4P0XA

Human farnesyl diphosphate synthase in complex with taxodione
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
339
structure length
330
Chain Sequence
AQEKQDFVQHFSQIVRVLTEGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRAPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyl pyrophosphate synthase
publication title Taxodione and arenarone inhibit farnesyl diphosphate synthase by binding to the isopentenyl diphosphate site.
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 330
sequence length 339
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2014-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4p0xA00
5A0KA 5IMNA 5DIQF 5B0JA 1JFAA 3SAEA 2FTZA 1YYTA 4DWGA 4NFKF 5B0LA 2PS7A 1DI1A 4MC8A 3TS7A 4LFVF 2ZY1A 4LPHF 3ASXA 5IMPA 3TC1A 3DYGA 4GP2A 5ILHA 5B0MA 5A0JA 3KRFA 2AETA 3RBMA 4PVXF 3WEGA 2Z4ZA 4DZWA 2AZKA 1DGPA 2OPMA 3ACYA 1UBWA 5EAUA 3LOMA 1ZW5A 4HD1A 3PDEA 4LPGF 2EWGA 5ER8A 2F8ZF 3N5JF 3WCIA 2H8OA 5EROA 5B01A 1HXGA 3ICNA 4LOBA 4N1ZF 3N0GA 5DHKA 3IPIA 5JV2F 3RYWA 3KROA 3WSAA 4NKEA 1VG4A 3KRPA 1N21A 4LZ3A 4QXSF 3WEFA 5B03A 4JZBA 5IK6A 2AELA 3B7LA 4OMGA 3CC9A 4RNQA 3N0FA 3WCBA 3ZOUA 4LA6A 3WEJA 3EZ3A 3WEIA 5AYPA 3QQVA 4ZQ8A 2AZJA 3ZL6A 1YJ4A 3WJKA 4P0VA 5JUZF 2E8UA 3WCAA 3AQBB 3ACXA 3IBAA 1HX9A 2E90A 4GP1A 5E8KA 2Z4XA 2OGDA 1N1BA 1N20A 3ZMCA 4JVJF 1N1ZA 3TFNA 2PS8A 3PKOA 2E8XA 3LDWA 3SDQA 2Q80A 3VJEA 3KROB 3LJIA 3KRPB 2ZEUA 2F89F 1YHKA 3G4FA 4H5EF 5DJVF 2Z7HA 5B00A 1N22A 4NKFA 4F6XA 4H5DF 3M02A 3WJNA 1VG6A 5IMIA 1N23A 2OPNA 4E9ZA 3WJOA 1YYRA 5DJRF 3S9VA 2RAHA 5DZ2A 3AQCB 4LUUA 3VJCA 5ILYA 4LIXA 2ZCRA 3ICMA 1WL0A 4P0WA 5ILZA 3Q30A 4KPJA 2AEKA 3KRAA 5IKHA 5HN9A 5B0IA 2E92A 4GAXA 4KVDA 5JV1F 3S4JA 4UMJA 3WCGA 3P5RA 3V66A 3ZMBA 1V4EA 2E93A 3OABA 3TFVA 5AELA 3N6KF 5CG6A 3VJAA 1V4HA 4DXJA 3TFPA 3M01A 3BNYA 2PS6A 4OGUA 3VJ9A 3LGKA 4WK5A 1YHLA 1WMWA 3PH7A 3LSNA 1YQ7A 2Q9YA 5DGNF 3OYRA 3LGZB 4N9UA 2ONHA 4KKMA 3EFQA 5DJPF 5B02A 2DH4A 5JV0F 3KRAB 3M9UA 3NF2A 3EGTA 3WEKA 2F8CF 3G4DA 4DI5A 2E8VA 3V1XA 2VF6A 3OABB 5ILKA 4XQSF 1FPSA 3SDRA 2Q9ZA 3KRCA 3KB9A 4F6VA 4MC3A 3WCJA 3WCDA 1YYQA 5ERNA 2ZCSA 2F7MF 4JXYA 5CG5A 3WSBA 1UBXA 5AHUB 3VJ8A 5IM1A 4RXAA 1YYSA 5A0IA 2OA6A 2ZCQA 4OKMA 2Z4WA 5KSXF 3WCMA 4KFAA 4KVYA 4LXWA 4DWBA 3LG5A 3LEEA 5HNAA 3P41A 3QKCA 4LZCA 5DGMF 4F62A 1HM4A 3N49F 3P5PA 3N45F 1HM7A 5DHIA 3SDVA 3LMDA 5ILJA 2F9KF 4MC0A 1WL3A 2Z50A 3ID0A 5IL8A 3WE9A 3N3DA 3NRIA 1RQIA 5E8HA 5IN8A 2Q58A 3WC9A 4JYXA 2O1OA 3KRCB 2Z52A 1KIYA 4RXEA 3UCAA 5IKAA 1YYUA 3ACWA 2E8WA 3N1VF 2FORA 4KUXA 5IL3A 2E4OA 4KPDA 1V4IA 2I19A 3PYBA 4RXDA 4KQSA 4RYPA 3LLWA 4Q23A 4H5CF 4KWDA 4LLSA 4XQTF 3SDTA 5EATA 2Z7IA 3VJDA 3MZVA 3LZ9A 3N5HF 4LZ0A 4LFEA 3N1WF 4NFJF 4P0XA 2PS5A 3OACA 2J1OA 3MAVA 5EASA 4NFIF 3AQ0A 3CP6A 1YV5A 5IK9A 4DEMF 1RTRA 4EA0A 5IK0A 3Q2ZA 3M0GA 4XQRF 4EA2A 3WCLA 3ADZA 