3PH7A

Crystal structure of plasmodium vivax putative polyprenyl pyrophosphate synthase in complex with geranylgeranyl diphosphate
Total Genus 134
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
134
sequence length
360
structure length
347
Chain Sequence
AFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKNRDINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSDEIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIAVDNLIYKKIEDISMLMGEYFQIHDDYLDIFSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Farnesyl pyrophosphate synthase
publication title Molecular characterization of a novel geranylgeranyl pyrophosphate synthase from Plasmodium parasites.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 134
structure length 347
sequence length 360
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-11-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3ph7A00
3PYAA 1WL0A 1JFGA 3WE9A 3ICKA 5I1UA 2ZEUA 3CP6A 4E1EA 5B0LA 4NKFA 3WSBA 3LSNA 2P1CA 4DWGA 1RTRA 5AELA 5IM1A 4QPFA 4DXJA 2E90A 3P5RA 2Z50A 3WEGA 3KRPA 3TFNA 4KVWA 3ACYA 5EAUA 5H9DA 2E8XA 1UBVA 4F6XA 2F89F 3WEFA 3BNYA 3LVSA 4LTZA 3N1VF 2Q80A 5ILKA 1N22A 1VG2A 2Q9ZA 3ASXA 3Q1OA 4NKEA 5IMIA 1DI1A 3WCIA 4PVXF 3VJCA 3EGTA 1YYQA 3DYGA 3LK5A 3KRFB 5DJVF 2E8TA 3OYRA 1YHMA 5DGMF 2F8CF 3SDTA 1WY0A 3ICZA 5HNAA 1WL2A 3TC1A 4KPJA 3KB9A 4F6VA 5ER8A 3N46F 4DHDA 3VJ8A 3M01A 3Q2QA 4LPHF 3CKEA 5DJPF 5A0JA 2Q58A 4LA6A 1JFAA 3SDQA 1N23A 2I19A 4LPGF 3G4FA 3WEJA 4KVIA 4LA5A 3WCHA 2J1OA 2DH4A 4FJQA 4K10A 3WCAA 3OABA 2PS8A 4P0VA 3ZMCA 5IKHA 4KWDA 3N5JF 3PDEA 3LGKA 3TFPA 1YYSA 5EASA 4UMJA 5DW7A 4LLSA 5JV1F 3WCDA 2ZCRA 3B7LA 4JYXA 1WL3A 3SDUA 4LUUA 4DEMF 3WC9A 2PS6A 3M0GA 5ILHA 3WCMA 3N0GA 5CG5A 4P0WA 5KSXF 4KQUA 2F94F 3P8RA 4GP2A 1FPSA 2Z7HA 3V1XA 3IPIA 3TFVA 3N3LF 5DGSF 3VJBA 5A0IA 4NFJF 2E95A 3ICNA 2Z4XA 1YYUA 1HM7A 4LIXA 4GAXA 3QQVA 3BNXA 2Z4YA 4L2XF 3SDRA 2F92F 3P41A 2ONHA 3LMDA 4LZCA 4KK2A 3RMGA 4NG6A 1V4KA 3P8LA 4KVDA 1V4IA 3WCCA 1WMWA 2OPMA 5HN7A 3V1VA 5AFXA 2J5CA 4KPDA 4RXDA 5A0KA 3Q30A 4QXSF 3PKOA 1YYRA 3AQCB 2AZJA 1YQ7A 4Q23A 5EATA 3NRIA 5EROA 3OABB 1HM4A 4DZWA 2Z7IA 3AQ0A 5ILZA 2F9KF 2OPNA 4JZXA 5B0JA 4JZBA 1V4HA 2E8VA 3ZL6A 4LZ0A 2E8WA 2PS5A 1HXGA 4N9UA 5E8LA 4KVYA 3V66A 4OKMA 5DJRF 4OMHA 2J1PA 5IL8A 5B0MA 1VG4A 1UBWA 5ERNA 5JV2F 5JV0F 3W7FA 4LFGA 5AYPA 3ID0A 1KIZA 3ZOUA 4JXYA 4XQTF 3RYEA 3AQBB 4MC0A 4MC8A 5B03A 4PVYF 4E9UA 4KQSA 2ZCQA 5IN8A 4NFKF 5ILYA 1YHKA 4NUAA 5DHIA 3AE0A 1N1BA 1YJ4A 3NPRA 3CC9A 2AELA 3N45F 4DWBA 3SDVA 5IK0A 2ONGA 3WJKA 5IMPA 4JXNA 4RXEA 4LZ3A 5IVGA 3KRPB 2F8ZF 5ILJA 1V4EA 3DYHA 2RAHA 3ACWA 3EFQA 3OACA 3APZA 5IKAA 5DHKA 3S4JA 3G4DA 4F62A 3WSAA 2ZCSA 4FP4A 3LLWA 4DI5A 3WEKA 4ZQ8A 5ILIA 2O1OA 4JVJF 4OMGA 3LJIA 3KRFA 3LEEA 5IMNA 3ZMBA 2VF6A 3WCGA 4HD1A 3IBAA 3UCAA 1YHLA 1VG3A 2PS7A 2ZEVA 3LG5A 3KROA 3ACXA 2E8UA 2Z78A 3KRCA 5B01A 