A0KA 5HN8A 2Q9ZA 3ACYA 2Z52A 3Q1OA 1HM4A 3NF2A 3KB9A 1VG3A 3TFPA 1KIZA 2ZCSA 5JV1F 3LLWA 3S9VA 3WEHA 2FORA 4PVXF 3V1VA 5DGSF 3KRPA 5IK0A 4LTVA 5ILHA 5B0IA 4LA5A 4JZBA 5B0LA 3LDWA 4OGUA 1UBWA 4E9UA 1VG6A 4RYPA 3CC9A 3WJOA 2E90A 3WCBA 4LZ0A 1RTRA 2I19A 3LGZB 4EA1A 3BNXA 4P0WA 4LFEA 3DYGA 1YJ4A 3WEFA 3APZA 3WC9A 4LFGA 4GP1A 4GA3A 2ZEUA 3N3LF 3WCIA 1N24A 3QQVA 4OKMA 2AZJA 2EWGA 5ERNA 3S4JA 4L2XF 3DYFA 2ZEVA 3OABB 3P8LA 4DXJA 4QPFA 2ZY1A 2E8VA 4HD1A 3LOMA 2PS8A 1VG7A 3PDEA 2OPMA 3SDUA
chains in the Genus database with same CATH topology
5DGMF 5DIQF 1WMWA 5B0MA 4XQRF 3TFVA 1N1ZA 4KKMA 3UCAA 1YQ7A 3Q2ZA 3N1VF 4MC8A 3M01A 3LK5A 2E92A 2ONHA 1V4HA 1YV5A 3TC1A 5B0KA 3NPKA 1DI1A 4LOBA 2H8OA 1EZFA 1V4IA 5ILZA 1HM7A 3QKCA 3KRFA 2Z50A 2F7MF 3OACB 3VJBA 4OKZA 4LXWA 3WCLA 5AHUB 3ADZA 4NFKF 3IPIA 5A0JA 5IN8A 1YYTA 3ZOUA 5EASA 4DEMF 5HNAA 1YYSA 3N5HF 4KQUA 3WJNA 4F62A 3AE0A 4EA0A 2ZCQA 3ICMA 3Q2QA 4GP2A 3WEJA 3N6KF 3LZ9A 4DWBA 3VJDA 5IMPA 2J5CA 2Q9YA 2P1CA 5DGNF 5ILDA 1YHKA 4EA2A 2E8TA 5E8LA 3KROB 3LGKA 1YYRA 5B0JA 4DZWA 5HN9A 4KVIA 1HXAA 5DZ2A 4LUUA 4DHDA 1UBVA 3ACXA 4KQSA 3VJAA 4JZXA 5ILKA 1DGPA 3KRAB 3WCCA 2VF6A 3M9UA 1JFGA 4F6VA 2F9KF 5A0IA 5AELA 2E93A 4LPGF 3N1WF 2PS5A 4MC3A 5JV0F 5HN7A 3VJCA 3ICNA 5H9DA 3LJIA 4N9UA 3CP6A 3KRCA 3N45F 3SAEA 2F89F 1WL3A 1YHMA 2PS4A 4Q23A 3MAVA 1WL2A 2F8CF 3CKEA 3KRPB 5IVGA 2DH4A 1UBXA 2AEKA 5IK6A 3N3DA 4FJQA 1YHLA 3ICZA 3ZMCA 1V4EA 3N46F 5ERMA 3WJKA 4N1ZF 1WKZA 4GAXA 4RXCA 2Z7HA 4H5CF 5IK9A 5ILJA 4OMGA 4KQ5A 4KPJA 4KWDA 4OMHA 3TS7A 3WCJA 3WCFA 1V4JA 4P0VA 4NKEA 4KVWA 5B00A 1UBYA 3P5RA 1N21A 2OPNA 5B03A 3N49F 2J1OA 3AQBB 3TFNA 3PH7A 2Z4VA 5B02A 4QXSF 3N0FA 3WCDA 5C05A 2AZLA 4LLSA 3WEIA 2E8UA 3LMDA 2PS6A 3IBAA 4LZ3A 3N5JF 3G4DA 3SDTA 3WCEA 2AZKA 3AQ0A 5AYPA 2RAHA 1PS1A 5DJVF 4NUAA 5JA0F 4E1EA 3VJ8A 2AELA 3ZL6A 3KRAA 3P41A 3WEKA 2F8ZF 3PYAA 1ZW5A 2AETA 3P5PA 4H5DF 5IMIA 2Z4YA 1KIYA 5E8HA 3LVSA 5B01A 2Z4ZA 1RQJA 3WCMA 3RYEA 1RQIA 1VG2A 4JYXA 4LZCA 2PS7A 2ZCOA 4JVJF 4NFIF 3ACWA 1N20A 3WSAA 2E91A 4NG6A 5JUZF 2Z78A 2E94A 3DYHA 4LTZA 3M02A 5IL8A 4DWGA 2E8XA 