3WCHA 3N46F 5ERMA 3WCEA 5HN7A 2ONGA 2E91A 3PYAA 4L2XF 3KBKA 1WL1A 4NUAA 4OKZA 5ILIA 3BNXA 4KQ5A 3V1VA 1RQJA 4GA3A 3NPKA 5AFXA 3LK5A 5B0KA 1WY0A 2E8TA 5H9DA 3N3LF 3AE0A 1HXAA 1UBYA 5JA0F 4EA1A 5IVGA 3CKEA 2AZLA 4E9UA 2Z78A 3RMGA 3OACB 4KVWA 3DYFA 2J5CA 2F92F 2Z4YA 1KIZA 3M00A 5HN8A 3VJBA 3KRFB 2Z4VA 4PVYF 2E94A 2J1PA 4K10A 3Q2QA 3DYHA 4KQUA 1YHMA 1WL2A 5ILDA 2E95A 1V4KA 3WCCA 5C05A 3NPRA 2ZCOA 3P8RA 1VG2A 1JFGA 4LTZA 4LFGA 1N24A 4FJQA 3LVSA 5DGSF 4KK2A 2ZEVA 1UBVA 4QPFA 3APZA 4E1EA 3ICKA 4LTVA 2P1CA 2F94F 3P8LA 3SDUA 3W7FA 1VG7A 4RXCA 3ZCDA 3Q1OA 4FP4A 3RYEA 2PS4A 1V4JA 4LA5A 5E8LA 2QISA 5I1UA 1VG3A 3WEHA 5DW7A 4KVIA 1EZFA 3ICZA 4OMHA 1WKZA 3WCFA 4DHDA 4JXNA 4NG6A 1HXCA 1PS1A 4LLTA 4JZXA
chains in the Genus database with same CATH superfamily
5A0KA 5IMNA 5DIQF 5B0JA 1JFAA 3SAEA 2FTZA 1YYTA 4DWGA 4NFKF 5B0LA 2PS7A 1DI1A 4MC8A 3TS7A 4LFVF 2ZY1A 4LPHF 3ASXA 5IMPA 3TC1A 3DYGA 4GP2A 5ILHA 5B0MA 5A0JA 3KRFA 2AETA 3RBMA 4PVXF 3WEGA 2Z4ZA 4DZWA 2AZKA 1DGPA 2OPMA 3ACYA 1UBWA 5EAUA 3LOMA 1ZW5A 4HD1A 3PDEA 4LPGF 2EWGA 5ER8A 2F8ZF 3N5JF 3WCIA 2H8OA 5EROA 5B01A 1HXGA 3ICNA 4LOBA 4N1ZF 3N0GA 5DHKA 3IPIA 5JV2F 3RYWA 3KROA 3WSAA 4NKEA 1VG4A 3KRPA 1N21A 4LZ3A 4QXSF 3WEFA 5B03A 4JZBA 5IK6A 2AELA 3B7LA 4OMGA 3CC9A 4RNQA 3N0FA 3WCBA 3ZOUA 4LA6A 3WEJA 3EZ3A 3WEIA 5AYPA 3QQVA 4ZQ8A 2AZJA 3ZL6A 1YJ4A 3WJKA 4P0VA 5JUZF 2E8UA 3WCAA 3AQBB 3ACXA 3IBAA 1HX9A 2E90A 4GP1A 5E8KA 2Z4XA 2OGDA 1N1BA 1N20A 3ZMCA 4JVJF 1N1ZA 3TFNA 2PS8A 3PKOA 2E8XA 3LDWA 3SDQA 2Q80A 3VJEA 3KROB 3LJIA 3KRPB 2ZEUA 2F89F 1YHKA 3G4FA 4H5EF 5DJVF 2Z7HA 5B00A 1N22A 4NKFA 4F6XA 4H5DF 3M02A 3WJNA 1VG6A 5IMIA 1N23A 2OPNA 4E9ZA 3WJOA 1YYRA 5DJRF 3S9VA 2RAHA 5DZ2A 3AQCB 4LUUA 3VJCA 5ILYA 4LIXA 2ZCRA 3ICMA 1WL0A 4P0WA 5ILZA 3Q30A 4KPJA 2AEKA 3KRAA 5IKHA 5HN9A 5B0IA 2E92A 4GAXA 4KVDA 5JV1F 3S4JA 4UMJA 3WCGA 3P5RA 3V66A 3ZMBA 1V4EA 2E93A 3OABA 3TFVA 5AELA 3N6KF 5CG6A 3VJAA 1V4HA 4DXJA 3TFPA 3M01A 3BNYA 2PS6A 4OGUA 3VJ9A 3LGKA 4WK5A 1YHLA 1WMWA 3PH7A 3LSNA 1YQ7A 2Q9YA 5DGNF 3OYRA 3LGZB 4N9UA 2ONHA 4KKMA 3EFQA 5DJPF 5B02A 2DH4A 5JV0F 3KRAB 3M9UA 3NF2A 3EGTA 3WEKA 2F8CF 3G4DA 4DI5A 2E8VA 3V1XA 2VF6A 3OABB 5ILKA 4XQSF 1FPSA 3SDRA 2Q9ZA 3KRCA 3KB9A 4F6VA 4MC3A 3WCJA 3WCDA 1YYQA 5ERNA 2ZCSA 2F7MF 4JXYA 5CG5A 3WSBA 1UBXA 5AHUB 3VJ8A 5IM1A 4RXAA 1YYSA 5A0IA 2OA6A 2ZCQA 4OKMA 2Z4WA 5KSXF 3WCMA 4KFAA 4KVYA 4LXWA 4DWBA 3LG5A 3LEEA 5HNAA 3P41A 3QKCA 4LZCA 5DGMF 4F62A 1HM4A 3N49F 3P5PA 3N45F 1HM7A 5DHIA 3SDVA 3LMDA 5ILJA 2F9KF 4MC0A 1WL3A 2Z50A 3ID0A 5IL8A 3WE9A 3N3DA 3NRIA 1RQIA 5E8HA 5IN8A 2Q58A 3WC9A 4JYXA 2O1OA 3KRCB 2Z52A 1KIYA 4RXEA 3UCAA 5IKAA 1YYUA 3ACWA 2E8WA 3N1VF 2FORA 4KUXA 5IL3A 2E4OA 4KPDA 1V4IA 2I19A 3PYBA 4RXDA 4KQSA 4RYPA 3LLWA 4Q23A 4H5CF 4KWDA 4LLSA 4XQTF 3SDTA 5EATA 2Z7IA 3VJDA 3MZVA 3LZ9A 3N5HF 4LZ0A 4LFEA 3N1WF 4NFJF 4P0XA 2PS5A 3OACA 