3CC9A

Crystal structure of plasmodium vivax putative polyprenyl pyrophosphate synthase in complex with geranylgeranyl diphosphate
Total Genus 138
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
138
sequence length
360
structure length
344
Chain Sequence
FFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKNINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSDEIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIAVDNLIYKKIEDISMLMGEYFQIHDDYLDIFSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Putative farnesyl pyrophosphate synthase
publication title Crystal structure of Plasmodium vivax putative polyprenyl pyrophosphate synthase in complex with geranylgeranyl diphosphate.
rcsb
source organism Plasmodium vivax sai-1
total genus 138
structure length 344
sequence length 360
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3cc9A00
2Q58A 3V1XA 2J1PA 5DJVF 4F6XA 3WCAA 3Q1OA 4LOBA 5E8HA 5ILZA 2E4OA 3LLWA 4LXWA 1YYTA 3KRFB 1N24A 4KUXA 2VF6A 3ADZA 2EWGA 2E8UA 3EGTA 4LFVF 4DHDA 2ZCRA 3TFNA 3EZ3A 3KB9A 3WCIA 4LZ3A 3LJIA 4EA2A 3BNYA 4P0VA 5A0KA 5HN7A 5KSXF 2AEKA 3V1VA 1VG3A 4MC0A 4ZQ8A 3PH7A 4DWGA 4XQRF 4LLSA 3MAVA 4MC3A 2H8OA 3TS7A 2AZKA 2ZEVA 3P5PA 2E8XA 2FORA 4NFIF 5EROA 3AQCB 5B02A 3WCEA 3M02A 2PS8A 3SDUA 3ID0A 4WK5A 1RQIA 5ILHA 2P1CA 4GP2A 3G4DA 5IMPA 5JV2F 1HM7A 3N0FA 2OA6A 2ZCOA 2Z4ZA 4NG6A 3LEEA 2Z52A 3KROA 4DI5A 3UCAA 3TFVA 4L2XF 4RXDA 1RQJA 3N46F 2AELA 3M01A 2J1OA 2OGDA 4N9UA 1UBXA 5IL3A 3N0GA 3ICKA 3TC1A 3KBKA 5ERMA 4KPDA 3VJBA 4DXJA 2Z50A 4F6VA 1N23A 4KWDA 2E91A 2F7MF 4LTVA 3WE9A 2ZCSA 5B01A 2ONGA 3LK5A 5IM1A 5DW7A 3ZCDA 4LA6A 1FPSA 3W7FA 3WJKA 3N45F 3OYRA 5CG6A 3RYWA 3MZVA 3PYAA 4LIXA 1JFAA 3ICMA 1N1ZA 2E90A 1UBVA 5ILIA 4KFAA 2F94F 4H5EF 4QXSF 1VG4A 3WSAA 3LGKA 4GA3A 5DGMF 5IL8A 4H5DF 3IPIA 4LUUA 4DWBA 4RXAA 2AETA 3AE0A 3SDRA 5AELA 2E92A 4JVJF 4KVYA 2PS7A 5HN9A 5EASA 3KRPA 2ZCQA 3ZOUA 4KK2A 4NFJF 1KIZA 2F9KF 3N1WF 3QQVA 4JXYA 3WSBA 5DJRF 3WCLA 4RNQA 4LFGA 2Q80A 3M00A 4NUAA 3DYFA 3NPKA 4LZCA 3SAEA 4FP4A 3SDVA 3AQ0A 4JZBA 4P0WA 5IN8A 3N49F 4NFKF 4QPFA 3ACWA 3BNXA 4EA1A 2I19A 1YHKA 2PS4A 5DHKA 5EAUA 4KVIA 2AZJA 5JV1F 2Z7IA 5HNAA 2E8VA 2PS6A 5JA0F 1WY0A 5JV0F 2OPMA 3PYBA 4OMGA 1V4KA 4PVYF 2Z4XA 4KPJA 2F92F 1VG6A 5C05A 2E95A 4NKEA 2AZLA 4RXCA 2F8CF 5ILKA 2Z78A 5ILYA 1KIYA 2Z7HA 2DH4A 3ZL6A 5IK9A 1N1BA 1UBYA 2Z4WA 3OACA 3P5RA 5AFXA 3S9VA 3VJCA 4KVDA 5ER8A 1UBWA 3P8LA 3KRCA 4JYXA 3CKEA 1N20A 1YYSA 3LZ9A 4E9ZA 3N1VF 5B0LA 3KRAA 4LPHF 1HM4A 1VG2A 2ONHA 3NF2A 2OPNA 3OACB 2PS5A 1V4HA 3P41A 3KROB 4LLTA 3SDTA 3Q2ZA 3KRCB 5IVGA 1HXAA 1YYUA 3LSNA 5E8KA 3OABA 3KRAB 3G4FA 3CC9A 3V66A 3VJ9A 1N21A 3QKCA 5B0MA 4K10A 5ILDA 4OGUA 5ILJA 4PVXF 1RTRA 5DHIA 5AYPA 4KQ5A 1WL1A 5ERNA 3LDWA 4LZ0A 3WCMA 5E8LA 3Q2QA 3ICNA 3LMDA 3ZMCA 3Q30A 3APZA 3OABB 1YYQA 4OKZA 3ICZA 5DZ2A 5AHUB 3KRFA 2E8WA 4RYPA 4LFEA 5A0JA 