5IL3A 3MAVA 5B0KA 4EA1A 2QISA 5C05A 4LFEA 3N5HF 3P5PA 5E8HA 4H5EF 1UBYA 1V4JA 3LDWA 3M02A 3QKCA 3KRAA 3WJNA 5ILDA 4H5DF 3LZ9A 3TS7A 4LXWA 1HXAA 5B02A 2E93A 4H5CF 5B0IA 4P0XA 1HX9A 5E8KA 3Q2ZA 3RBMA 1N24A 3ZCDA 4XQRF 3MZVA 4XQSF 5HN9A 5B00A 1PS1A 4LFVF 3ADZA 3N1WF 3N6KF 3NPKA 3WCEA 3VJAA 3PH7A 2AETA 3OACB 4N1ZF 2OA6A 3NF2A 3RYWA 2ZCOA 3ICMA 2FTZA 1VG6A 2Q9YA 4GA3A 3PYBA 3SAEA 3KBKA 3VJDA 1ZW5A 4RXCA 3N3DA 3WJOA 3WCBA 2Z4WA 4KUXA 4RYPA 5JUZF 1HXCA 5CG6A 4OKZA 1N21A 1N20A 1RQIA 1N1ZA 2Z52A 5HN8A 3VJEA 1EZFA 5AHUB 5ERMA 5IK6A 2ZY1A 1WKZA 5IK9A 3N0FA 1VG7A 1DGPA 3KROB 2OGDA 3VJ9A 4KKMA 3LOMA 4MC3A 2Z4ZA 3KRCB 3LGZB 5JA0F 2E4OA 4LLTA 3EZ3A 2AEKA 4E9ZA 2H8OA 3WEHA 1UBXA 4WK5A 4OGUA 1YYTA 4LTVA 3M00A 3M9UA 3KRAB 4KQ5A 4NFIF 4EA0A 4RNQA 5DIQF 3N49F 2E94A 4RXAA 3WEIA 3WCJA 1RQJA 1KIYA 4KFAA 2F7MF 3WCFA 1YV5A 4LOBA 3WCLA 2E91A 2E92A 2EWGA 2AZLA 1WL1A 2FORA 3DYFA 2PS4A 3S9VA 2AZKA 5DGNF 2Z4VA 5DZ2A 4GP1A 4EA2A
chains in the Genus database with same CATH superfamily
3PYAA 1WL0A 1JFGA 3WE9A 3ICKA 5I1UA 2ZEUA 3CP6A 4E1EA 5B0LA 4NKFA 3WSBA 3LSNA 2P1CA 4DWGA 1RTRA 5AELA 5IM1A 4QPFA 4DXJA 2E90A 3P5RA 2Z50A 3WEGA 3KRPA 3TFNA 4KVWA 3ACYA 5EAUA 5H9DA 2E8XA 1UBVA 4F6XA 2F89F 3WEFA 3BNYA 3LVSA 4LTZA 3N1VF 2Q80A 5ILKA 1N22A 1VG2A 2Q9ZA 3ASXA 3Q1OA 4NKEA 5IMIA 1DI1A 3WCIA 4PVXF 3VJCA 3EGTA 1YYQA 3DYGA 3LK5A 3KRFB 5DJVF 2E8TA 3OYRA 1YHMA 5DGMF 2F8CF 3SDTA 1WY0A 3ICZA 5HNAA 1WL2A 3TC1A 4KPJA 3KB9A 4F6VA 5ER8A 3N46F 4DHDA 3VJ8A 3M01A 3Q2QA 4LPHF 3CKEA 5DJPF 5A0JA 2Q58A 4LA6A 1JFAA 3SDQA 1N23A 2I19A 4LPGF 3G4FA 3WEJA 4KVIA 4LA5A 3WCHA 2J1OA 2DH4A 4FJQA 4K10A 3WCAA 3OABA 2PS8A 4P0VA 3ZMCA 5IKHA 4KWDA 3N5JF 3PDEA 3LGKA 3TFPA 1YYSA 5EASA 4UMJA 5DW7A 4LLSA 5JV1F 3WCDA 2ZCRA 3B7LA 4JYXA 1WL3A 3SDUA 4LUUA 4DEMF 3WC9A 2PS6A 3M0GA 5ILHA 3WCMA 3N0GA 5CG5A 4P0WA 5KSXF 4KQUA 2F94F 3P8RA 4GP2A 1FPSA 2Z7HA 3V1XA 3IPIA 3TFVA 3N3LF 5DGSF 3VJBA 5A0IA 4NFJF 2E95A 3ICNA 2Z4XA 1YYUA 1HM7A 4LIXA 4GAXA 3QQVA 3BNXA 2Z4YA 4L2XF 3SDRA 2F92F 3P41A 2ONHA 3LMDA 4LZCA 4KK2A 3RMGA 4NG6A 1V4KA 3P8LA 4KVDA 1V4IA 3WCCA 1WMWA 2OPMA 5HN7A 3V1VA 5AFXA 2J5CA 4KPDA 4RXDA 5A0KA 3Q30A 4QXSF 3PKOA 1YYRA 3AQCB 2AZJA 1YQ7A 4Q23A 5EATA 3NRIA 5EROA 3OABB 1HM4A 4DZWA 2Z7IA 3AQ0A 5ILZA 2F9KF 2OPNA 4JZXA 5B0JA 4JZBA 1V4HA 2E8VA 3ZL6A 4LZ0A 2E8WA 2PS5A 1HXGA 4N9UA 5E8LA 4KVYA 3V66A 4OKMA 5DJRF 4OMHA 2J1PA 5IL8A 5B0MA 1VG4A 1UBWA 5ERNA 5JV2F 5JV0F 3W7FA 4LFGA 5AYPA 3ID0A 1KIZA 3ZOUA 4JXYA 4XQTF 3RYEA 3AQBB 4MC0A 4MC8A 5B03A 4PVYF 4E9UA 4KQSA 2ZCQA 5IN8A 4NFKF 5ILYA 1YHKA 4NUAA 5DHIA 3AE0A 1N1BA 1YJ4A 3NPRA 3CC9A 2AELA 3N45F 4DWBA 3SDVA 5IK0A 2ONGA 3WJKA 5IMPA 4JXNA 4RXEA 4LZ3A 5IVGA 3KRPB 2F8ZF 5ILJA 1V4EA 3DYHA 2RAHA 3ACWA 3EFQA 3OACA 3APZA 5IKAA 5DHKA 3S4JA 3G4DA 4F62A 3WSAA 2ZCSA 4FP4A 3LLWA 4DI5A 3WEKA 4ZQ8A 5ILIA 2O1OA 4JVJF 4OMGA 3LJIA 3KRFA 3LEEA 5IMNA 3ZMBA 2VF6A 3WCGA 4HD1A 