2J1OA 3MAVA 5EASA 4NFIF 3AQ0A 3CP6A 1YV5A 5IK9A 4DEMF 1RTRA 4EA0A 5IK0A 3Q2ZA 3M0GA 4XQRF 4EA2A 3WCLA 3ADZA 3WCHA 3N46F 5ERMA 3WCEA 5HN7A 2ONGA 2E91A 3PYAA 4L2XF 3KBKA 1WL1A 4NUAA 4OKZA 5ILIA 3BNXA 4KQ5A 3V1VA 1RQJA 4GA3A 3NPKA 5AFXA 3LK5A 5B0KA 1WY0A 2E8TA 5H9DA 3N3LF 3AE0A 1HXAA 1UBYA 5JA0F 4EA1A 5IVGA 3CKEA 2AZLA 4E9UA 2Z78A 3RMGA 3OACB 4KVWA 3DYFA 2J5CA 2F92F 2Z4YA 1KIZA 3M00A 5HN8A 3VJBA 3KRFB 2Z4VA 4PVYF 2E94A 2J1PA 4K10A 3Q2QA 3DYHA 4KQUA 1YHMA 1WL2A 5ILDA 2E95A 1V4KA 3WCCA 5C05A 3NPRA 2ZCOA 3P8RA 1VG2A 1JFGA 4LTZA 4LFGA 1N24A 4FJQA 3LVSA 5DGSF 4KK2A 2ZEVA 1UBVA 4QPFA 3APZA 4E1EA 3ICKA 4LTVA 2P1CA 2F94F 3P8LA 3SDUA 3W7FA 1VG7A 4RXCA 3ZCDA 3Q1OA 4FP4A 3RYEA 2PS4A 1V4JA 4LA5A 5E8LA 2QISA 5I1UA 1VG3A 3WEHA 5DW7A 4KVIA 1EZFA 3ICZA 4OMHA 1WKZA 3WCFA 4DHDA 4JXNA 4NG6A 1HXCA 1PS1A 4LLTA 4JZXA
chains in the Genus database with same CATH topology
5A0KA 5IMNA 5DIQF 5B0JA 1JFAA 3SAEA 2FTZA 1YYTA 4DWGA 4NFKF 5B0LA 2PS7A 1DI1A 4MC8A 3TS7A 4LFVF 2ZY1A 4LPHF 3ASXA 5IMPA 3TC1A 3DYGA 4GP2A 5ILHA 5B0MA 5A0JA 3KRFA 2AETA 3RBMA 4PVXF 3WEGA 2Z4ZA 4DZWA 2AZKA 1DGPA 2OPMA 3ACYA 1UBWA 5EAUA 3LOMA 1ZW5A 4HD1A 3PDEA 4LPGF 2EWGA 5ER8A 2F8ZF 3N5JF 3WCIA 2H8OA 5EROA 5B01A 1HXGA 3ICNA 4LOBA 4N1ZF 3N0GA 5DHKA 3IPIA 5JV2F 3RYWA 3KROA 3WSAA 4NKEA 1VG4A 3KRPA 1N21A 4LZ3A 4QXSF 3WEFA 5B03A 4JZBA 5IK6A 2AELA 3B7LA 4OMGA 3CC9A 4RNQA 3N0FA 3WCBA 3ZOUA 4LA6A 3WEJA 3EZ3A 3WEIA 5AYPA 3QQVA 4ZQ8A 2AZJA 3ZL6A 1YJ4A 3WJKA 4P0VA 5JUZF 2E8UA 3WCAA 3AQBB 3ACXA 3IBAA 1HX9A 2E90A 4GP1A 5E8KA 2Z4XA 2OGDA 1N1BA 1N20A 3ZMCA 4JVJF 1N1ZA 3TFNA 2PS8A 3PKOA 2E8XA 3LDWA 3SDQA 2Q80A 3VJEA 3KROB 3LJIA 3KRPB 2ZEUA 2F89F 1YHKA 3G4FA 4H5EF 5DJVF 2Z7HA 5B00A 1N22A 4NKFA 4F6XA 4H5DF 3M02A 3WJNA 1VG6A 5IMIA 1N23A 2OPNA 4E9ZA 3WJOA 1YYRA 5DJRF 3S9VA 2RAHA 5DZ2A 3AQCB 4LUUA 3VJCA 5ILYA 4LIXA 2ZCRA 3ICMA 1WL0A 4P0WA 5ILZA 3Q30A 4KPJA 2AEKA 3KRAA 5IKHA 5HN9A 5B0IA 2E92A 4GAXA 4KVDA 5JV1F 3S4JA 4UMJA 3WCGA 3P5RA 3V66A 3ZMBA 1V4EA 2E93A 3OABA 3TFVA 5AELA 3N6KF 5CG6A 3VJAA 1V4HA 4DXJA 3TFPA 3M01A 3BNYA 2PS6A 4OGUA 3VJ9A 3LGKA 4WK5A 1YHLA 1WMWA 3PH7A 3LSNA 1YQ7A 2Q9YA 5DGNF 3OYRA 3LGZB 4N9UA 2ONHA 4KKMA 3EFQA 5DJPF 5B02A 2DH4A 5JV0F 3KRAB 3M9UA 3NF2A 3EGTA 3WEKA 2F8CF 3G4DA 4DI5A 2E8VA 3V1XA 2VF6A 3OABB 5ILKA 4XQSF 1FPSA 3SDRA 2Q9ZA 3KRCA 3KB9A 4F6VA 4MC3A 3WCJA 3WCDA 1YYQA 5ERNA 2ZCSA 2F7MF 4JXYA 5CG5A 3WSBA 1UBXA 5AHUB 3VJ8A 5IM1A 4RXAA 1YYSA 5A0IA 2OA6A 2ZCQA 4OKMA 2Z4WA 5KSXF 3WCMA 4KFAA 4KVYA 4LXWA 4DWBA 3LG5A 3LEEA 5HNAA 3P41A 3QKCA 4LZCA 5DGMF 4F62A 1HM4A 3N49F 3P5PA 3N45F 1HM7A 5DHIA 3SDVA 3LMDA 5ILJA 2F9KF 4MC0A 1WL3A 2Z50A 3ID0A 5IL8A 3WE9A 3N3DA 3NRIA 1RQIA 5E8HA 5IN8A 2Q58A 3WC9A 4JYXA 2O1OA 3KRCB 2Z52A 1KIYA 4RXEA 3UCAA 5IKAA 1YYUA 3ACWA 2E8WA 3N1VF 2FORA 4KUXA 5IL3A 2E4OA 4KPDA 1V4IA 2I19A 3PYBA 4RXDA 4KQSA 4RYPA 3LLWA 4Q23A 