3WEFA 5B03A 3NRIA 4GAXA 5JUZF 4E9UA 3VJ8A 2J5CA 5A0IA 1DGPA 5IK6A 2Q9YA 5IKAA 1DI1A 4KQUA 1HXCA 1N22A 3DYHA 4E1EA 3RBMA 1WL2A 4XQSF 4KQSA 2FTZA 2E93A 3RYEA 4OKMA 4KVWA 4EA0A 3RMGA 4F62A 3N3LF 3KRPB 4LTZA 5B0KA 3WCHA 2F8ZF 4GP1A 3DYGA 3WEIA 5DJPF 1HX9A 5IKHA 2E8TA 4LA5A 3PKOA 3EFQA 1YHLA 3M9UA 4N1ZF 5I1UA 4JZXA 1ZW5A 3WEKA 3IBAA 4MC8A 4OMHA 1VG7A 2Z4YA 5DGNF 3ACXA 1YV5A 4HD1A 3LOMA 3VJAA 4KKMA 1WKZA 1V4EA 3LVSA 3N5JF 1YJ4A 3WEHA 3LGZB 3WJOA 3WCFA 1WL0A 1WMWA 5IMIA 3ASXA 3ACYA 2RAHA 3WCJA 2Q9ZA 3WEGA 3N3DA 2QISA 3B7LA 4RXEA 3WJNA 2E94A 4Q23A 5B0IA 3TFPA 1EZFA 5IK0A 3N5HF 1V4JA 1WL3A 2F89F 3P8RA 4JXNA 3VJEA 3ZMBA 3SDQA 3VJDA 3WEJA 4XQTF 5DGSF 3LG5A 3N6KF 4P0XA 4H5CF 4FJQA 4DZWA 3WC9A 4UMJA 1YYRA 1YHMA 3S4JA 4LPGF 1JFGA 3WCBA 3PDEA 4NKFA 5B00A 1V4IA 3CP6A 3NPRA 3AQBB 2O1OA 3WCGA 5EATA 1YQ7A 2ZY1A 2ZEUA 3M0GA 5HN8A 5DIQF 1HXGA 4DEMF 1PS1A 5H9DA 5B0JA 5IMNA 3WCDA 2Z4VA 3WCCA 5CG5A
chains in the Genus database with same CATH superfamily
2Q58A 3V1XA 2J1PA 5DJVF 4F6XA 3WCAA 3Q1OA 4LOBA 5E8HA 5ILZA 2E4OA 3LLWA 4LXWA 1YYTA 3KRFB 1N24A 4KUXA 2VF6A 3ADZA 2EWGA 2E8UA 3EGTA 4LFVF 4DHDA 2ZCRA 3TFNA 3EZ3A 3KB9A 3WCIA 4LZ3A 3LJIA 4EA2A 3BNYA 4P0VA 5A0KA 5HN7A 5KSXF 2AEKA 3V1VA 1VG3A 4MC0A 4ZQ8A 3PH7A 4DWGA 4XQRF 4LLSA 3MAVA 4MC3A 2H8OA 3TS7A 2AZKA 2ZEVA 3P5PA 2E8XA 2FORA 4NFIF 5EROA 3AQCB 5B02A 3WCEA 3M02A 2PS8A 3SDUA 3ID0A 4WK5A 1RQIA 5ILHA 2P1CA 4GP2A 3G4DA 5IMPA 5JV2F 1HM7A 3N0FA 2OA6A 2ZCOA 2Z4ZA 4NG6A 3LEEA 2Z52A 3KROA 4DI5A 3UCAA 3TFVA 4L2XF 4RXDA 1RQJA 3N46F 2AELA 3M01A 2J1OA 2OGDA 4N9UA 1UBXA 5IL3A 3N0GA 3ICKA 3TC1A 3KBKA 5ERMA 4KPDA 3VJBA 4DXJA 2Z50A 4F6VA 1N23A 4KWDA 2E91A 2F7MF 4LTVA 3WE9A 2ZCSA 5B01A 2ONGA 3LK5A 5IM1A 5DW7A 3ZCDA 4LA6A 1FPSA 3W7FA 3WJKA 3N45F 3OYRA 5CG6A 3RYWA 3MZVA 3PYAA 4LIXA 1JFAA 3ICMA 1N1ZA 2E90A 1UBVA 5ILIA 4KFAA 2F94F 4H5EF 4QXSF 1VG4A 3WSAA 3LGKA 4GA3A 5DGMF 5IL8A 4H5DF 3IPIA 4LUUA 4DWBA 4RXAA 2AETA 3AE0A 3SDRA 5AELA 2E92A 4JVJF 4KVYA 2PS7A 5HN9A 5EASA 3KRPA 2ZCQA 3ZOUA 4KK2A 4NFJF 1KIZA 2F9KF 3N1WF 3QQVA 4JXYA 3WSBA 5DJRF 3WCLA 4RNQA 4LFGA 2Q80A 3M00A 4NUAA 3DYFA 3NPKA 4LZCA 3SAEA 4FP4A 3SDVA 3AQ0A 4JZBA 4P0WA 5IN8A 3N49F 4NFKF 4QPFA 3ACWA 3BNXA 4EA1A 2I19A 1YHKA 2PS4A 5DHKA 5EAUA 4KVIA 2AZJA 5JV1F 2Z7IA 5HNAA 2E8VA 2PS6A 5JA0F 1WY0A 5JV0F 2OPMA 3PYBA 4OMGA 1V4KA 4PVYF 2Z4XA 4KPJA 2F92F 1VG6A 5C05A 2E95A 4NKEA 2AZLA 4RXCA 2F8CF 5ILKA 2Z78A 5ILYA 1KIYA 2Z7HA 2DH4A 3ZL6A 5IK9A 1N1BA 1UBYA 2Z4WA 3OACA 3P5RA 5AFXA 3S9VA 3VJCA 4KVDA 5ER8A 1UBWA 3P8LA 3KRCA 4JYXA 3CKEA 1N20A 1YYSA 3LZ9A 4E9ZA 3N1VF 5B0LA 3KRAA 4LPHF 1HM4A 1VG2A 2ONHA 3NF2A 2OPNA 3OACB 2PS5A 1V4HA 3P41A 3KROB 4LLTA 3SDTA 3Q2ZA 3KRCB 5IVGA 1HXAA 1YYUA 3LSNA 5E8KA 3OABA 3KRAB 3G4FA 3CC9A 3V66A 3VJ9A 1N21A 3QKCA 5B0MA 4K10A 5ILDA 4OGUA 5ILJA 4PVXF 1RTRA 5DHIA 5AYPA 4KQ5A 1WL1A 5ERNA 3LDWA 4LZ0A 3WCMA 5E8LA 3Q2QA 3ICNA 3LMDA 