3IBAA 3UCAA 1YHLA 1VG3A 2PS7A 2ZEVA 3LG5A 3KROA 3ACXA 2E8UA 2Z78A 3KRCA 5B01A 5IL3A 3MAVA 5B0KA 4EA1A 2QISA 5C05A 4LFEA 3N5HF 3P5PA 5E8HA 4H5EF 1UBYA 1V4JA 3LDWA 3M02A 3QKCA 3KRAA 3WJNA 5ILDA 4H5DF 3LZ9A 3TS7A 4LXWA 1HXAA 5B02A 2E93A 4H5CF 5B0IA 4P0XA 1HX9A 5E8KA 3Q2ZA 3RBMA 1N24A 3ZCDA 4XQRF 3MZVA 4XQSF 5HN9A 5B00A 1PS1A 4LFVF 3ADZA 3N1WF 3N6KF 3NPKA 3WCEA 3VJAA 3PH7A 2AETA 3OACB 4N1ZF 2OA6A 3NF2A 3RYWA 2ZCOA 3ICMA 2FTZA 1VG6A 2Q9YA 4GA3A 3PYBA 3SAEA 3KBKA 3VJDA 1ZW5A 4RXCA 3N3DA 3WJOA 3WCBA 2Z4WA 4KUXA 4RYPA 5JUZF 1HXCA 5CG6A 4OKZA 1N21A 1N20A 1RQIA 1N1ZA 2Z52A 5HN8A 3VJEA 1EZFA 5AHUB 5ERMA 5IK6A 2ZY1A 1WKZA 5IK9A 3N0FA 1VG7A 1DGPA 3KROB 2OGDA 3VJ9A 4KKMA 3LOMA 4MC3A 2Z4ZA 3KRCB 3LGZB 5JA0F 2E4OA 4LLTA 3EZ3A 2AEKA 4E9ZA 2H8OA 3WEHA 1UBXA 4WK5A 4OGUA 1YYTA 4LTVA 3M00A 3M9UA 3KRAB 4KQ5A 4NFIF 4EA0A 4RNQA 5DIQF 3N49F 2E94A 4RXAA 3WEIA 3WCJA 1RQJA 1KIYA 4KFAA 2F7MF 3WCFA 1YV5A 4LOBA 3WCLA 2E91A 2E92A 2EWGA 2AZLA 1WL1A 2FORA 3DYFA 2PS4A 3S9VA 2AZKA 5DGNF 2Z4VA 5DZ2A 4GP1A 4EA2A
chains in the Genus database with same CATH topology
3PYAA 1WL0A 1JFGA 3WE9A 3ICKA 5I1UA 2ZEUA 3CP6A 4E1EA 5B0LA 4NKFA 3WSBA 3LSNA 2P1CA 4DWGA 1RTRA 5AELA 5IM1A 4QPFA 4DXJA 2E90A 3P5RA 2Z50A 3WEGA 3KRPA 3TFNA 4KVWA 3ACYA 5EAUA 5H9DA 2E8XA 1UBVA 4F6XA 2F89F 3WEFA 3BNYA 3LVSA 4LTZA 3N1VF 2Q80A 5ILKA 1N22A 1VG2A 2Q9ZA 3ASXA 3Q1OA 4NKEA 5IMIA 1DI1A 3WCIA 4PVXF 3VJCA 3EGTA 1YYQA 3DYGA 3LK5A 3KRFB 5DJVF 2E8TA 3OYRA 1YHMA 5DGMF 2F8CF 3SDTA 1WY0A 3ICZA 5HNAA 1WL2A 3TC1A 4KPJA 3KB9A 4F6VA 5ER8A 3N46F 4DHDA 3VJ8A 3M01A 3Q2QA 4LPHF 3CKEA 5DJPF 5A0JA 2Q58A 4LA6A 1JFAA 3SDQA 1N23A 2I19A 4LPGF 3G4FA 3WEJA 4KVIA 4LA5A 3WCHA 2J1OA 2DH4A 4FJQA 4K10A 3WCAA 3OABA 2PS8A 4P0VA 3ZMCA 5IKHA 4KWDA 3N5JF 3PDEA 3LGKA 3TFPA 1YYSA 5EASA 4UMJA 5DW7A 4LLSA 5JV1F 3WCDA 2ZCRA 3B7LA 4JYXA 1WL3A 3SDUA 4LUUA 4DEMF 3WC9A 2PS6A 3M0GA 5ILHA 3WCMA 3N0GA 5CG5A 4P0WA 5KSXF 4KQUA 2F94F 3P8RA 4GP2A 1FPSA 2Z7HA 3V1XA 3IPIA 3TFVA 3N3LF 5DGSF 3VJBA 5A0IA 4NFJF 2E95A 3ICNA 2Z4XA 1YYUA 1HM7A 4LIXA 4GAXA 3QQVA 3BNXA 2Z4YA 4L2XF 3SDRA 2F92F 3P41A 2ONHA 3LMDA 4LZCA 4KK2A 3RMGA 4NG6A 1V4KA 3P8LA 4KVDA 1V4IA 3WCCA 1WMWA 2OPMA 5HN7A 3V1VA 5AFXA 2J5CA 4KPDA 4RXDA 5A0KA 3Q30A 4QXSF 3PKOA 1YYRA 3AQCB 2AZJA 1YQ7A 4Q23A 5EATA 3NRIA 5EROA 3OABB 1HM4A 4DZWA 2Z7IA 3AQ0A 5ILZA 2F9KF 2OPNA 4JZXA 5B0JA 4JZBA 1V4HA 2E8VA 3ZL6A 4LZ0A 2E8WA 2PS5A 1HXGA 4N9UA 5E8LA 4KVYA 3V66A 4OKMA 5DJRF 4OMHA 2J1PA 5IL8A 5B0MA 1VG4A 1UBWA 5ERNA 5JV2F 5JV0F 3W7FA 4LFGA 5AYPA 3ID0A 1KIZA 3ZOUA 4JXYA 4XQTF 3RYEA 3AQBB 4MC0A 4MC8A 5B03A 4PVYF 4E9UA 4KQSA 2ZCQA 5IN8A 4NFKF 5ILYA 1YHKA 4NUAA 5DHIA 3AE0A 1N1BA 1YJ4A 3NPRA 3CC9A 2AELA 3N45F 4DWBA 3SDVA 5IK0A 2ONGA 3WJKA 5IMPA 4JXNA 4RXEA 4LZ3A 5IVGA 3KRPB 2F8ZF 5ILJA 1V4EA 3DYHA 2RAHA 3ACWA 3EFQA 3OACA 3APZA 5IKAA 5DHKA 3S4JA 3G4DA 4F62A 3WSAA 2ZCSA 4FP4A 3LLWA 4DI5A 3WEKA 4ZQ8A 