4H5CF 4KWDA 4LLSA 4XQTF 3SDTA 5EATA 2Z7IA 3VJDA 3MZVA 3LZ9A 3N5HF 4LZ0A 4LFEA 3N1WF 4NFJF 4P0XA 2PS5A 3OACA 2J1OA 3MAVA 5EASA 4NFIF 3AQ0A 3CP6A 1YV5A 5IK9A 4DEMF 1RTRA 4EA0A 5IK0A 3Q2ZA 3M0GA 4XQRF 4EA2A 3WCLA 3ADZA 3WCHA 3N46F 5ERMA 3WCEA 5HN7A 2ONGA 2E91A 3PYAA 4L2XF 3KBKA 1WL1A 4NUAA 4OKZA 5ILIA 3BNXA 4KQ5A 3V1VA 1RQJA 4GA3A 3NPKA 5AFXA 3LK5A 5B0KA 1WY0A 2E8TA 5H9DA 3N3LF 3AE0A 1HXAA 1UBYA 5JA0F 4EA1A 5IVGA 3CKEA 2AZLA 4E9UA 2Z78A 3RMGA 3OACB 4KVWA 3DYFA 2J5CA 2F92F 2Z4YA 1KIZA 3M00A 5HN8A 3VJBA 3KRFB 2Z4VA 4PVYF 2E94A 2J1PA 4K10A 3Q2QA 3DYHA 4KQUA 1YHMA 1WL2A 5ILDA 2E95A 1V4KA 3WCCA 5C05A 3NPRA 2ZCOA 3P8RA 1VG2A 1JFGA 4LTZA 4LFGA 1N24A 4FJQA 3LVSA 5DGSF 4KK2A 2ZEVA 1UBVA 4QPFA 3APZA 4E1EA 3ICKA 4LTVA 2P1CA 2F94F 3P8LA 3SDUA 3W7FA 1VG7A 4RXCA 3ZCDA 3Q1OA 4FP4A 3RYEA 2PS4A 1V4JA 4LA5A 5E8LA 2QISA 5I1UA 1VG3A 3WEHA 5DW7A 4KVIA 1EZFA 3ICZA 4OMHA 1WKZA 3WCFA 4DHDA 4JXNA 4NG6A 1HXCA 1PS1A 4LLTA 4JZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A0K A;  5IMN A;  5DIQ F;  5B0J A;  1JFA A;  3SAE A;  2FTZ A;  1YYT A;  4DWG A;  4NFK F;  5B0L A;  2PS7 A;  1DI1 A;  4MC8 A;  3TS7 A;  4LFV F;  2ZY1 A;  4LPH F;  3ASX A;  5IMP A;  3TC1 A;  3DYG A;  4GP2 A;  5ILH A;  5B0M A;  5A0J A;  3KRF A;  2AET A;  3RBM A;  4PVX F;  3WEG A;  2Z4Z A;  4DZW A;  2AZK A;  1DGP A;  2OPM A;  3ACY A;  1UBW A;  5EAU A;  3LOM A;  1ZW5 A;  4HD1 A;  3PDE A;  4LPG F;  2EWG A;  5ER8 A;  2F8Z F;  3N5J F;  3WCI A;  2H8O A;  5ERO A;  5B01 A;  1HXG A;  3ICN A;  4LOB A;  4N1Z F;  3N0G A;  5DHK A;  3IPI A;  5JV2 F;  3RYW A;  3KRO A;  3WSA A;  4NKE A;  1VG4 A;  3KRP A;  1N21 A;  4LZ3 A;  4QXS F;  3WEF A;  5B03 A;  4JZB A;  5IK6 A;  2AEL A;  3B7L A;  4OMG A;  3CC9 A;  4RNQ A;  3N0F A;  3WCB A;  3ZOU A;  4LA6 A;  3WEJ A;  3EZ3 A;  3WEI A;  5AYP A;  3QQV A;  4ZQ8 A;  2AZJ A;  3ZL6 A;  1YJ4 A;  3WJK A;  4P0V A;  5JUZ F;  2E8U A;  3WCA A;  3AQB B;  3ACX A;  3IBA A;  1HX9 A;  2E90 A;  4GP1 A;  5E8K A;  2Z4X A;  2OGD A;  1N1B A;  1N20 A;  3ZMC A;  4JVJ F;  1N1Z A;  3TFN A;  2PS8 A;  3PKO A;  2E8X A;  3LDW A;  3SDQ A;  2Q80 A;  3VJE A;  3KRO B;  3LJI A;  3KRP B;  2ZEU A;  2F89 F;  1YHK A;  3G4F A;  4H5E F;  5DJV F;  2Z7H A;  5B00 A;  1N22 A;  4NKF A;  4F6X A;  4H5D F;  3M02 A;  3WJN A;  1VG6 A;  5IMI A;  1N23 A;  2OPN A;  4E9Z A;  3WJO A;  1YYR A;  5DJR F;  3S9V A;  2RAH A;  5DZ2 A;  3AQC B;  4LUU A;  3VJC A;  5ILY A;  4LIX A;  2ZCR A;  3ICM A;  1WL0 A;  4P0W A;  5ILZ A;  3Q30 A;  4KPJ A;  2AEK A;  3KRA A;  5IKH A;  5HN9 A;  5B0I A;  2E92 A;  4GAX A;  4KVD A;  5JV1 F;  3S4J A;  4UMJ A;  3WCG A;  3P5R A;  3V66 A;  3ZMB A;  1V4E A;  2E93 A;  3OAB A;  3TFV A;  5AEL A;  3N6K F;  5CG6 A;  3VJA A;  1V4H A;  4DXJ A;  3TFP A;  3M01 A;  3BNY A;  2PS6 A;  4OGU A;  3VJ9 A;  3LGK A;  4WK5 A;  1YHL A;  1WMW A;  3PH7 A;  3LSN A;  1YQ7 A;  