3ZMCA 3Q30A 3APZA 3OABB 1YYQA 4OKZA 3ICZA 5DZ2A 5AHUB 3KRFA 2E8WA 4RYPA 4LFEA 5A0JA 3WEFA 5B03A 3NRIA 4GAXA 5JUZF 4E9UA 3VJ8A 2J5CA 5A0IA 1DGPA 5IK6A 2Q9YA 5IKAA 1DI1A 4KQUA 1HXCA 1N22A 3DYHA 4E1EA 3RBMA 1WL2A 4XQSF 4KQSA 2FTZA 2E93A 3RYEA 4OKMA 4KVWA 4EA0A 3RMGA 4F62A 3N3LF 3KRPB 4LTZA 5B0KA 3WCHA 2F8ZF 4GP1A 3DYGA 3WEIA 5DJPF 1HX9A 5IKHA 2E8TA 4LA5A 3PKOA 3EFQA 1YHLA 3M9UA 4N1ZF 5I1UA 4JZXA 1ZW5A 3WEKA 3IBAA 4MC8A 4OMHA 1VG7A 2Z4YA 5DGNF 3ACXA 1YV5A 4HD1A 3LOMA 3VJAA 4KKMA 1WKZA 1V4EA 3LVSA 3N5JF 1YJ4A 3WEHA 3LGZB 3WJOA 3WCFA 1WL0A 1WMWA 5IMIA 3ASXA 3ACYA 2RAHA 3WCJA 2Q9ZA 3WEGA 3N3DA 2QISA 3B7LA 4RXEA 3WJNA 2E94A 4Q23A 5B0IA 3TFPA 1EZFA 5IK0A 3N5HF 1V4JA 1WL3A 2F89F 3P8RA 4JXNA 3VJEA 3ZMBA 3SDQA 3VJDA 3WEJA 4XQTF 5DGSF 3LG5A 3N6KF 4P0XA 4H5CF 4FJQA 4DZWA 3WC9A 4UMJA 1YYRA 1YHMA 3S4JA 4LPGF 1JFGA 3WCBA 3PDEA 4NKFA 5B00A 1V4IA 3CP6A 3NPRA 3AQBB 2O1OA 3WCGA 5EATA 1YQ7A 2ZY1A 2ZEUA 3M0GA 5HN8A 5DIQF 1HXGA 4DEMF 1PS1A 5H9DA 5B0JA 5IMNA 3WCDA 2Z4VA 3WCCA 5CG5A
chains in the Genus database with same CATH topology
2Q58A 3V1XA 2J1PA 5DJVF 4F6XA 3WCAA 3Q1OA 4LOBA 5E8HA 5ILZA 2E4OA 3LLWA 4LXWA 1YYTA 3KRFB 1N24A 4KUXA 2VF6A 3ADZA 2EWGA 2E8UA 3EGTA 4LFVF 4DHDA 2ZCRA 3TFNA 3EZ3A 3KB9A 3WCIA 4LZ3A 3LJIA 4EA2A 3BNYA 4P0VA 5A0KA 5HN7A 5KSXF 2AEKA 3V1VA 1VG3A 4MC0A 4ZQ8A 3PH7A 4DWGA 4XQRF 4LLSA 3MAVA 4MC3A 2H8OA 3TS7A 2AZKA 2ZEVA 3P5PA 2E8XA 2FORA 4NFIF 5EROA 3AQCB 5B02A 3WCEA 3M02A 2PS8A 3SDUA 3ID0A 4WK5A 1RQIA 5ILHA 2P1CA 4GP2A 3G4DA 5IMPA 5JV2F 1HM7A 3N0FA 2OA6A 2ZCOA 2Z4ZA 4NG6A 3LEEA 2Z52A 3KROA 4DI5A 3UCAA 3TFVA 4L2XF 4RXDA 1RQJA 3N46F 2AELA 3M01A 2J1OA 2OGDA 4N9UA 1UBXA 5IL3A 3N0GA 3ICKA 3TC1A 3KBKA 5ERMA 4KPDA 3VJBA 4DXJA 2Z50A 4F6VA 1N23A 4KWDA 2E91A 2F7MF 4LTVA 3WE9A 2ZCSA 5B01A 2ONGA 3LK5A 5IM1A 5DW7A 3ZCDA 4LA6A 1FPSA 3W7FA 3WJKA 3N45F 3OYRA 5CG6A 3RYWA 3MZVA 3PYAA 4LIXA 1JFAA 3ICMA 1N1ZA 2E90A 1UBVA 5ILIA 4KFAA 2F94F 4H5EF 4QXSF 1VG4A 3WSAA 3LGKA 4GA3A 5DGMF 5IL8A 4H5DF 3IPIA 4LUUA 4DWBA 4RXAA 2AETA 3AE0A 3SDRA 5AELA 2E92A 4JVJF 4KVYA 2PS7A 5HN9A 5EASA 3KRPA 2ZCQA 3ZOUA 4KK2A 4NFJF 1KIZA 2F9KF 3N1WF 3QQVA 4JXYA 3WSBA 5DJRF 3WCLA 4RNQA 4LFGA 2Q80A 3M00A 4NUAA 3DYFA 3NPKA 4LZCA 3SAEA 4FP4A 3SDVA 3AQ0A 4JZBA 4P0WA 5IN8A 3N49F 4NFKF 4QPFA 3ACWA 3BNXA 4EA1A 2I19A 1YHKA 2PS4A 5DHKA 5EAUA 4KVIA 2AZJA 5JV1F 2Z7IA 5HNAA 2E8VA 2PS6A 5JA0F 1WY0A 5JV0F 2OPMA 3PYBA 4OMGA 1V4KA 4PVYF 2Z4XA 4KPJA 2F92F 1VG6A 5C05A 2E95A 4NKEA 2AZLA 4RXCA 2F8CF 5ILKA 2Z78A 5ILYA 1KIYA 2Z7HA 2DH4A 3ZL6A 5IK9A 1N1BA 1UBYA 2Z4WA 3OACA 3P5RA 5AFXA 3S9VA 3VJCA 4KVDA 5ER8A 1UBWA 3P8LA 3KRCA 4JYXA 3CKEA 1N20A 1YYSA 3LZ9A 4E9ZA 3N1VF 5B0LA 3KRAA 4LPHF 1HM4A 1VG2A 2ONHA 3NF2A 2OPNA 3OACB 2PS5A 1V4HA 3P41A 3KROB 4LLTA 3SDTA 3Q2ZA 3KRCB 5IVGA 1HXAA 1YYUA 3LSNA 5E8KA 3OABA 3KRAB 3G4FA 3CC9A 3V66A 3VJ9A 1N21A 3QKCA 5B0MA 4K10A 5ILDA 4OGUA 5ILJA 4PVXF 