5ILIA 2O1OA 4JVJF 4OMGA 3LJIA 3KRFA 3LEEA 5IMNA 3ZMBA 2VF6A 3WCGA 4HD1A 3IBAA 3UCAA 1YHLA 1VG3A 2PS7A 2ZEVA 3LG5A 3KROA 3ACXA 2E8UA 2Z78A 3KRCA 5B01A 5IL3A 3MAVA 5B0KA 4EA1A 2QISA 5C05A 4LFEA 3N5HF 3P5PA 5E8HA 4H5EF 1UBYA 1V4JA 3LDWA 3M02A 3QKCA 3KRAA 3WJNA 5ILDA 4H5DF 3LZ9A 3TS7A 4LXWA 1HXAA 5B02A 2E93A 4H5CF 5B0IA 4P0XA 1HX9A 5E8KA 3Q2ZA 3RBMA 1N24A 3ZCDA 4XQRF 3MZVA 4XQSF 5HN9A 5B00A 1PS1A 4LFVF 3ADZA 3N1WF 3N6KF 3NPKA 3WCEA 3VJAA 3PH7A 2AETA 3OACB 4N1ZF 2OA6A 3NF2A 3RYWA 2ZCOA 3ICMA 2FTZA 1VG6A 2Q9YA 4GA3A 3PYBA 3SAEA 3KBKA 3VJDA 1ZW5A 4RXCA 3N3DA 3WJOA 3WCBA 2Z4WA 4KUXA 4RYPA 5JUZF 1HXCA 5CG6A 4OKZA 1N21A 1N20A 1RQIA 1N1ZA 2Z52A 5HN8A 3VJEA 1EZFA 5AHUB 5ERMA 5IK6A 2ZY1A 1WKZA 5IK9A 3N0FA 1VG7A 1DGPA 3KROB 2OGDA 3VJ9A 4KKMA 3LOMA 4MC3A 2Z4ZA 3KRCB 3LGZB 5JA0F 2E4OA 4LLTA 3EZ3A 2AEKA 4E9ZA 2H8OA 3WEHA 1UBXA 4WK5A 4OGUA 1YYTA 4LTVA 3M00A 3M9UA 3KRAB 4KQ5A 4NFIF 4EA0A 4RNQA 5DIQF 3N49F 2E94A 4RXAA 3WEIA 3WCJA 1RQJA 1KIYA 4KFAA 2F7MF 3WCFA 1YV5A 4LOBA 3WCLA 2E91A 2E92A 2EWGA 2AZLA 1WL1A 2FORA 3DYFA 2PS4A 3S9VA 2AZKA 5DGNF 2Z4VA 5DZ2A 4GP1A 4EA2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PYA A;  1WL0 A;  1JFG A;  3WE9 A;  3ICK A;  5I1U A;  2ZEU A;  3CP6 A;  4E1E A;  5B0L A;  4NKF A;  3WSB A;  3LSN A;  2P1C A;  4DWG A;  1RTR A;  5AEL A;  5IM1 A;  4QPF A;  4DXJ A;  2E90 A;  3P5R A;  2Z50 A;  3WEG A;  3KRP A;  3TFN A;  4KVW A;  3ACY A;  5EAU A;  5H9D A;  2E8X A;  1UBV A;  4F6X A;  2F89 F;  3WEF A;  3BNY A;  3LVS A;  4LTZ A;  3N1V F;  2Q80 A;  5ILK A;  1N22 A;  1VG2 A;  2Q9Z A;  3ASX A;  3Q1O A;  4NKE A;  5IMI A;  1DI1 A;  3WCI A;  4PVX F;  3VJC A;  3EGT A;  1YYQ A;  3DYG A;  3LK5 A;  3KRF B;  5DJV F;  2E8T A;  3OYR A;  1YHM A;  5DGM F;  2F8C F;  3SDT A;  1WY0 A;  3ICZ A;  5HNA A;  1WL2 A;  3TC1 A;  4KPJ A;  3KB9 A;  4F6V A;  5ER8 A;  3N46 F;  4DHD A;  3VJ8 A;  3M01 A;  3Q2Q A;  4LPH F;  3CKE A;  5DJP F;  5A0J A;  2Q58 A;  4LA6 A;  1JFA A;  3SDQ A;  1N23 A;  2I19 A;  4LPG F;  3G4F A;  3WEJ A;  4KVI A;  4LA5 A;  3WCH A;  2J1O A;  2DH4 A;  4FJQ A;  4K10 A;  3WCA A;  3OAB A;  2PS8 A;  4P0V A;  3ZMC A;  5IKH A;  4KWD A;  3N5J F;  3PDE A;  3LGK A;  3TFP A;  1YYS A;  5EAS A;  4UMJ A;  5DW7 A;  4LLS A;  5JV1 F;  3WCD A;  2ZCR A;  3B7L A;  4JYX A;  1WL3 A;  3SDU A;  4LUU A;  4DEM F;  3WC9 A;  2PS6 A;  3M0G A;  5ILH A;  3WCM A;  3N0G A;  5CG5 A;  4P0W A;  5KSX F;  4KQU A;  2F94 F;  3P8R A;  4GP2 A;  1FPS A;  2Z7H A;  3V1X A;  3IPI A;  3TFV A;  3N3L F;  5DGS F;  3VJB A;  5A0I A;  4NFJ F;  2E95 A;  3ICN A;  2Z4X A;  1YYU A;  1HM7 A;  4LIX A;  4GAX A;  3QQV A;  3BNX A;  2Z4Y A;  4L2X F;  3SDR A;  2F92 F;  3P41 A;  2ONH A;  3LMD A;  4LZC A;  4KK2 A;  3RMG A;  4NG6 A;  1V4K A;  3P8L A;  4KVD A;  1V4I A;  3WCC A;  1WMW A;  2OPM A;  5HN7 A;  3V1V A;  5AFX A;  2J5C A;  4KPD A;  4RXD A;  5A0K A;  3Q30 A;  4QXS F;  3PKO