5DHIA 5I1UA 2ZCRA 3KRFB 3PYBA 3MZVA 3WSBA 4P0XA 1YYUA 2O1OA 2Q58A 3OYRA 3G4FA 3ZMBA 3OABA 2E8WA 1N1BA 5IKAA 3V1XA 4MC0A 5IMNA 4KVDA 4ZQ8A 3RYWA 4F6XA 5CG6A 3M0GA 3BNYA 3N0GA 5ILYA 3WCAA 3WE9A 4JXYA 4KVYA 5AFXA 3SDQA 3B7LA 2OA6A 3RBMA 5EROA 1VG4A 3EFQA 3NRIA 1JFAA 5CG5A 4KUXA 5E8KA 3W7FA 4E9ZA 4RXDA 1FPSA 1YYQA 3WEGA 4KPDA 3RMGA 4DI5A 1N22A 2E95A 1N23A 3LG5A 4KFAA 3OACA 3PKOA 2OGDA 3VJ9A 4PVYF 5DJRF 2F92F 5DJPF 5EAUA 4JXNA 5ILIA 5KSXF 4KK2A 4LIXA 1WL1A 5DHKA 3M00A 3KRCB 4UMJA 2ONGA 3P8RA 3AQCB 3ASXA 4LLTA 3SDRA 3ICKA 4XQSF 2F94F 5IKHA 3EZ3A 2E4OA 3WCHA 2J1PA 1HXGA 3ID0A 4LFVF 4FP4A 4WK5A 3LEEA 3LSNA 4RNQA 1HXCA 3WCGA 3KBKA 3VJEA 2Q80A 1HX9A 5DW7A 5ER8A 5IL3A 3KROA 4NKFA 1WL0A 2Z4WA 2QISA 5EATA 4K10A 3EGTA 2Z4XA 4H5EF 4RXAA 3V66A 3ZCDA 4LPHF 5JV2F 3Q30A 4RXEA 4LA6A 1V4KA 2Z7IA 1WY0A 5IM1A 4NFJF 2FTZA 4XQTF 3SDVA 3NPRA 5A0KA 5HN8A 2Q9ZA 3ACYA 2Z52A 3Q1OA 1HM4A 3NF2A 3KB9A 1VG3A 3TFPA 1KIZA 2ZCSA 5JV1F 3LLWA 3S9VA 3WEHA 2FORA 4PVXF 3V1VA 5DGSF 3KRPA 5IK0A 4LTVA 5ILHA 5B0IA 4LA5A 4JZBA 5B0LA 3LDWA 4OGUA 1UBWA 4E9UA 1VG6A 4RYPA 3CC9A 3WJOA 2E90A 3WCBA 4LZ0A 1RTRA 2I19A 3LGZB 4EA1A 3BNXA 4P0WA 4LFEA 3DYGA 1YJ4A 3WEFA 3APZA 3WC9A 4LFGA 4GP1A 4GA3A 2ZEUA 3N3LF 3WCIA 1N24A 3QQVA 4OKMA 2AZJA 2EWGA 5ERNA 3S4JA 4L2XF 3DYFA 2ZEVA 3OABB 3P8LA 4DXJA 4QPFA 2ZY1A 2E8VA 4HD1A 3LOMA 2PS8A 1VG7A 3PDEA 2OPMA 3SDUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DGM F;  5DIQ F;  1WMW A;  5B0M A;  4XQR F;  3TFV A;  1N1Z A;  4KKM A;  3UCA A;  1YQ7 A;  3Q2Z A;  3N1V F;  4MC8 A;  3M01 A;  3LK5 A;  2E92 A;  2ONH A;  1V4H A;  1YV5 A;  3TC1 A;  5B0K A;  3NPK A;  1DI1 A;  4LOB A;  2H8O A;  1EZF A;  1V4I A;  5ILZ A;  1HM7 A;  3QKC A;  3KRF A;  2Z50 A;  2F7M F;  3OAC B;  3VJB A;  4OKZ A;  4LXW A;  3WCL A;  5AHU B;  3ADZ A;  4NFK F;  3IPI A;  5A0J A;  5IN8 A;  1YYT A;  3ZOU A;  5EAS A;  4DEM F;  5HNA A;  1YYS A;  3N5H F;  4KQU A;  3WJN A;  4F62 A;  3AE0 A;  4EA0 A;  2ZCQ A;  3ICM A;  3Q2Q A;  4GP2 A;  3WEJ A;  3N6K F;  3LZ9 A;  4DWB A;  3VJD A;  5IMP A;  2J5C A;  2Q9Y A;  2P1C A;  5DGN F;  5ILD A;  