1RTRA 5DHIA 5AYPA 4KQ5A 1WL1A 5ERNA 3LDWA 4LZ0A 3WCMA 5E8LA 3Q2QA 3ICNA 3LMDA 3ZMCA 3Q30A 3APZA 3OABB 1YYQA 4OKZA 3ICZA 5DZ2A 5AHUB 3KRFA 2E8WA 4RYPA 4LFEA 5A0JA 3WEFA 5B03A 3NRIA 4GAXA 5JUZF 4E9UA 3VJ8A 2J5CA 5A0IA 1DGPA 5IK6A 2Q9YA 5IKAA 1DI1A 4KQUA 1HXCA 1N22A 3DYHA 4E1EA 3RBMA 1WL2A 4XQSF 4KQSA 2FTZA 2E93A 3RYEA 4OKMA 4KVWA 4EA0A 3RMGA 4F62A 3N3LF 3KRPB 4LTZA 5B0KA 3WCHA 2F8ZF 4GP1A 3DYGA 3WEIA 5DJPF 1HX9A 5IKHA 2E8TA 4LA5A 3PKOA 3EFQA 1YHLA 3M9UA 4N1ZF 5I1UA 4JZXA 1ZW5A 3WEKA 3IBAA 4MC8A 4OMHA 1VG7A 2Z4YA 5DGNF 3ACXA 1YV5A 4HD1A 3LOMA 3VJAA 4KKMA 1WKZA 1V4EA 3LVSA 3N5JF 1YJ4A 3WEHA 3LGZB 3WJOA 3WCFA 1WL0A 1WMWA 5IMIA 3ASXA 3ACYA 2RAHA 3WCJA 2Q9ZA 3WEGA 3N3DA 2QISA 3B7LA 4RXEA 3WJNA 2E94A 4Q23A 5B0IA 3TFPA 1EZFA 5IK0A 3N5HF 1V4JA 1WL3A 2F89F 3P8RA 4JXNA 3VJEA 3ZMBA 3SDQA 3VJDA 3WEJA 4XQTF 5DGSF 3LG5A 3N6KF 4P0XA 4H5CF 4FJQA 4DZWA 3WC9A 4UMJA 1YYRA 1YHMA 3S4JA 4LPGF 1JFGA 3WCBA 3PDEA 4NKFA 5B00A 1V4IA 3CP6A 3NPRA 3AQBB 2O1OA 3WCGA 5EATA 1YQ7A 2ZY1A 2ZEUA 3M0GA 5HN8A 5DIQF 1HXGA 4DEMF 1PS1A 5H9DA 5B0JA 5IMNA 3WCDA 2Z4VA 3WCCA 5CG5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q58 A;  3V1X A;  2J1P A;  5DJV F;  4F6X A;  3WCA A;  3Q1O A;  4LOB A;  5E8H A;  5ILZ A;  2E4O A;  3LLW A;  4LXW A;  1YYT A;  3KRF B;  1N24 A;  4KUX A;  2VF6 A;  3ADZ A;  2EWG A;  2E8U A;  3EGT A;  4LFV F;  4DHD A;  2ZCR A;  3TFN A;  3EZ3 A;  3KB9 A;  3WCI A;  4LZ3 A;  3LJI A;  4EA2 A;  3BNY A;  4P0V A;  5A0K A;  5HN7 A;  5KSX F;  2AEK A;  3V1V A;  1VG3 A;  4MC0 A;  4ZQ8 A;  3PH7 A;  4DWG A;  4XQR F;  4LLS A;  3MAV A;  4MC3 A;  2H8O A;  3TS7 A;  2AZK A;  2ZEV A;  3P5P A;  2E8X A;  2FOR A;  4NFI F;  5ERO A;  3AQC B;  5B02 A;  3WCE A;  3M02 A;  2PS8 A;  3SDU A;  3ID0 A;  4WK5 A;  1RQI A;  5ILH A;  2P1C A;  4GP2 A;  3G4D A;  5IMP A;  5JV2 F;  1HM7 A;  3N0F A;  2OA6 A;  2ZCO A;  2Z4Z A;  4NG6 A;  3LEE A;  2Z52 A;  3KRO A;  4DI5 A;  3UCA A;  3TFV A;  4L2X F;  4RXD A;  1RQJ A;  3N46 F;  2AEL A;  3M01 A;  2J1O A;  2OGD A;  4N9U A;  1UBX A;  5IL3 A;  3N0G A;  3ICK A;  3TC1 A;  3KBK A;  5ERM A;  4KPD A;  3VJB A;  4DXJ A;  2Z50 A;  4F6V A;  1N23 A;  4KWD A;  2E91 A;  2F7M F;  4LTV A;  3WE9 A;  2ZCS A;  5B01 A;  2ONG A;  3LK5 A;  5IM1 A;  5DW7 A;  3ZCD A;  4LA6 A;  1FPS A;  3W7F A;  3WJK A;  3N45 F;  3OYR A;  5CG6 A;  3RYW A;  3MZV A;  3PYA A;  4LIX A;  1JFA A;  3ICM A;  1N1Z A;  2E90 A;  1UBV A;  5ILI A;  4KFA A;  2F94 F;  4H5E F;  4QXS F;  1VG4 A;  3WSA A;  3LGK A;  4GA3 A;  5DGM F;  5IL8 A;  4H5D F;  3IPI A;  4LUU A;  4DWB A;  4RXA A;  2AET A;  3AE0 A;  3SDR A;  5AEL A;  2E92 A;  4JVJ F;  4KVY A;  2PS7 A;  5HN9 A;  5EAS A;  3KRP A;  2ZCQ A;  3ZOU A;  4KK2 A;  4NFJ F;  1KIZ A;  2F9K F;  3N1W F;  3QQV A;  4JXY A;  3WSB A;  5DJR F;  3WCL A;  4RNQ A;  4LFG A;  2Q80 A;  3M00 A;  4NUA A;  3DYF A;  3NPK A;  4LZC A;  3SAE A;  4FP4 A;  3SDV