A;  1YYR A;  3AQC B;  2AZJ A;  1YQ7 A;  4Q23 A;  5EAT A;  3NRI A;  5ERO A;  3OAB B;  1HM4 A;  4DZW A;  2Z7I A;  3AQ0 A;  5ILZ A;  2F9K F;  2OPN A;  4JZX A;  5B0J A;  4JZB A;  1V4H A;  2E8V A;  3ZL6 A;  4LZ0 A;  2E8W A;  2PS5 A;  1HXG A;  4N9U A;  5E8L A;  4KVY A;  3V66 A;  4OKM A;  5DJR F;  4OMH A;  2J1P A;  5IL8 A;  5B0M A;  1VG4 A;  1UBW A;  5ERN A;  5JV2 F;  5JV0 F;  3W7F A;  4LFG A;  5AYP A;  3ID0 A;  1KIZ A;  3ZOU A;  4JXY A;  4XQT F;  3RYE A;  3AQB B;  4MC0 A;  4MC8 A;  5B03 A;  4PVY F;  4E9U A;  4KQS A;  2ZCQ A;  5IN8 A;  4NFK F;  5ILY A;  1YHK A;  4NUA A;  5DHI A;  3AE0 A;  1N1B A;  1YJ4 A;  3NPR A;  3CC9 A;  2AEL A;  3N45 F;  4DWB A;  3SDV A;  5IK0 A;  2ONG A;  3WJK A;  5IMP A;  4JXN A;  4RXE A;  4LZ3 A;  5IVG A;  3KRP B;  2F8Z F;  5ILJ A;  1V4E A;  3DYH A;  2RAH A;  3ACW A;  3EFQ A;  3OAC A;  3APZ A;  5IKA A;  5DHK A;  3S4J A;  3G4D A;  4F62 A;  3WSA A;  2ZCS A;  4FP4 A;  3LLW A;  4DI5 A;  3WEK A;  4ZQ8 A;  5ILI A;  2O1O A;  4JVJ F;  4OMG A;  3LJI A;  3KRF A;  3LEE A;  5IMN A;  3ZMB A;  2VF6 A;  3WCG A;  4HD1 A;  3IBA A;  3UCA A;  1YHL A;  1VG3 A;  2PS7 A;  2ZEV A;  3LG5 A;  3KRO A;  3ACX A;  2E8U A;  2Z78 A;  3KRC A;  5B01 A;  5IL3 A;  3MAV A;  5B0K A;  4EA1 A;  2QIS A;  5C05 A;  4LFE A;  3N5H F;  3P5P A;  5E8H A;  4H5E F;  1UBY A;  1V4J A;  3LDW A;  3M02 A;  3QKC A;  3KRA A;  3WJN A;  5ILD A;  4H5D F;  3LZ9 A;  3TS7 A;  4LXW A;  1HXA A;  5B02 A;  2E93 A;  4H5C F;  5B0I A;  4P0X A;  1HX9 A;  5E8K A;  3Q2Z A;  3RBM A;  1N24 A;  3ZCD A;  4XQR F;  3MZV A;  4XQS F;  5HN9 A;  5B00 A;  1PS1 A;  4LFV F;  3ADZ A;  3N1W F;  3N6K F;  3NPK A;  3WCE A;  3VJA A;  3PH7 A;  2AET A;  3OAC B;  4N1Z F;  2OA6 A;  3NF2 A;  3RYW A;  2ZCO A;  3ICM A;  2FTZ A;  1VG6 A;  2Q9Y A;  4GA3 A;  3PYB A;  3SAE A;  3KBK A;  3VJD A;  1ZW5 A;  4RXC A;  3N3D A;  3WJO A;  3WCB A;  2Z4W A;  4KUX A;  4RYP A;  5JUZ F;  1HXC A;  5CG6 A;  4OKZ A;  1N21 A;  1N20 A;  1RQI A;  1N1Z A;  2Z52 A;  5HN8 A;  3VJE A;  1EZF A;  5AHU B;  5ERM A;  5IK6 A;  2ZY1 A;  1WKZ A;  5IK9 A;  3N0F A;  1VG7 A;  1DGP A;  3KRO B;  2OGD A;  3VJ9 A;  4KKM A;  3LOM A;  4MC3 A;  2Z4Z A;  3KRC B;  3LGZ B;  5JA0 F;  2E4O A;  4LLT A;  3EZ3 A;  2AEK A;  4E9Z A;  2H8O A;  3WEH A;  1UBX A;  4WK5 A;  4OGU A;  1YYT A;  4LTV A;  3M00 A;  3M9U A;  3KRA B;  4KQ5 A;  4NFI F;  4EA0 A;  4RNQ A;  5DIQ F;  3N49 F;  2E94 A;  4RXA A;  3WEI A;  3WCJ A;  1RQJ A;  1KIY A;  4KFA A;  2F7M F;  3WCF A;  1YV5 A;  4LOB A;  3WCL A;  2E91 A;  2E92 A;  2EWG A;  2AZL A;  1WL1 A;  2FOR A;  3DYF A;  2PS4 A;  3S9V A;  2AZK A;  5DGN F;  2Z4V A;  5DZ2 A;  4GP1 A;  4EA2 A; 
#chains in the Genus database with same CATH topology