1YHK A;  4EA2 A;  2E8T A;  5E8L A;  3KRO B;  3LGK A;  1YYR A;  5B0J A;  4DZW A;  5HN9 A;  4KVI A;  1HXA A;  5DZ2 A;  4LUU A;  4DHD A;  1UBV A;  3ACX A;  4KQS A;  3VJA A;  4JZX A;  5ILK A;  1DGP A;  3KRA B;  3WCC A;  2VF6 A;  3M9U A;  1JFG A;  4F6V A;  2F9K F;  5A0I A;  5AEL A;  2E93 A;  4LPG F;  3N1W F;  2PS5 A;  4MC3 A;  5JV0 F;  5HN7 A;  3VJC A;  3ICN A;  5H9D A;  3LJI A;  4N9U A;  3CP6 A;  3KRC A;  3N45 F;  3SAE A;  2F89 F;  1WL3 A;  1YHM A;  2PS4 A;  4Q23 A;  3MAV A;  1WL2 A;  2F8C F;  3CKE A;  3KRP B;  5IVG A;  2DH4 A;  1UBX A;  2AEK A;  5IK6 A;  3N3D A;  4FJQ A;  1YHL A;  3ICZ A;  3ZMC A;  1V4E A;  3N46 F;  5ERM A;  3WJK A;  4N1Z F;  1WKZ A;  4GAX A;  4RXC A;  2Z7H A;  4H5C F;  5IK9 A;  5ILJ A;  4OMG A;  4KQ5 A;  4KPJ A;  4KWD A;  4OMH A;  3TS7 A;  3WCJ A;  3WCF A;  1V4J A;  4P0V A;  4NKE A;  4KVW A;  5B00 A;  1UBY A;  3P5R A;  1N21 A;  2OPN A;  5B03 A;  3N49 F;  2J1O A;  3AQB B;  3TFN A;  3PH7 A;  2Z4V A;  5B02 A;  4QXS F;  3N0F A;  3WCD A;  5C05 A;  2AZL A;  4LLS A;  3WEI A;  2E8U A;  3LMD A;  2PS6 A;  3IBA A;  4LZ3 A;  3N5J F;  3G4D A;  3SDT A;  3WCE A;  2AZK A;  3AQ0 A;  5AYP A;  2RAH A;  1PS1 A;  5DJV F;  4NUA A;  5JA0 F;  4E1E A;  3VJ8 A;  2AEL A;  3ZL6 A;  3KRA A;  3P41 A;  3WEK A;  2F8Z F;  3PYA A;  1ZW5 A;  2AET A;  3P5P A;  4H5D F;  5IMI A;  2Z4Y A;  1KIY A;  5E8H A;  3LVS A;  5B01 A;  2Z4Z A;  1RQJ A;  3WCM A;  3RYE A;  1RQI A;  1VG2 A;  4JYX A;  4LZC A;  2PS7 A;  2ZCO A;  4JVJ F;  4NFI F;  3ACW A;  1N20 A;  3WSA A;  2E91 A;  4NG6 A;  5JUZ F;  2Z78 A;  2E94 A;  3DYH A;  4LTZ A;  3M02 A;  5IL8 A;  4DWG A;  2E8X A;  5DHI A;  5I1U A;  2ZCR A;  3KRF B;  3PYB A;  3MZV A;  3WSB A;  4P0X A;  1YYU A;  2O1O A;  2Q58 A;  3OYR A;  3G4F A;  3ZMB A;  3OAB A;  2E8W A;  1N1B A;  5IKA A;  3V1X A;  4MC0 A;  5IMN A;  4KVD A;  4ZQ8 A;  3RYW A;  4F6X A;  5CG6 A;  3M0G A;  3BNY A;  3N0G A;  5ILY A;  3WCA A;  3WE9 A;  4JXY A;  4KVY A;  5AFX A;  3SDQ A;  3B7L A;  2OA6 A;  3RBM A;  5ERO A;  1VG4 A;  3EFQ A;  3NRI A;  1JFA A;  5CG5 A;  4KUX A;  5E8K A;  3W7F A;  4E9Z A;  4RXD A;  