2Q9Y A;  5DGN F;  3OYR A;  3LGZ B;  4N9U A;  2ONH A;  4KKM A;  3EFQ A;  5DJP F;  5B02 A;  2DH4 A;  5JV0 F;  3KRA B;  3M9U A;  3NF2 A;  3EGT A;  3WEK A;  2F8C F;  3G4D A;  4DI5 A;  2E8V A;  3V1X A;  2VF6 A;  3OAB B;  5ILK A;  4XQS F;  1FPS A;  3SDR A;  2Q9Z A;  3KRC A;  3KB9 A;  4F6V A;  4MC3 A;  3WCJ A;  3WCD A;  1YYQ A;  5ERN A;  2ZCS A;  2F7M F;  4JXY A;  5CG5 A;  3WSB A;  1UBX A;  5AHU B;  3VJ8 A;  5IM1 A;  4RXA A;  1YYS A;  5A0I A;  2OA6 A;  2ZCQ A;  4OKM A;  2Z4W A;  5KSX F;  3WCM A;  4KFA A;  4KVY A;  4LXW A;  4DWB A;  3LG5 A;  3LEE A;  5HNA A;  3P41 A;  3QKC A;  4LZC A;  5DGM F;  4F62 A;  1HM4 A;  3N49 F;  3P5P A;  3N45 F;  1HM7 A;  5DHI A;  3SDV A;  3LMD A;  5ILJ A;  2F9K F;  4MC0 A;  1WL3 A;  2Z50 A;  3ID0 A;  5IL8 A;  3WE9 A;  3N3D A;  3NRI A;  1RQI A;  5E8H A;  5IN8 A;  2Q58 A;  3WC9 A;  4JYX A;  2O1O A;  3KRC B;  2Z52 A;  1KIY A;  4RXE A;  3UCA A;  5IKA A;  1YYU A;  3ACW A;  2E8W A;  3N1V F;  2FOR A;  4KUX A;  5IL3 A;  2E4O A;  4KPD A;  1V4I A;  2I19 A;  3PYB A;  4RXD A;  4KQS A;  4RYP A;  3LLW A;  4Q23 A;  4H5C F;  4KWD A;  4LLS A;  4XQT F;  3SDT A;  5EAT A;  2Z7I A;  3VJD A;  3MZV A;  3LZ9 A;  3N5H F;  4LZ0 A;  4LFE A;  3N1W F;  4NFJ F;  4P0X A;  2PS5 A;  3OAC A;  2J1O A;  3MAV A;  5EAS A;  4NFI F;  3AQ0 A;  3CP6 A;  1YV5 A;  5IK9 A;  4DEM F;  1RTR A;  4EA0 A;  5IK0 A;  3Q2Z A;  3M0G A;  4XQR F;  4EA2 A;  3WCL A;  3ADZ A;  3WCH A;  3N46 F;  5ERM A;  3WCE A;  5HN7 A;  2ONG A;  2E91 A;  3PYA A;  4L2X F;  3KBK A;  1WL1 A;  4NUA A;  4OKZ A;  5ILI A;  3BNX A;  4KQ5 A;  3V1V A;  1RQJ A;  4GA3 A;  3NPK A;  5AFX A;  3LK5 A;  5B0K A;  1WY0 A;  2E8T A;  5H9D A;  3N3L F;  3AE0 A;  1HXA A;  1UBY A;  5JA0 F;  4EA1 A;  5IVG A;  3CKE A;  2AZL A;  4E9U A;  2Z78 A;  3RMG A;  3OAC B;  4KVW A;  3DYF A;  2J5C A;  2F92 F;  2Z4Y A;  1KIZ A;  3M00 A;  5HN8 A;  3VJB A;  3KRF B;  2Z4V A;  4PVY F;  2E94 A;  2J1P A;  4K10 A;  3Q2Q A;  3DYH A;  4KQU A;  1YHM A;  1WL2 A;  5ILD A;  2E95 A;  1V4K A;  3WCC A;  5C05 A;  3NPR A;  2ZCO A;  3P8R A;  1VG2 A;  1JFG A;  4LTZ A;  4LFG A;  1N24 A;  4FJQ A;  3LVS A;  5DGS F;  4KK2 A;  2ZEV A;  1UBV A;  4QPF A;  3APZ A;  4E1E A;  3ICK A;  4LTV A;  2P1C A;  2F94 F;  3P8L A;  3SDU A;  3W7F A;  1VG7 A;  4RXC A;  3ZCD A;  3Q1O A;  4FP4 A;  3RYE A;  2PS4 A;  1V4J A;  4LA5 A;  5E8L A;  2QIS A;  5I1U A;  1VG3 A;  3WEH A;  5DW7 A;  4KVI A;  1EZF A;  3ICZ A;  4OMH A;  1WKZ A;  3WCF A;  4DHD A;  4JXN A;  4NG6 A;  1HXC A;  1PS1 A;  4LLT A;  4JZX A; 
#chains in the Genus database with same CATH topology