 3PYA A;  1WL0 A;  1JFG A;  3WE9 A;  3ICK A;  5I1U A;  2ZEU A;  3CP6 A;  4E1E A;  5B0L A;  4NKF A;  3WSB A;  3LSN A;  2P1C A;  4DWG A;  1RTR A;  5AEL A;  5IM1 A;  4QPF A;  4DXJ A;  2E90 A;  3P5R A;  2Z50 A;  3WEG A;  3KRP A;  3TFN A;  4KVW A;  3ACY A;  5EAU A;  5H9D A;  2E8X A;  1UBV A;  4F6X A;  2F89 F;  3WEF A;  3BNY A;  3LVS A;  4LTZ A;  3N1V F;  2Q80 A;  5ILK A;  1N22 A;  1VG2 A;  2Q9Z A;  3ASX A;  3Q1O A;  4NKE A;  5IMI A;  1DI1 A;  3WCI A;  4PVX F;  3VJC A;  3EGT A;  1YYQ A;  3DYG A;  3LK5 A;  3KRF B;  5DJV F;  2E8T A;  3OYR A;  1YHM A;  5DGM F;  2F8C F;  3SDT A;  1WY0 A;  3ICZ A;  5HNA A;  1WL2 A;  3TC1 A;  4KPJ A;  3KB9 A;  4F6V A;  5ER8 A;  3N46 F;  4DHD A;  3VJ8 A;  3M01 A;  3Q2Q A;  4LPH F;  3CKE A;  5DJP F;  5A0J A;  2Q58 A;  4LA6 A;  1JFA A;  3SDQ A;  1N23 A;  2I19 A;  4LPG F;  3G4F A;  3WEJ A;  4KVI A;  4LA5 A;  3WCH A;  2J1O A;  2DH4 A;  4FJQ A;  4K10 A;  3WCA A;  3OAB A;  2PS8 A;  4P0V A;  3ZMC A;  5IKH A;  4KWD A;  3N5J F;  3PDE A;  3LGK A;  3TFP A;  1YYS A;  5EAS A;  4UMJ A;  5DW7 A;  4LLS A;  5JV1 F;  3WCD A;  2ZCR A;  3B7L A;  4JYX A;  1WL3 A;  3SDU A;  4LUU A;  4DEM F;  3WC9 A;  2PS6 A;  3M0G A;  5ILH A;  3WCM A;  3N0G A;  5CG5 A;  4P0W A;  5KSX F;  4KQU A;  2F94 F;  3P8R A;  4GP2 A;  1FPS A;  2Z7H A;  3V1X A;  3IPI A;  3TFV A;  3N3L F;  5DGS F;  3VJB A;  5A0I A;  4NFJ F;  2E95 A;  3ICN A;  2Z4X A;  1YYU A;  1HM7 A;  4LIX A;  4GAX A;  3QQV A;  3BNX A;  2Z4Y A;  4L2X F;  3SDR A;  2F92 F;  3P41 A;  2ONH A;  3LMD A;  4LZC A;  4KK2 A;  3RMG A;  4NG6 A;  1V4K A;  3P8L A;  4KVD A;  1V4I A;  3WCC A;  1WMW A;  2OPM A;  5HN7 A;  3V1V A;  5AFX A;  2J5C A;  4KPD A;  4RXD A;  5A0K A;  3Q30 A;  4QXS F;  3PKO A;  1YYR A;  3AQC B;  2AZJ A;  1YQ7 A;  4Q23 A;  5EAT A;  3NRI A;  5ERO A;  3OAB B;  1HM4 A;  4DZW A;  2Z7I A;  3AQ0 A;  5ILZ A;  2F9K F;  2OPN A;  4JZX A;  5B0J A;  4JZB A;  1V4H A;  2E8V A;  3ZL6 A;  4LZ0 A;  2E8W A;  2PS5 A;  1HXG A;  4N9U A;  5E8L A;  4KVY A;  3V66 A;  4OKM A;  5DJR F;  4OMH A;  2J1P A;  5IL8 A;  5B0M A;  1VG4 A;  1UBW A;  5ERN A;  5JV2 F;  5JV0 F;  3W7F A;  4LFG A;  5AYP A;  3ID0 A;  1KIZ A;  3ZOU A;  4JXY A;  4XQT F;  3RYE A;  3AQB B;  4MC0 A;  4MC8 A;  5B03 A;  4PVY F;  4E9U A;  4KQS A;  2ZCQ A;  5IN8 A;  4NFK F;  5ILY A;  1YHK A;  4NUA A;  5DHI A;  3AE0 A;  1N1B A;  1YJ4 A;  3NPR A;  3CC9 A;  2AEL A;  3N45 F;  4DWB A;  3SDV A;  5IK0 A;  2ONG A;  3WJK A;  5IMP A;  4JXN A;  4RXE A;  4LZ3 A;  5IVG A;  3KRP B;  2F8Z F;  5ILJ A;  1V4E A;  3DYH A;  2RAH A;  3ACW A;  3EFQ A;  3OAC A;  3APZ A;  5IKA A;  5DHK A;  3S4J A;  3G4D A;  4F62 A;  3WSA A;  2ZCS A;  4FP4 A;  3LLW A;  4DI5 A;  3WEK A;  4ZQ8 A;  5ILI A;  2O1O A;  4JVJ F;  4OMG A;  3LJI A;  3KRF A;  3LEE A;  5IMN A;  3ZMB A;  2VF6 A;  3WCG A;  4HD1 A;  3IBA A;  3UCA A;  1YHL A;  1VG3 A;  2PS7 A;  2ZEV A;  3LG5 A;  3KRO A;  3ACX A;  2E8U A;  2Z78 A;  3KRC A;  5B01 A;  5IL3 A;  3MAV A;  5B0K A;  4EA1 A;  2QIS A;  5C05 A;  4LFE A;  3N5H F;  3P5P A;  5E8H A;  4H5E F;  1UBY A;  1V4J A;  3LDW A;  3M02 