A;  3AQ0 A;  4JZB A;  4P0W A;  5IN8 A;  3N49 F;  4NFK F;  4QPF A;  3ACW A;  3BNX A;  4EA1 A;  2I19 A;  1YHK A;  2PS4 A;  5DHK A;  5EAU A;  4KVI A;  2AZJ A;  5JV1 F;  2Z7I A;  5HNA A;  2E8V A;  2PS6 A;  5JA0 F;  1WY0 A;  5JV0 F;  2OPM A;  3PYB A;  4OMG A;  1V4K A;  4PVY F;  2Z4X A;  4KPJ A;  2F92 F;  1VG6 A;  5C05 A;  2E95 A;  4NKE A;  2AZL A;  4RXC A;  2F8C F;  5ILK A;  2Z78 A;  5ILY A;  1KIY A;  2Z7H A;  2DH4 A;  3ZL6 A;  5IK9 A;  1N1B A;  1UBY A;  2Z4W A;  3OAC A;  3P5R A;  5AFX A;  3S9V A;  3VJC A;  4KVD A;  5ER8 A;  1UBW A;  3P8L A;  3KRC A;  4JYX A;  3CKE A;  1N20 A;  1YYS A;  3LZ9 A;  4E9Z A;  3N1V F;  5B0L A;  3KRA A;  4LPH F;  1HM4 A;  1VG2 A;  2ONH A;  3NF2 A;  2OPN A;  3OAC B;  2PS5 A;  1V4H A;  3P41 A;  3KRO B;  4LLT A;  3SDT A;  3Q2Z A;  3KRC B;  5IVG A;  1HXA A;  1YYU A;  3LSN A;  5E8K A;  3OAB A;  3KRA B;  3G4F A;  3CC9 A;  3V66 A;  3VJ9 A;  1N21 A;  3QKC A;  5B0M A;  4K10 A;  5ILD A;  4OGU A;  5ILJ A;  4PVX F;  1RTR A;  5DHI A;  5AYP A;  4KQ5 A;  1WL1 A;  5ERN A;  3LDW A;  4LZ0 A;  3WCM A;  5E8L A;  3Q2Q A;  3ICN A;  3LMD A;  3ZMC A;  3Q30 A;  3APZ A;  3OAB B;  1YYQ A;  4OKZ A;  3ICZ A;  5DZ2 A;  5AHU B;  3KRF A;  2E8W A;  4RYP A;  4LFE A;  5A0J A;  3WEF A;  5B03 A;  3NRI A;  4GAX A;  5JUZ F;  4E9U A;  3VJ8 A;  2J5C A;  5A0I A;  1DGP A;  5IK6 A;  2Q9Y A;  5IKA A;  1DI1 A;  4KQU A;  1HXC A;  1N22 A;  3DYH A;  4E1E A;  3RBM A;  1WL2 A;  4XQS F;  4KQS A;  2FTZ A;  2E93 A;  3RYE A;  4OKM A;  4KVW A;  4EA0 A;  3RMG A;  4F62 A;  3N3L F;  3KRP B;  4LTZ A;  5B0K A;  3WCH A;  2F8Z F;  4GP1 A;  3DYG A;  3WEI A;  5DJP F;  1HX9 A;  5IKH A;  2E8T A;  4LA5 A;  3PKO A;  3EFQ A;  1YHL A;  3M9U A;  4N1Z F;  5I1U A;  4JZX A;  1ZW5 A;  3WEK A;  3IBA A;  4MC8 A;  4OMH A;  1VG7 A;  2Z4Y A;  5DGN F;  3ACX A;  1YV5 A;  4HD1 A;  3LOM A;  3VJA A;  4KKM A;  1WKZ A;  1V4E A;  3LVS A;  3N5J F;  1YJ4 A;  3WEH A;  3LGZ B;  3WJO A;  3WCF A;  1WL0 A;  1WMW A;  5IMI A;  3ASX A;  3ACY A;  2RAH A;  3WCJ A;  2Q9Z A;  3WEG A;  3N3D A;  2QIS A;  3B7L A;  4RXE A;  3WJN A;  2E94 A;  4Q23 A;  5B0I A;  3TFP A;  1EZF A;  5IK0 A;  3N5H F;  1V4J A;  1WL3 A;  2F89 F;  3P8R A;  4JXN A;  3VJE A;  3ZMB A;  3SDQ A;  3VJD A;  3WEJ A;  4XQT F;  5DGS F;  3LG5 A;  3N6K F;  4P0X A;  4H5C F;  4FJQ A;  4DZW A;  3WC9 A;  4UMJ A;  1YYR A;  1YHM A;  3S4J A;  4LPG F;  1JFG A;  3WCB A;  3PDE A;  4NKF A;  5B00 A;  1V4I A;  3CP6 A;  3NPR A;  3AQB B;  2O1O A;  3WCG A;  5EAT A;  1YQ7 A;  2ZY1 A;  2ZEU A;  3M0G A;  5HN8 A;  5DIQ F;  1HXG A;  4DEM F;  1PS1 A;  5H9D A;  5B0J A;  5IMN A;  3WCD A;  2Z4V A;  3WCC A;  5CG5 A; 
#chains in the Genus database with same CATH topology