1FPS A;  1YYQ A;  3WEG A;  4KPD A;  3RMG A;  4DI5 A;  1N22 A;  2E95 A;  1N23 A;  3LG5 A;  4KFA A;  3OAC A;  3PKO A;  2OGD A;  3VJ9 A;  4PVY F;  5DJR F;  2F92 F;  5DJP F;  5EAU A;  4JXN A;  5ILI A;  5KSX F;  4KK2 A;  4LIX A;  1WL1 A;  5DHK A;  3M00 A;  3KRC B;  4UMJ A;  2ONG A;  3P8R A;  3AQC B;  3ASX A;  4LLT A;  3SDR A;  3ICK A;  4XQS F;  2F94 F;  5IKH A;  3EZ3 A;  2E4O A;  3WCH A;  2J1P A;  1HXG A;  3ID0 A;  4LFV F;  4FP4 A;  4WK5 A;  3LEE A;  3LSN A;  4RNQ A;  1HXC A;  3WCG A;  3KBK A;  3VJE A;  2Q80 A;  1HX9 A;  5DW7 A;  5ER8 A;  5IL3 A;  3KRO A;  4NKF A;  1WL0 A;  2Z4W A;  2QIS A;  5EAT A;  4K10 A;  3EGT A;  2Z4X A;  4H5E F;  4RXA A;  3V66 A;  3ZCD A;  4LPH F;  5JV2 F;  3Q30 A;  4RXE A;  4LA6 A;  1V4K A;  2Z7I A;  1WY0 A;  5IM1 A;  4NFJ F;  2FTZ A;  4XQT F;  3SDV A;  3NPR A;  5A0K A;  5HN8 A;  2Q9Z A;  3ACY A;  2Z52 A;  3Q1O A;  1HM4 A;  3NF2 A;  3KB9 A;  1VG3 A;  3TFP A;  1KIZ A;  2ZCS A;  5JV1 F;  3LLW A;  3S9V A;  3WEH A;  2FOR A;  4PVX F;  3V1V A;  5DGS F;  3KRP A;  5IK0 A;  4LTV A;  5ILH A;  5B0I A;  4LA5 A;  4JZB A;  5B0L A;  3LDW A;  4OGU A;  1UBW A;  4E9U A;  1VG6 A;  4RYP A;  3CC9 A;  3WJO A;  2E90 A;  3WCB A;  4LZ0 A;  1RTR A;  2I19 A;  3LGZ B;  4EA1 A;  3BNX A;  4P0W A;  4LFE A;  3DYG A;  1YJ4 A;  3WEF A;  3APZ A;  3WC9 A;  4LFG A;  4GP1 A;  4GA3 A;  2ZEU A;  3N3L F;  3WCI A;  1N24 A;  3QQV A;  4OKM A;  2AZJ A;  2EWG A;  5ERN A;  3S4J A;  4L2X F;  3DYF A;  2ZEV A;  3OAB B;  3P8L A;  4DXJ A;  4QPF A;  2ZY1 A;  2E8V A;  4HD1 A;  3LOM A;  2PS8 A;  1VG7 A;  3PDE A;  2OPM A;  3SDU A; 
#chains in the Genus database with same CATH topology
 5DGM F;  5DIQ F;  1WMW A;  5B0M A;  4XQR F;  3TFV A;  1N1Z A;  4KKM A;  3UCA A;  1YQ7 A;  3Q2Z A;  3N1V F;  4MC8 A;  3M01 A;  3LK5 A;  2E92 A;  2ONH A;  1V4H A;  1YV5 A;  3TC1 A;  5B0K A;  3NPK A;  1DI1 A;  4LOB A;  2H8O A;  1EZF A;  1V4I A;  5ILZ A;  1HM7 A;  3QKC A;  3KRF A;  2Z50 A;  2F7M F;  3OAC B;  3VJB A;  4OKZ A;  4LXW A;  3WCL A;  5AHU B;  3ADZ A;  4NFK F;  3IPI A;  5A0J A;  5IN8 A;  1YYT A;  3ZOU A;  5EAS A;  4DEM