A;  3QKC A;  3KRA A;  3WJN A;  5ILD A;  4H5D F;  3LZ9 A;  3TS7 A;  4LXW A;  1HXA A;  5B02 A;  2E93 A;  4H5C F;  5B0I A;  4P0X A;  1HX9 A;  5E8K A;  3Q2Z A;  3RBM A;  1N24 A;  3ZCD A;  4XQR F;  3MZV A;  4XQS F;  5HN9 A;  5B00 A;  1PS1 A;  4LFV F;  3ADZ A;  3N1W F;  3N6K F;  3NPK A;  3WCE A;  3VJA A;  3PH7 A;  2AET A;  3OAC B;  4N1Z F;  2OA6 A;  3NF2 A;  3RYW A;  2ZCO A;  3ICM A;  2FTZ A;  1VG6 A;  2Q9Y A;  4GA3 A;  3PYB A;  3SAE A;  3KBK A;  3VJD A;  1ZW5 A;  4RXC A;  3N3D A;  3WJO A;  3WCB A;  2Z4W A;  4KUX A;  4RYP A;  5JUZ F;  1HXC A;  5CG6 A;  4OKZ A;  1N21 A;  1N20 A;  1RQI A;  1N1Z A;  2Z52 A;  5HN8 A;  3VJE A;  1EZF A;  5AHU B;  5ERM A;  5IK6 A;  2ZY1 A;  1WKZ A;  5IK9 A;  3N0F A;  1VG7 A;  1DGP A;  3KRO B;  2OGD A;  3VJ9 A;  4KKM A;  3LOM A;  4MC3 A;  2Z4Z A;  3KRC B;  3LGZ B;  5JA0 F;  2E4O A;  4LLT A;  3EZ3 A;  2AEK A;  4E9Z A;  2H8O A;  3WEH A;  1UBX A;  4WK5 A;  4OGU A;  1YYT A;  4LTV A;  3M00 A;  3M9U A;  3KRA B;  4KQ5 A;  4NFI F;  4EA0 A;  4RNQ A;  5DIQ F;  3N49 F;  2E94 A;  4RXA A;  3WEI A;  3WCJ A;  1RQJ A;  1KIY A;  4KFA A;  2F7M F;  3WCF A;  1YV5 A;  4LOB A;  3WCL A;  2E91 A;  2E92 A;  2EWG A;  2AZL A;  1WL1 A;  2FOR A;  3DYF A;  2PS4 A;  3S9V A;  2AZK A;  5DGN F;  2Z4V A;  5DZ2 A;  4GP1 A;  4EA2 A; 
#chains in the Genus database with same CATH homology
 3PYA A;  1WL0 A;  1JFG A;  3WE9 A;  3ICK A;  5I1U A;  2ZEU A;  3CP6 A;  4E1E A;  5B0L A;  4NKF A;  3WSB A;  3LSN A;  2P1C A;  4DWG A;  1RTR A;  5AEL A;  5IM1 A;  4QPF A;  4DXJ A;  2E90 A;  3P5R A;  2Z50 A;  3WEG A;  3KRP A;  3TFN A;  4KVW A;  3ACY A;  5EAU A;  5H9D A;  2E8X A;  1UBV A;  4F6X A;  2F89 F;  3WEF A;  3BNY A;  3LVS A;  4LTZ A;  3N1V F;  2Q80 A;  5ILK A;  1N22 A;  1VG2 A;  2Q9Z A;  3ASX A;  3Q1O A;  4NKE A;  5IMI A;  1DI1 A;  3WCI A;  4PVX F;  3VJC A;  3EGT A;  1YYQ A;  3DYG A;  3LK5 A;  3KRF B;  5DJV F;  2E8T A;  3OYR A;  1YHM A;  5DGM F;  2F8C F;  3SDT A;  1WY0 A;  3ICZ A;  5HNA A;  1WL2 A;  3TC1 A;  4KPJ A;  3KB9 A;  4F6V A;  5ER8 A;  3N46 F;  4DHD A;  3VJ8 A;  3M01 A;  3Q2Q A;  4LPH F;  3CKE A;  5DJP F;  5A0J A;  2Q58 A;  4LA6 A;  1JFA A;  3SDQ A;  1N23 A;  2I19 A;  4LPG F;  3G4F A;  3WEJ A;  4KVI A;  4LA5 A;  3WCH A;  2J1O A;  2DH4 A;  4FJQ A;  4K10 A;  3WCA A;  3OAB A;  2PS8 A;  4P0V A;  3ZMC A;  5IKH A;  4KWD A;  3N5J F;  3PDE A;  3LGK A;  3TFP A;  1YYS A;  5EAS A;  4UMJ A;  5DW7 A;  4LLS A;  5JV1 F;  3WCD A;  2ZCR A;  3B7L A;  4JYX A;  1WL3 A;  3SDU A;  4LUU A;  4DEM F;  3WC9 A;  2PS6 A;  3M0G A;  5ILH A;  3WCM A;  3N0G A;  5CG5 A;  4P0W A;  5KSX F;  4KQU A;  2F94 F;  3P8R A;  4GP2 A;  1FPS A;  2Z7H A;  3V1X A;  3IPI A;  3TFV A;  3N3L F;  5DGS F;  3VJB A;  5A0I A;  4NFJ F;  2E95 A;  3ICN A;  2Z4X A;  1YYU A;  1HM7 A;  4LIX A;  4GAX A;  3QQV A;  3BNX A;  2Z4Y A;  4L2X F;  3SDR A;  2F92 F;  3P41 A;  2ONH A;  3LMD A;  4LZC