 2Q58 A;  3V1X A;  2J1P A;  5DJV F;  4F6X A;  3WCA A;  3Q1O A;  4LOB A;  5E8H A;  5ILZ A;  2E4O A;  3LLW A;  4LXW A;  1YYT A;  3KRF B;  1N24 A;  4KUX A;  2VF6 A;  3ADZ A;  2EWG A;  2E8U A;  3EGT A;  4LFV F;  4DHD A;  2ZCR A;  3TFN A;  3EZ3 A;  3KB9 A;  3WCI A;  4LZ3 A;  3LJI A;  4EA2 A;  3BNY A;  4P0V A;  5A0K A;  5HN7 A;  5KSX F;  2AEK A;  3V1V A;  1VG3 A;  4MC0 A;  4ZQ8 A;  3PH7 A;  4DWG A;  4XQR F;  4LLS A;  3MAV A;  4MC3 A;  2H8O A;  3TS7 A;  2AZK A;  2ZEV A;  3P5P A;  2E8X A;  2FOR A;  4NFI F;  5ERO A;  3AQC B;  5B02 A;  3WCE A;  3M02 A;  2PS8 A;  3SDU A;  3ID0 A;  4WK5 A;  1RQI A;  5ILH A;  2P1C A;  4GP2 A;  3G4D A;  5IMP A;  5JV2 F;  1HM7 A;  3N0F A;  2OA6 A;  2ZCO A;  2Z4Z A;  4NG6 A;  3LEE A;  2Z52 A;  3KRO A;  4DI5 A;  3UCA A;  3TFV A;  4L2X F;  4RXD A;  1RQJ A;  3N46 F;  2AEL A;  3M01 A;  2J1O A;  2OGD A;  4N9U A;  1UBX A;  5IL3 A;  3N0G A;  3ICK A;  3TC1 A;  3KBK A;  5ERM A;  4KPD A;  3VJB A;  4DXJ A;  2Z50 A;  4F6V A;  1N23 A;  4KWD A;  2E91 A;  2F7M F;  4LTV A;  3WE9 A;  2ZCS A;  5B01 A;  2ONG A;  3LK5 A;  5IM1 A;  5DW7 A;  3ZCD A;  4LA6 A;  1FPS A;  3W7F A;  3WJK A;  3N45 F;  3OYR A;  5CG6 A;  3RYW A;  3MZV A;  3PYA A;  4LIX A;  1JFA A;  3ICM A;  1N1Z A;  2E90 A;  1UBV A;  5ILI A;  4KFA A;  2F94 F;  4H5E F;  4QXS F;  1VG4 A;  3WSA A;  3LGK A;  4GA3 A;  5DGM F;  5IL8 A;  4H5D F;  3IPI A;  4LUU A;  4DWB A;  4RXA A;  2AET A;  3AE0 A;  3SDR A;  5AEL A;  2E92 A;  4JVJ F;  4KVY A;  2PS7 A;  5HN9 A;  5EAS A;  3KRP A;  2ZCQ A;  3ZOU A;  4KK2 A;  4NFJ F;  1KIZ A;  2F9K F;  3N1W F;  3QQV A;  4JXY A;  3WSB A;  5DJR F;  3WCL A;  4RNQ A;  4LFG A;  2Q80 A;  3M00 A;  4NUA A;  3DYF A;  3NPK A;  4LZC A;  3SAE A;  4FP4 A;  3SDV A;  3AQ0 A;  4JZB A;  4P0W A;  5IN8 A;  3N49 F;  4NFK F;  4QPF A;  3ACW A;  3BNX A;  4EA1 A;  2I19 A;  1YHK A;  2PS4 A;  5DHK A;  5EAU A;  4KVI A;  2AZJ A;  5JV1 F;  2Z7I A;  5HNA A;  2E8V A;  2PS6 A;  5JA0 F;  1WY0 A;  5JV0 F;  2OPM A;  3PYB A;  4OMG A;  1V4K A;  4PVY F;  2Z4X A;  4KPJ A;  2F92 F;  1VG6 A;  5C05 A;  2E95 A;  4NKE A;  2AZL A;  4RXC A;  2F8C F;  5ILK A;  2Z78 A;  5ILY A;  1KIY A;  2Z7H A;  2DH4 A;  3ZL6 A;  5IK9 A;  1N1B A;  1UBY A;  2Z4W A;  3OAC A;  3P5R A;  5AFX A;  3S9V A;  3VJC A;  4KVD A;  5ER8 A;  1UBW A;  3P8L A;  3KRC A;  4JYX A;  3CKE A;  1N20 A;  1YYS A;  3LZ9 A;  4E9Z A;  3N1V F;  5B0L A;  3KRA A;  4LPH F;  1HM4 A;  1VG2 A;  2ONH A;  3NF2 A;  2OPN A;  3OAC B;  2PS5 A;  1V4H A;  3P41 A;  3KRO B;  4LLT A;  3SDT A;  3Q2Z A;  3KRC B;  5IVG A;  1HXA A;  1YYU A;  3LSN A;  5E8K A;  3OAB A;  3KRA B;  3G4F A;  3CC9 A;  3V66 A;  3VJ9 A;  1N21 A;  3QKC A;  5B0M A;  4K10 A;  5ILD A;  4OGU A;  5ILJ A;  4PVX F;  1RTR A;  5DHI A;  5AYP A;  4KQ5 A;  1WL1 A;  5ERN A;  3LDW A;  4LZ0 A;  3WCM A;  5E8L A;  3Q2Q A;  3ICN A;  3LMD A;  3ZMC A;  3Q30 A;  3APZ A;  3OAB B;  1YYQ A;  4OKZ A;  3ICZ A;  5DZ2 A;  5AHU B;  3KRF A;  2E8W A;  4RYP A;  4LFE A;  5A0J A;  3WEF A;  5B03 A;  3NRI A;  4GAX A;  5JUZ F;  4E9U A;  3VJ8 A;  2J5C A;  5A0I A;  1DGP A;  5IK6 A;  