F;  5HNA A;  1YYS A;  3N5H F;  4KQU A;  3WJN A;  4F62 A;  3AE0 A;  4EA0 A;  2ZCQ A;  3ICM A;  3Q2Q A;  4GP2 A;  3WEJ A;  3N6K F;  3LZ9 A;  4DWB A;  3VJD A;  5IMP A;  2J5C A;  2Q9Y A;  2P1C A;  5DGN F;  5ILD A;  1YHK A;  4EA2 A;  2E8T A;  5E8L A;  3KRO B;  3LGK A;  1YYR A;  5B0J A;  4DZW A;  5HN9 A;  4KVI A;  1HXA A;  5DZ2 A;  4LUU A;  4DHD A;  1UBV A;  3ACX A;  4KQS A;  3VJA A;  4JZX A;  5ILK A;  1DGP A;  3KRA B;  3WCC A;  2VF6 A;  3M9U A;  1JFG A;  4F6V A;  2F9K F;  5A0I A;  5AEL A;  2E93 A;  4LPG F;  3N1W F;  2PS5 A;  4MC3 A;  5JV0 F;  5HN7 A;  3VJC A;  3ICN A;  5H9D A;  3LJI A;  4N9U A;  3CP6 A;  3KRC A;  3N45 F;  3SAE A;  2F89 F;  1WL3 A;  1YHM A;  2PS4 A;  4Q23 A;  3MAV A;  1WL2 A;  2F8C F;  3CKE A;  3KRP B;  5IVG A;  2DH4 A;  1UBX A;  2AEK A;  5IK6 A;  3N3D A;  4FJQ A;  1YHL A;  3ICZ A;  3ZMC A;  1V4E A;  3N46 F;  5ERM A;  3WJK A;  4N1Z F;  1WKZ A;  4GAX A;  4RXC A;  2Z7H A;  4H5C F;  5IK9 A;  5ILJ A;  4OMG A;  4KQ5 A;  4KPJ A;  4KWD A;  4OMH A;  3TS7 A;  3WCJ A;  3WCF A;  1V4J A;  4P0V A;  4NKE A;  4KVW A;  5B00 A;  1UBY A;  3P5R A;  1N21 A;  2OPN A;  5B03 A;  3N49 F;  2J1O A;  3AQB B;  3TFN A;  3PH7 A;  2Z4V A;  5B02 A;  4QXS F;  3N0F A;  3WCD A;  5C05 A;  2AZL A;  4LLS A;  3WEI A;  2E8U A;  3LMD A;  2PS6 A;  3IBA A;  4LZ3 A;  3N5J F;  3G4D A;  3SDT A;  3WCE A;  2AZK A;  3AQ0 A;  5AYP A;  2RAH A;  1PS1 A;  5DJV F;  4NUA A;  5JA0 F;  4E1E A;  3VJ8 A;  2AEL A;  3ZL6 A;  3KRA A;  3P41 A;  3WEK A;  2F8Z F;  3PYA A;  1ZW5 A;  2AET A;  3P5P A;  4H5D F;  5IMI A;  2Z4Y A;  1KIY A;  5E8H A;  3LVS A;  5B01 A;  2Z4Z A;  1RQJ A;  3WCM A;  3RYE A;  1RQI A;  1VG2 A;  4JYX A;  4LZC A;  2PS7 A;  2ZCO A;  4JVJ F;  4NFI F;  3ACW A;  1N20 A;  3WSA A;  2E91 A;  4NG6 A;  5JUZ F;  2Z78 A;  2E94 A;  3DYH A;  4LTZ A;  3M02 A;  5IL8 A;  4DWG A;  2E8X A;  5DHI A;  5I1U A;  2ZCR A;  3KRF B;  3PYB A;  3MZV A;  3WSB A;  4P0X A;  1YYU A;  2O1O A;  2Q58 A;  3OYR A;  3G4F A;  3ZMB A;  3OAB A;  2E8W A;  1N1B A;  5IKA A;  3V1X A;  4MC0 A;  5IMN A;  4KVD A;  4ZQ8 A;  3RYW A;  4F6X A;  5CG6 A;  