A;  4KK2 A;  3RMG A;  4NG6 A;  1V4K A;  3P8L A;  4KVD A;  1V4I A;  3WCC A;  1WMW A;  2OPM A;  5HN7 A;  3V1V A;  5AFX A;  2J5C A;  4KPD A;  4RXD A;  5A0K A;  3Q30 A;  4QXS F;  3PKO A;  1YYR A;  3AQC B;  2AZJ A;  1YQ7 A;  4Q23 A;  5EAT A;  3NRI A;  5ERO A;  3OAB B;  1HM4 A;  4DZW A;  2Z7I A;  3AQ0 A;  5ILZ A;  2F9K F;  2OPN A;  4JZX A;  5B0J A;  4JZB A;  1V4H A;  2E8V A;  3ZL6 A;  4LZ0 A;  2E8W A;  2PS5 A;  1HXG A;  4N9U A;  5E8L A;  4KVY A;  3V66 A;  4OKM A;  5DJR F;  4OMH A;  2J1P A;  5IL8 A;  5B0M A;  1VG4 A;  1UBW A;  5ERN A;  5JV2 F;  5JV0 F;  3W7F A;  4LFG A;  5AYP A;  3ID0 A;  1KIZ A;  3ZOU A;  4JXY A;  4XQT F;  3RYE A;  3AQB B;  4MC0 A;  4MC8 A;  5B03 A;  4PVY F;  4E9U A;  4KQS A;  2ZCQ A;  5IN8 A;  4NFK F;  5ILY A;  1YHK A;  4NUA A;  5DHI A;  3AE0 A;  1N1B A;  1YJ4 A;  3NPR A;  3CC9 A;  2AEL A;  3N45 F;  4DWB A;  3SDV A;  5IK0 A;  2ONG A;  3WJK A;  5IMP A;  4JXN A;  4RXE A;  4LZ3 A;  5IVG A;  3KRP B;  2F8Z F;  5ILJ A;  1V4E A;  3DYH A;  2RAH A;  3ACW A;  3EFQ A;  3OAC A;  3APZ A;  5IKA A;  5DHK A;  3S4J A;  3G4D A;  4F62 A;  3WSA A;  2ZCS A;  4FP4 A;  3LLW A;  4DI5 A;  3WEK A;  4ZQ8 A;  5ILI A;  2O1O A;  4JVJ F;  4OMG A;  3LJI A;  3KRF A;  3LEE A;  5IMN A;  3ZMB A;  2VF6 A;  3WCG A;  4HD1 A;  3IBA A;  3UCA A;  1YHL A;  1VG3 A;  2PS7 A;  2ZEV A;  3LG5 A;  3KRO A;  3ACX A;  2E8U A;  2Z78 A;  3KRC A;  5B01 A;  5IL3 A;  3MAV A;  5B0K A;  4EA1 A;  2QIS A;  5C05 A;  4LFE A;  3N5H F;  3P5P A;  5E8H A;  4H5E F;  1UBY A;  1V4J A;  3LDW A;  3M02 A;  3QKC A;  3KRA A;  3WJN A;  5ILD A;  4H5D F;  3LZ9 A;  3TS7 A;  4LXW A;  1HXA A;  5B02 A;  2E93 A;  4H5C F;  5B0I A;  4P0X A;  1HX9 A;  5E8K A;  3Q2Z A;  3RBM A;  1N24 A;  3ZCD A;  4XQR F;  3MZV A;  4XQS F;  5HN9 A;  5B00 A;  1PS1 A;  4LFV F;  3ADZ A;  3N1W F;  3N6K F;  3NPK A;  3WCE A;  3VJA A;  3PH7 A;  2AET A;  3OAC B;  4N1Z F;  2OA6 A;  3NF2 A;  3RYW A;  2ZCO A;  3ICM A;  2FTZ A;  1VG6 A;  2Q9Y A;  4GA3 A;  3PYB A;  3SAE A;  3KBK A;  3VJD A;  1ZW5 A;  4RXC A;  3N3D A;  3WJO A;  3WCB A;  2Z4W A;  4KUX A;  4RYP A;  5JUZ F;  1HXC A;  5CG6 A;  4OKZ A;  1N21 A;  1N20 A;  1RQI A;  1N1Z A;  2Z52 A;  5HN8 A;  3VJE A;  1EZF A;  5AHU B;  5ERM A;  5IK6 A;  2ZY1 A;  1WKZ A;  5IK9 A;  3N0F A;  1VG7 A;  1DGP A;  3KRO B;  2OGD A;  3VJ9 A;  4KKM A;  3LOM A;  4MC3 A;  2Z4Z A;  3KRC B;  3LGZ B;  5JA0 F;  2E4O A;  4LLT A;  3EZ3 A;  2AEK A;  4E9Z A;  2H8O A;  3WEH A;  1UBX A;  4WK5 A;  4OGU A;  1YYT A;  4LTV A;  3M00 A;  3M9U A;  3KRA B;  4KQ5 A;  4NFI F;  4EA0 A;  4RNQ A;  5DIQ F;  3N49 F;  2E94 A;  4RXA A;  3WEI A;  3WCJ A;  1RQJ A;  1KIY A;  4KFA A;  2F7M F;  3WCF A;  1YV5 A;  4LOB A;  3WCL A;  2E91 A;  2E92 A;  2EWG A;  2AZL A;  1WL1 A;  2FOR A;  3DYF A;  2PS4 A;  3S9V A;  2AZK A;  5DGN F;  2Z4V A;  5DZ2 A;  4GP1 A;  4EA2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...