 5A0K A;  5IMN A;  5DIQ F;  5B0J A;  1JFA A;  3SAE A;  2FTZ A;  1YYT A;  4DWG A;  4NFK F;  5B0L A;  2PS7 A;  1DI1 A;  4MC8 A;  3TS7 A;  4LFV F;  2ZY1 A;  4LPH F;  3ASX A;  5IMP A;  3TC1 A;  3DYG A;  4GP2 A;  5ILH A;  5B0M A;  5A0J A;  3KRF A;  2AET A;  3RBM A;  4PVX F;  3WEG A;  2Z4Z A;  4DZW A;  2AZK A;  1DGP A;  2OPM A;  3ACY A;  1UBW A;  5EAU A;  3LOM A;  1ZW5 A;  4HD1 A;  3PDE A;  4LPG F;  2EWG A;  5ER8 A;  2F8Z F;  3N5J F;  3WCI A;  2H8O A;  5ERO A;  5B01 A;  1HXG A;  3ICN A;  4LOB A;  4N1Z F;  3N0G A;  5DHK A;  3IPI A;  5JV2 F;  3RYW A;  3KRO A;  3WSA A;  4NKE A;  1VG4 A;  3KRP A;  1N21 A;  4LZ3 A;  4QXS F;  3WEF A;  5B03 A;  4JZB A;  5IK6 A;  2AEL A;  3B7L A;  4OMG A;  3CC9 A;  4RNQ A;  3N0F A;  3WCB A;  3ZOU A;  4LA6 A;  3WEJ A;  3EZ3 A;  3WEI A;  5AYP A;  3QQV A;  4ZQ8 A;  2AZJ A;  3ZL6 A;  1YJ4 A;  3WJK A;  4P0V A;  5JUZ F;  2E8U A;  3WCA A;  3AQB B;  3ACX A;  3IBA A;  1HX9 A;  2E90 A;  4GP1 A;  5E8K A;  2Z4X A;  2OGD A;  1N1B A;  1N20 A;  3ZMC A;  4JVJ F;  1N1Z A;  3TFN A;  2PS8 A;  3PKO A;  2E8X A;  3LDW A;  3SDQ A;  2Q80 A;  3VJE A;  3KRO B;  3LJI A;  3KRP B;  2ZEU A;  2F89 F;  1YHK A;  3G4F A;  4H5E F;  5DJV F;  2Z7H A;  5B00 A;  1N22 A;  4NKF A;  4F6X A;  4H5D F;  3M02 A;  3WJN A;  1VG6 A;  5IMI A;  1N23 A;  2OPN A;  4E9Z A;  3WJO A;  1YYR A;  5DJR F;  3S9V A;  2RAH A;  5DZ2 A;  3AQC B;  4LUU A;  3VJC A;  5ILY A;  4LIX A;  2ZCR A;  3ICM A;  1WL0 A;  4P0W A;  5ILZ A;  3Q30 A;  4KPJ A;  2AEK A;  3KRA A;  5IKH A;  5HN9 A;  5B0I A;  2E92 A;  4GAX A;  4KVD A;  5JV1 F;  3S4J A;  4UMJ A;  3WCG A;  3P5R A;  3V66 A;  3ZMB A;  1V4E A;  2E93 A;  3OAB A;  3TFV A;  5AEL A;  3N6K F;  5CG6 A;  3VJA A;  1V4H A;  4DXJ A;  3TFP A;  3M01 A;  3BNY A;  2PS6 A;  4OGU A;  3VJ9 A;  3LGK A;  4WK5 A;  1YHL A;  1WMW A;  3PH7 A;  3LSN A;  1YQ7 A;  2Q9Y A;  5DGN F;  3OYR A;  3LGZ B;  4N9U A;  2ONH A;  4KKM A;  3EFQ A;  5DJP F;  5B02 A;  2DH4 A;  5JV0 F;  3KRA B;  3M9U A;  3NF2 A;  3EGT A;  3WEK A;  2F8C F;  3G4D A;  4DI5 A;  2E8V A;  3V1X A;  2VF6 A;  3OAB B;  5ILK A;  4XQS F;  1FPS A;  3SDR A;  2Q9Z A;  3KRC A;  3KB9 A;  4F6V A;  4MC3 A;  3WCJ A;  3WCD A;  1YYQ A;  5ERN A;  2ZCS A;  2F7M F;  4JXY A;  5CG5 A;  3WSB A;  1UBX A;  5AHU B;  3VJ8 A;  5IM1 A;  4RXA A;  1YYS A;  5A0I A;  2OA6 A;  2ZCQ A;  4OKM A;  2Z4W A;  5KSX F;  3WCM A;  4KFA A;  4KVY A;  4LXW A;  4DWB A;  3LG5 A;  3LEE A;  5HNA A;  3P41 A;  3QKC A;  4LZC A;  5DGM F;  4F62 A;  1HM4 A;  3N49 F;  3P5P A;  3N45 F;  1HM7 A;  5DHI A;  3SDV A;  3LMD A;  5ILJ A;  2F9K F;  4MC0 A;  1WL3 A;  2Z50 A;  3ID0 A;  5IL8 A;  3WE9 A;  3N3D A;  3NRI A;  1RQI A;  5E8H A;  5IN8 A;  2Q58 A;  3WC9 A;  4JYX A;  2O1O A;  3KRC B;  2Z52 A;  1KIY A;  4RXE A;  3UCA A;  5IKA A;  1YYU A;  3ACW A;  2E8W A;  3N1V F;  2FOR A;  4KUX A;  5IL3 A;  2E4O A;  4KPD A;  1V4I A;  2I19 A;  3PYB A;  4RXD A;  4KQS A;  4RYP A;  3LLW A;  4Q23 A;  4H5C F;  4KWD A;  4LLS A;  4XQT F;  3SDT A;  5EAT A;  2Z7I A;  3VJD A;  3MZV A;  3LZ9 A;  3N5H F;  4LZ0 A;  4LFE A;  3N1W F;  4NFJ F;  4P0X A;  2PS5 A;  3OAC A;  2J1O A;  3MAV A;  5EAS A;  