3M0G A;  3BNY A;  3N0G A;  5ILY A;  3WCA A;  3WE9 A;  4JXY A;  4KVY A;  5AFX A;  3SDQ A;  3B7L A;  2OA6 A;  3RBM A;  5ERO A;  1VG4 A;  3EFQ A;  3NRI A;  1JFA A;  5CG5 A;  4KUX A;  5E8K A;  3W7F A;  4E9Z A;  4RXD A;  1FPS A;  1YYQ A;  3WEG A;  4KPD A;  3RMG A;  4DI5 A;  1N22 A;  2E95 A;  1N23 A;  3LG5 A;  4KFA A;  3OAC A;  3PKO A;  2OGD A;  3VJ9 A;  4PVY F;  5DJR F;  2F92 F;  5DJP F;  5EAU A;  4JXN A;  5ILI A;  5KSX F;  4KK2 A;  4LIX A;  1WL1 A;  5DHK A;  3M00 A;  3KRC B;  4UMJ A;  2ONG A;  3P8R A;  3AQC B;  3ASX A;  4LLT A;  3SDR A;  3ICK A;  4XQS F;  2F94 F;  5IKH A;  3EZ3 A;  2E4O A;  3WCH A;  2J1P A;  1HXG A;  3ID0 A;  4LFV F;  4FP4 A;  4WK5 A;  3LEE A;  3LSN A;  4RNQ A;  1HXC A;  3WCG A;  3KBK A;  3VJE A;  2Q80 A;  1HX9 A;  5DW7 A;  5ER8 A;  5IL3 A;  3KRO A;  4NKF A;  1WL0 A;  2Z4W A;  2QIS A;  5EAT A;  4K10 A;  3EGT A;  2Z4X A;  4H5E F;  4RXA A;  3V66 A;  3ZCD A;  4LPH F;  5JV2 F;  3Q30 A;  4RXE A;  4LA6 A;  1V4K A;  2Z7I A;  1WY0 A;  5IM1 A;  4NFJ F;  2FTZ A;  4XQT F;  3SDV A;  3NPR A;  5A0K A;  5HN8 A;  2Q9Z A;  3ACY A;  2Z52 A;  3Q1O A;  1HM4 A;  3NF2 A;  3KB9 A;  1VG3 A;  3TFP A;  1KIZ A;  2ZCS A;  5JV1 F;  3LLW A;  3S9V A;  3WEH A;  2FOR A;  4PVX F;  3V1V A;  5DGS F;  3KRP A;  5IK0 A;  4LTV A;  5ILH A;  5B0I A;  4LA5 A;  4JZB A;  5B0L A;  3LDW A;  4OGU A;  1UBW A;  4E9U A;  1VG6 A;  4RYP A;  3CC9 A;  3WJO A;  2E90 A;  3WCB A;  4LZ0 A;  1RTR A;  2I19 A;  3LGZ B;  4EA1 A;  3BNX A;  4P0W A;  4LFE A;  3DYG A;  1YJ4 A;  3WEF A;  3APZ A;  3WC9 A;  4LFG A;  4GP1 A;  4GA3 A;  2ZEU A;  3N3L F;  3WCI A;  1N24 A;  3QQV A;  4OKM A;  2AZJ A;  2EWG A;  5ERN A;  3S4J A;  4L2X F;  3DYF A;  2ZEV A;  3OAB B;  3P8L A;  4DXJ A;  4QPF A;  2ZY1 A;  2E8V A;  4HD1 A;  3LOM A;  2PS8 A;  1VG7 A;  3PDE A;  2OPM A;  3SDU A; 
#chains in the Genus database with same CATH homology