2Q9Y A;  5IKA A;  1DI1 A;  4KQU A;  1HXC A;  1N22 A;  3DYH A;  4E1E A;  3RBM A;  1WL2 A;  4XQS F;  4KQS A;  2FTZ A;  2E93 A;  3RYE A;  4OKM A;  4KVW A;  4EA0 A;  3RMG A;  4F62 A;  3N3L F;  3KRP B;  4LTZ A;  5B0K A;  3WCH A;  2F8Z F;  4GP1 A;  3DYG A;  3WEI A;  5DJP F;  1HX9 A;  5IKH A;  2E8T A;  4LA5 A;  3PKO A;  3EFQ A;  1YHL A;  3M9U A;  4N1Z F;  5I1U A;  4JZX A;  1ZW5 A;  3WEK A;  3IBA A;  4MC8 A;  4OMH A;  1VG7 A;  2Z4Y A;  5DGN F;  3ACX A;  1YV5 A;  4HD1 A;  3LOM A;  3VJA A;  4KKM A;  1WKZ A;  1V4E A;  3LVS A;  3N5J F;  1YJ4 A;  3WEH A;  3LGZ B;  3WJO A;  3WCF A;  1WL0 A;  1WMW A;  5IMI A;  3ASX A;  3ACY A;  2RAH A;  3WCJ A;  2Q9Z A;  3WEG A;  3N3D A;  2QIS A;  3B7L A;  4RXE A;  3WJN A;  2E94 A;  4Q23 A;  5B0I A;  3TFP A;  1EZF A;  5IK0 A;  3N5H F;  1V4J A;  1WL3 A;  2F89 F;  3P8R A;  4JXN A;  3VJE A;  3ZMB A;  3SDQ A;  3VJD A;  3WEJ A;  4XQT F;  5DGS F;  3LG5 A;  3N6K F;  4P0X A;  4H5C F;  4FJQ A;  4DZW A;  3WC9 A;  4UMJ A;  1YYR A;  1YHM A;  3S4J A;  4LPG F;  1JFG A;  3WCB A;  3PDE A;  4NKF A;  5B00 A;  1V4I A;  3CP6 A;  3NPR A;  3AQB B;  2O1O A;  3WCG A;  5EAT A;  1YQ7 A;  2ZY1 A;  2ZEU A;  3M0G A;  5HN8 A;  5DIQ F;  1HXG A;  4DEM F;  1PS1 A;  5H9D A;  5B0J A;  5IMN A;  3WCD A;  2Z4V A;  3WCC A;  5CG5 A; 
#chains in the Genus database with same CATH homology
 2Q58 A;  3V1X A;  2J1P A;  5DJV F;  4F6X A;  3WCA A;  3Q1O A;  4LOB A;  5E8H A;  5ILZ A;  2E4O A;  3LLW A;  4LXW A;  1YYT A;  3KRF B;  1N24 A;  4KUX A;  2VF6 A;  3ADZ A;  2EWG A;  2E8U A;  3EGT A;  4LFV F;  4DHD A;  2ZCR A;  3TFN A;  3EZ3 A;  3KB9 A;  3WCI A;  4LZ3 A;  3LJI A;  4EA2 A;  3BNY A;  4P0V A;  5A0K A;  5HN7 A;  5KSX F;  2AEK A;  3V1V A;  1VG3 A;  4MC0 A;  4ZQ8 A;  3PH7 A;  4DWG A;  4XQR F;  4LLS A;  3MAV A;  4MC3 A;  2H8O A;  3TS7 A;  2AZK A;  2ZEV A;  3P5P A;  2E8X A;  2FOR A;  4NFI F;  5ERO A;  3AQC B;  5B02 A;  3WCE A;  3M02 A;  2PS8 A;  3SDU A;  3ID0 A;  4WK5 A;  1RQI A;  5ILH A;  2P1C A;  4GP2 A;  3G4D A;  5IMP A;  5JV2 F;  1HM7 A;  3N0F A;  2OA6 A;  2ZCO A;  2Z4Z A;  4NG6 A;  3LEE A;  2Z52 A;  3KRO A;  4DI5 A;  3UCA A;  3TFV A;  4L2X F;  4RXD A;  1RQJ A;  3N46 F;  2AEL A;  3M01 A;  2J1O A;  2OGD A;  4N9U A;  1UBX A;  5IL3 A;  3N0G A;  3ICK A;  3TC1 A;  3KBK A;  5ERM A;  4KPD A;  3VJB A;  4DXJ A;  2Z50 A;  4F6V A;  1N23 A;  4KWD A;  2E91 A;  2F7M F;  4LTV A;  3WE9 A;  2ZCS A;  5B01 A;  2ONG A;  3LK5 A;  5IM1 A;  5DW7 A;  3ZCD A;  4LA6 A;  1FPS A;  3W7F A;  3WJK A;  3N45 F;  3OYR A;  5CG6 A;  3RYW A;  3MZV A;  3PYA A;  4LIX A;  1JFA A;  3ICM A;  1N1Z A;  2E90 A;  1UBV A;  5ILI A;  4KFA A;  2F94 F;  4H5E F;  4QXS F;  1VG4 A;  3WSA A;  3LGK A;  4GA3 A;  5DGM F;  5IL8 A;  4H5D F;  3IPI A;  4LUU A;  4DWB A;  4RXA A;  2AET A;  3AE0 A;  3SDR A;  5AEL A;  2E92 A;  4JVJ F;  4KVY A;  2PS7 A;  5HN9 A;  5EAS A;  3KRP A;  2ZCQ A;  3ZOU A;  