4NFI F;  3AQ0 A;  3CP6 A;  1YV5 A;  5IK9 A;  4DEM F;  1RTR A;  4EA0 A;  5IK0 A;  3Q2Z A;  3M0G A;  4XQR F;  4EA2 A;  3WCL A;  3ADZ A;  3WCH A;  3N46 F;  5ERM A;  3WCE A;  5HN7 A;  2ONG A;  2E91 A;  3PYA A;  4L2X F;  3KBK A;  1WL1 A;  4NUA A;  4OKZ A;  5ILI A;  3BNX A;  4KQ5 A;  3V1V A;  1RQJ A;  4GA3 A;  3NPK A;  5AFX A;  3LK5 A;  5B0K A;  1WY0 A;  2E8T A;  5H9D A;  3N3L F;  3AE0 A;  1HXA A;  1UBY A;  5JA0 F;  4EA1 A;  5IVG A;  3CKE A;  2AZL A;  4E9U A;  2Z78 A;  3RMG A;  3OAC B;  4KVW A;  3DYF A;  2J5C A;  2F92 F;  2Z4Y A;  1KIZ A;  3M00 A;  5HN8 A;  3VJB A;  3KRF B;  2Z4V A;  4PVY F;  2E94 A;  2J1P A;  4K10 A;  3Q2Q A;  3DYH A;  4KQU A;  1YHM A;  1WL2 A;  5ILD A;  2E95 A;  1V4K A;  3WCC A;  5C05 A;  3NPR A;  2ZCO A;  3P8R A;  1VG2 A;  1JFG A;  4LTZ A;  4LFG A;  1N24 A;  4FJQ A;  3LVS A;  5DGS F;  4KK2 A;  2ZEV A;  1UBV A;  4QPF A;  3APZ A;  4E1E A;  3ICK A;  4LTV A;  2P1C A;  2F94 F;  3P8L A;  3SDU A;  3W7F A;  1VG7 A;  4RXC A;  3ZCD A;  3Q1O A;  4FP4 A;  3RYE A;  2PS4 A;  1V4J A;  4LA5 A;  5E8L A;  2QIS A;  5I1U A;  1VG3 A;  3WEH A;  5DW7 A;  4KVI A;  1EZF A;  3ICZ A;  4OMH A;  1WKZ A;  3WCF A;  4DHD A;  4JXN A;  4NG6 A;  1HXC A;  1PS1 A;  4LLT A;  4JZX A; 
#chains in the Genus database with same CATH homology
 5A0K A;  5IMN A;  5DIQ F;  5B0J A;  1JFA A;  3SAE A;  2FTZ A;  1YYT A;  4DWG A;  4NFK F;  5B0L A;  2PS7 A;  1DI1 A;  4MC8 A;  3TS7 A;  4LFV F;  2ZY1 A;  4LPH F;  3ASX A;  5IMP A;  3TC1 A;  3DYG A;  4GP2 A;  5ILH A;  5B0M A;  5A0J A;  3KRF A;  2AET A;  3RBM A;  4PVX F;  3WEG A;  2Z4Z A;  4DZW A;  2AZK A;  1DGP A;  2OPM A;  3ACY A;  1UBW A;  5EAU A;  3LOM A;  1ZW5 A;  4HD1 A;  3PDE A;  4LPG F;  2EWG A;  5ER8 A;  2F8Z F;  3N5J F;  3WCI A;  2H8O A;  5ERO A;  5B01 A;  1HXG A;  3ICN A;  4LOB A;  4N1Z F;  3N0G A;  5DHK A;  3IPI A;  5JV2 F;  3RYW A;  3KRO A;  3WSA A;  4NKE A;  1VG4 A;  3KRP A;  1N21 A;  4LZ3 A;  4QXS F;  3WEF A;  5B03 A;  4JZB A;  5IK6 A;  2AEL A;  3B7L A;  4OMG A;  3CC9 A;  4RNQ A;  3N0F A;  3WCB A;  3ZOU A;  4LA6 A;  3WEJ A;  3EZ3 A;  3WEI A;  5AYP A;  3QQV A;  4ZQ8 A;  2AZJ A;  3ZL6 A;  1YJ4 A;  3WJK A;  4P0V A;  5JUZ F;  2E8U A;  3WCA A;  3AQB B;  3ACX A;  3IBA A;  1HX9 A;  2E90 A;  4GP1 A;  5E8K A;  2Z4X A;  2OGD A;  1N1B A;  1N20 A;  3ZMC A;  4JVJ F;  1N1Z A;  3TFN A;  2PS8 A;  3PKO A;  2E8X A;  3LDW A;  3SDQ A;  2Q80 A;  3VJE A;  3KRO B;  3LJI A;  3KRP B;  2ZEU A;  2F89 F;  1YHK A;  3G4F A;  4H5E F;  5DJV F;  2Z7H A;  5B00 A;  1N22 A;  4NKF A;  4F6X A;  4H5D F;  3M02 A;  3WJN A;  1VG6 A;  5IMI A;  1N23 A;  2OPN A;  4E9Z A;  3WJO A;  1YYR A;  5DJR F;  3S9V A;  2RAH A;  5DZ2 A;  3AQC B;  4LUU A;  3VJC A;  5ILY A;  4LIX A;  2ZCR A;  3ICM A;  1WL0 A;  4P0W A;  5ILZ A;  3Q30 A;  4KPJ A;  2AEK A;  3KRA A;  5IKH A;  5HN9 A;  5B0I A;  2E92 A;  4GAX A;  4KVD A;  