 5DGM F;  5DIQ F;  1WMW A;  5B0M A;  4XQR F;  3TFV A;  1N1Z A;  4KKM A;  3UCA A;  1YQ7 A;  3Q2Z A;  3N1V F;  4MC8 A;  3M01 A;  3LK5 A;  2E92 A;  2ONH A;  1V4H A;  1YV5 A;  3TC1 A;  5B0K A;  3NPK A;  1DI1 A;  4LOB A;  2H8O A;  1EZF A;  1V4I A;  5ILZ A;  1HM7 A;  3QKC A;  3KRF A;  2Z50 A;  2F7M F;  3OAC B;  3VJB A;  4OKZ A;  4LXW A;  3WCL A;  5AHU B;  3ADZ A;  4NFK F;  3IPI A;  5A0J A;  5IN8 A;  1YYT A;  3ZOU A;  5EAS A;  4DEM F;  5HNA A;  1YYS A;  3N5H F;  4KQU A;  3WJN A;  4F62 A;  3AE0 A;  4EA0 A;  2ZCQ A;  3ICM A;  3Q2Q A;  4GP2 A;  3WEJ A;  3N6K F;  3LZ9 A;  4DWB A;  3VJD A;  5IMP A;  2J5C A;  2Q9Y A;  2P1C A;  5DGN F;  5ILD A;  1YHK A;  4EA2 A;  2E8T A;  5E8L A;  3KRO B;  3LGK A;  1YYR A;  5B0J A;  4DZW A;  5HN9 A;  4KVI A;  1HXA A;  5DZ2 A;  4LUU A;  4DHD A;  1UBV A;  3ACX A;  4KQS A;  3VJA A;  4JZX A;  5ILK A;  1DGP A;  3KRA B;  3WCC A;  2VF6 A;  3M9U A;  1JFG A;  4F6V A;  2F9K F;  5A0I A;  5AEL A;  2E93 A;  4LPG F;  3N1W F;  2PS5 A;  4MC3 A;  5JV0 F;  5HN7 A;  3VJC A;  3ICN A;  5H9D A;  3LJI A;  4N9U A;  3CP6 A;  3KRC A;  3N45 F;  3SAE A;  2F89 F;  1WL3 A;  1YHM A;  2PS4 A;  4Q23 A;  3MAV A;  1WL2 A;  2F8C F;  3CKE A;  3KRP B;  5IVG A;  2DH4 A;  1UBX A;  2AEK A;  5IK6 A;  3N3D A;  4FJQ A;  1YHL A;  3ICZ A;  3ZMC A;  1V4E A;  3N46 F;  5ERM A;  3WJK A;  4N1Z F;  1WKZ A;  4GAX A;  4RXC A;  2Z7H A;  4H5C F;  5IK9 A;  5ILJ A;  4OMG A;  4KQ5 A;  4KPJ A;  4KWD A;  4OMH A;  3TS7 A;  3WCJ A;  3WCF A;  1V4J A;  4P0V A;  4NKE A;  4KVW A;  5B00 A;  1UBY A;  3P5R A;  1N21 A;  2OPN A;  5B03 A;  3N49 F;  2J1O A;  3AQB B;  3TFN A;  3PH7 A;  2Z4V A;  5B02 A;  4QXS F;  3N0F A;  3WCD A;  5C05 A;  2AZL A;  4LLS A;  3WEI A;  2E8U A;  3LMD A;  2PS6 A;  3IBA A;  4LZ3 A;  3N5J F;  3G4D A;  3SDT A;  3WCE A;  2AZK A;  3AQ0 A;  5AYP A;  2RAH A;  1PS1 A;  5DJV F;  4NUA A;  5JA0 F;  4E1E A;  3VJ8 A;  2AEL A;  3ZL6 A;  3KRA A;  3P41 A;  3WEK A;  2F8Z F;  3PYA A;  1ZW5 A;  2AET A;  3P5P A;  4H5D F;  5IMI A;  2Z4Y A;  1KIY A;  5E8H A;  3LVS A;  5B01 A;  2Z4Z A;  1RQJ A;  3WCM A;  3RYE A;  1RQI A;  1VG2 A;  4JYX A;  4LZC A;  2PS7 A;  2ZCO A;  4JVJ F;  4NFI F;  3ACW A;  1N20 A;  3WSA A;  2E91 A;  4NG6 A;  5JUZ F;  2Z78 A;  2E94 A;  3DYH A;  4LTZ A;  3M02 A;  5IL8 A;  4DWG A;  2E8X A;  5DHI A;  5I1U A;  