4KK2 A;  4NFJ F;  1KIZ A;  2F9K F;  3N1W F;  3QQV A;  4JXY A;  3WSB A;  5DJR F;  3WCL A;  4RNQ A;  4LFG A;  2Q80 A;  3M00 A;  4NUA A;  3DYF A;  3NPK A;  4LZC A;  3SAE A;  4FP4 A;  3SDV A;  3AQ0 A;  4JZB A;  4P0W A;  5IN8 A;  3N49 F;  4NFK F;  4QPF A;  3ACW A;  3BNX A;  4EA1 A;  2I19 A;  1YHK A;  2PS4 A;  5DHK A;  5EAU A;  4KVI A;  2AZJ A;  5JV1 F;  2Z7I A;  5HNA A;  2E8V A;  2PS6 A;  5JA0 F;  1WY0 A;  5JV0 F;  2OPM A;  3PYB A;  4OMG A;  1V4K A;  4PVY F;  2Z4X A;  4KPJ A;  2F92 F;  1VG6 A;  5C05 A;  2E95 A;  4NKE A;  2AZL A;  4RXC A;  2F8C F;  5ILK A;  2Z78 A;  5ILY A;  1KIY A;  2Z7H A;  2DH4 A;  3ZL6 A;  5IK9 A;  1N1B A;  1UBY A;  2Z4W A;  3OAC A;  3P5R A;  5AFX A;  3S9V A;  3VJC A;  4KVD A;  5ER8 A;  1UBW A;  3P8L A;  3KRC A;  4JYX A;  3CKE A;  1N20 A;  1YYS A;  3LZ9 A;  4E9Z A;  3N1V F;  5B0L A;  3KRA A;  4LPH F;  1HM4 A;  1VG2 A;  2ONH A;  3NF2 A;  2OPN A;  3OAC B;  2PS5 A;  1V4H A;  3P41 A;  3KRO B;  4LLT A;  3SDT A;  3Q2Z A;  3KRC B;  5IVG A;  1HXA A;  1YYU A;  3LSN A;  5E8K A;  3OAB A;  3KRA B;  3G4F A;  3CC9 A;  3V66 A;  3VJ9 A;  1N21 A;  3QKC A;  5B0M A;  4K10 A;  5ILD A;  4OGU A;  5ILJ A;  4PVX F;  1RTR A;  5DHI A;  5AYP A;  4KQ5 A;  1WL1 A;  5ERN A;  3LDW A;  4LZ0 A;  3WCM A;  5E8L A;  3Q2Q A;  3ICN A;  3LMD A;  3ZMC A;  3Q30 A;  3APZ A;  3OAB B;  1YYQ A;  4OKZ A;  3ICZ A;  5DZ2 A;  5AHU B;  3KRF A;  2E8W A;  4RYP A;  4LFE A;  5A0J A;  3WEF A;  5B03 A;  3NRI A;  4GAX A;  5JUZ F;  4E9U A;  3VJ8 A;  2J5C A;  5A0I A;  1DGP A;  5IK6 A;  2Q9Y A;  5IKA A;  1DI1 A;  4KQU A;  1HXC A;  1N22 A;  3DYH A;  4E1E A;  3RBM A;  1WL2 A;  4XQS F;  4KQS A;  2FTZ A;  2E93 A;  3RYE A;  4OKM A;  4KVW A;  4EA0 A;  3RMG A;  4F62 A;  3N3L F;  3KRP B;  4LTZ A;  5B0K A;  3WCH A;  2F8Z F;  4GP1 A;  3DYG A;  3WEI A;  5DJP F;  1HX9 A;  5IKH A;  2E8T A;  4LA5 A;  3PKO A;  3EFQ A;  1YHL A;  3M9U A;  4N1Z F;  5I1U A;  4JZX A;  1ZW5 A;  3WEK A;  3IBA A;  4MC8 A;  4OMH A;  1VG7 A;  2Z4Y A;  5DGN F;  3ACX A;  1YV5 A;  4HD1 A;  3LOM A;  3VJA A;  4KKM A;  1WKZ A;  1V4E A;  3LVS A;  3N5J F;  1YJ4 A;  3WEH A;  3LGZ B;  3WJO A;  3WCF A;  1WL0 A;  1WMW A;  5IMI A;  3ASX A;  3ACY A;  2RAH A;  3WCJ A;  2Q9Z A;  3WEG A;  3N3D A;  2QIS A;  3B7L A;  4RXE A;  3WJN A;  2E94 A;  4Q23 A;  5B0I A;  3TFP A;  1EZF A;  5IK0 A;  3N5H F;  1V4J A;  1WL3 A;  2F89 F;  3P8R A;  4JXN A;  3VJE A;  3ZMB A;  3SDQ A;  3VJD A;  3WEJ A;  4XQT F;  5DGS F;  3LG5 A;  3N6K F;  4P0X A;  4H5C F;  4FJQ A;  4DZW A;  3WC9 A;  4UMJ A;  1YYR A;  1YHM A;  3S4J A;  4LPG F;  1JFG A;  3WCB A;  3PDE A;  4NKF A;  5B00 A;  1V4I A;  3CP6 A;  3NPR A;  3AQB B;  2O1O A;  3WCG A;  5EAT A;  1YQ7 A;  2ZY1 A;  2ZEU A;  3M0G A;  5HN8 A;  5DIQ F;  1HXG A;  4DEM F;  1PS1 A;  5H9D A;  5B0J A;  5IMN A;  3WCD A;  2Z4V A;  3WCC A;  5CG5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...