5JV1 F;  3S4J A;  4UMJ A;  3WCG A;  3P5R A;  3V66 A;  3ZMB A;  1V4E A;  2E93 A;  3OAB A;  3TFV A;  5AEL A;  3N6K F;  5CG6 A;  3VJA A;  1V4H A;  4DXJ A;  3TFP A;  3M01 A;  3BNY A;  2PS6 A;  4OGU A;  3VJ9 A;  3LGK A;  4WK5 A;  1YHL A;  1WMW A;  3PH7 A;  3LSN A;  1YQ7 A;  2Q9Y A;  5DGN F;  3OYR A;  3LGZ B;  4N9U A;  2ONH A;  4KKM A;  3EFQ A;  5DJP F;  5B02 A;  2DH4 A;  5JV0 F;  3KRA B;  3M9U A;  3NF2 A;  3EGT A;  3WEK A;  2F8C F;  3G4D A;  4DI5 A;  2E8V A;  3V1X A;  2VF6 A;  3OAB B;  5ILK A;  4XQS F;  1FPS A;  3SDR A;  2Q9Z A;  3KRC A;  3KB9 A;  4F6V A;  4MC3 A;  3WCJ A;  3WCD A;  1YYQ A;  5ERN A;  2ZCS A;  2F7M F;  4JXY A;  5CG5 A;  3WSB A;  1UBX A;  5AHU B;  3VJ8 A;  5IM1 A;  4RXA A;  1YYS A;  5A0I A;  2OA6 A;  2ZCQ A;  4OKM A;  2Z4W A;  5KSX F;  3WCM A;  4KFA A;  4KVY A;  4LXW A;  4DWB A;  3LG5 A;  3LEE A;  5HNA A;  3P41 A;  3QKC A;  4LZC A;  5DGM F;  4F62 A;  1HM4 A;  3N49 F;  3P5P A;  3N45 F;  1HM7 A;  5DHI A;  3SDV A;  3LMD A;  5ILJ A;  2F9K F;  4MC0 A;  1WL3 A;  2Z50 A;  3ID0 A;  5IL8 A;  3WE9 A;  3N3D A;  3NRI A;  1RQI A;  5E8H A;  5IN8 A;  2Q58 A;  3WC9 A;  4JYX A;  2O1O A;  3KRC B;  2Z52 A;  1KIY A;  4RXE A;  3UCA A;  5IKA A;  1YYU A;  3ACW A;  2E8W A;  3N1V F;  2FOR A;  4KUX A;  5IL3 A;  2E4O A;  4KPD A;  1V4I A;  2I19 A;  3PYB A;  4RXD A;  4KQS A;  4RYP A;  3LLW A;  4Q23 A;  4H5C F;  4KWD A;  4LLS A;  4XQT F;  3SDT A;  5EAT A;  2Z7I A;  3VJD A;  3MZV A;  3LZ9 A;  3N5H F;  4LZ0 A;  4LFE A;  3N1W F;  4NFJ F;  4P0X A;  2PS5 A;  3OAC A;  2J1O A;  3MAV A;  5EAS A;  4NFI F;  3AQ0 A;  3CP6 A;  1YV5 A;  5IK9 A;  4DEM F;  1RTR A;  4EA0 A;  5IK0 A;  3Q2Z A;  3M0G A;  4XQR F;  4EA2 A;  3WCL A;  3ADZ A;  3WCH A;  3N46 F;  5ERM A;  3WCE A;  5HN7 A;  2ONG A;  2E91 A;  3PYA A;  4L2X F;  3KBK A;  1WL1 A;  4NUA A;  4OKZ A;  5ILI A;  3BNX A;  4KQ5 A;  3V1V A;  1RQJ A;  4GA3 A;  3NPK A;  5AFX A;  3LK5 A;  5B0K A;  1WY0 A;  2E8T A;  5H9D A;  3N3L F;  3AE0 A;  1HXA A;  1UBY A;  5JA0 F;  4EA1 A;  5IVG A;  3CKE A;  2AZL A;  4E9U A;  2Z78 A;  3RMG A;  3OAC B;  4KVW A;  3DYF A;  2J5C A;  2F92 F;  2Z4Y A;  1KIZ A;  3M00 A;  5HN8 A;  3VJB A;  3KRF B;  2Z4V A;  4PVY F;  2E94 A;  2J1P A;  4K10 A;  3Q2Q A;  3DYH A;  4KQU A;  1YHM A;  1WL2 A;  5ILD A;  2E95 A;  1V4K A;  3WCC A;  5C05 A;  3NPR A;  2ZCO A;  3P8R A;  1VG2 A;  1JFG A;  4LTZ A;  4LFG A;  1N24 A;  4FJQ A;  3LVS A;  5DGS F;  4KK2 A;  2ZEV A;  1UBV A;  4QPF A;  3APZ A;  4E1E A;  3ICK A;  4LTV A;  2P1C A;  2F94 F;  3P8L A;  3SDU A;  3W7F A;  1VG7 A;  4RXC A;  3ZCD A;  3Q1O A;  4FP4 A;  3RYE A;  2PS4 A;  1V4J A;  4LA5 A;  5E8L A;  2QIS A;  5I1U A;  1VG3 A;  3WEH A;  5DW7 A;  4KVI A;  1EZF A;  3ICZ A;  4OMH A;  1WKZ A;  3WCF A;  4DHD A;  4JXN A;  4NG6 A;  1HXC A;  1PS1 A;  4LLT A;  4JZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...