2ZCR A;  3KRF B;  3PYB A;  3MZV A;  3WSB A;  4P0X A;  1YYU A;  2O1O A;  2Q58 A;  3OYR A;  3G4F A;  3ZMB A;  3OAB A;  2E8W A;  1N1B A;  5IKA A;  3V1X A;  4MC0 A;  5IMN A;  4KVD A;  4ZQ8 A;  3RYW A;  4F6X A;  5CG6 A;  3M0G A;  3BNY A;  3N0G A;  5ILY A;  3WCA A;  3WE9 A;  4JXY A;  4KVY A;  5AFX A;  3SDQ A;  3B7L A;  2OA6 A;  3RBM A;  5ERO A;  1VG4 A;  3EFQ A;  3NRI A;  1JFA A;  5CG5 A;  4KUX A;  5E8K A;  3W7F A;  4E9Z A;  4RXD A;  1FPS A;  1YYQ A;  3WEG A;  4KPD A;  3RMG A;  4DI5 A;  1N22 A;  2E95 A;  1N23 A;  3LG5 A;  4KFA A;  3OAC A;  3PKO A;  2OGD A;  3VJ9 A;  4PVY F;  5DJR F;  2F92 F;  5DJP F;  5EAU A;  4JXN A;  5ILI A;  5KSX F;  4KK2 A;  4LIX A;  1WL1 A;  5DHK A;  3M00 A;  3KRC B;  4UMJ A;  2ONG A;  3P8R A;  3AQC B;  3ASX A;  4LLT A;  3SDR A;  3ICK A;  4XQS F;  2F94 F;  5IKH A;  3EZ3 A;  2E4O A;  3WCH A;  2J1P A;  1HXG A;  3ID0 A;  4LFV F;  4FP4 A;  4WK5 A;  3LEE A;  3LSN A;  4RNQ A;  1HXC A;  3WCG A;  3KBK A;  3VJE A;  2Q80 A;  1HX9 A;  5DW7 A;  5ER8 A;  5IL3 A;  3KRO A;  4NKF A;  1WL0 A;  2Z4W A;  2QIS A;  5EAT A;  4K10 A;  3EGT A;  2Z4X A;  4H5E F;  4RXA A;  3V66 A;  3ZCD A;  4LPH F;  5JV2 F;  3Q30 A;  4RXE A;  4LA6 A;  1V4K A;  2Z7I A;  1WY0 A;  5IM1 A;  4NFJ F;  2FTZ A;  4XQT F;  3SDV A;  3NPR A;  5A0K A;  5HN8 A;  2Q9Z A;  3ACY A;  2Z52 A;  3Q1O A;  1HM4 A;  3NF2 A;  3KB9 A;  1VG3 A;  3TFP A;  1KIZ A;  2ZCS A;  5JV1 F;  3LLW A;  3S9V A;  3WEH A;  2FOR A;  4PVX F;  3V1V A;  5DGS F;  3KRP A;  5IK0 A;  4LTV A;  5ILH A;  5B0I A;  4LA5 A;  4JZB A;  5B0L A;  3LDW A;  4OGU A;  1UBW A;  4E9U A;  1VG6 A;  4RYP A;  3CC9 A;  3WJO A;  2E90 A;  3WCB A;  4LZ0 A;  1RTR A;  2I19 A;  3LGZ B;  4EA1 A;  3BNX A;  4P0W A;  4LFE A;  3DYG A;  1YJ4 A;  3WEF A;  3APZ A;  3WC9 A;  4LFG A;  4GP1 A;  4GA3 A;  2ZEU A;  3N3L F;  3WCI A;  1N24 A;  3QQV A;  4OKM A;  2AZJ A;  2EWG A;  5ERN A;  3S4J A;  4L2X F;  3DYF A;  2ZEV A;  3OAB B;  3P8L A;  4DXJ A;  4QPF A;  2ZY1 A;  2E8V A;  4HD1 A;  3LOM A;  2PS8 A;  1VG7 A;  3PDE A;  2OPM A;  3SDU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...