4E9UA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with a thiocyanate inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 116
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4e9uA00
3WCGA 4LZCA 3ADZA 3ZOUA 1YHLA 4LPHF 3VJCA 5DGSF 4MC8A 2Z4WA 5DJVF 1YHKA 2EWGA 3AE0A 3IPIA 2F8ZF 2E4OA 2F8CF 3LZ9A 5I1UA 2Z7HA 4OKMA 1VG7A 1WL2A 2Q9ZA 3DYGA 4RXAA 3CC9A 5A0IA 4EA1A 5A0KA 3BNYA 5ILKA 5DGMF 5ILZA 2P1CA 3P41A 5ILIA 1YYUA 5HN9A 5IK6A 4HD1A 2OGDA 1KIYA 2FTZA 3KROB 4JZXA 3BNXA 2OPMA 3LOMA 4PVYF 5DIQF 4PVXF 4KK2A 5A0JA 2Z52A 1V4JA 4MC0A 4E9ZA 1RQJA 3WCDA 2Q9YA 3KBKA 3Q2QA 4P0XA 2H8OA 3WCCA 4KVWA 2E95A 1VG6A 1V4KA 2PS6A 4DEMF 3LJIA 4LLTA 3RMGA 2QISA 3ZL6A 4N9UA 4DZWA 1VG4A 4LZ0A 4JZBA 2E8UA 3TC1A 3B7LA 5E8LA 3N0FA 3LG5A 3RYEA 3ICZA 3KB9A 3ZMBA 1WY0A 3DYHA 4JXYA 1N1ZA 1KIZA 4NFKF 3WJNA 5ER8A 4UMJA 4L2XF 5DW7A 1YYTA 2Z78A 5B00A 4KUXA 3N6KF 1RTRA 3N5JF 4N1ZF 3N3LF 3MZVA 3OYRA 5ILJA 4E9UA 3ICNA 4RXEA 2Q80A 2RAHA 2F7MF 3VJAA 2Z4VA 3M00A 3KRCA 1N22A 3LK5A 4QPFA 3ICKA 1UBWA 3WSAA 4OMHA 3VJDA 2E8TA 3G4DA 3ACXA 3LLWA 5IMPA 1DI1A 4H5CF 5DHKA 2AZJA 1V4HA 3NRIA 5ILYA 2FORA 5JV1F 4OKZA 5EROA 1V4EA 3Q30A 5CG5A 2ZEUA 5AFXA 5IKAA 4NG6A 1N24A 3TFVA 5DJPF 3AQBB 3IBAA 5AYPA 3EZ3A 4LTZA 3WCHA 3ICMA 3N46F 1HXCA 5DJRF 3NF2A 5ILDA 4LTVA 2J1PA 1N21A 3LGKA 3WJOA 3WCIA 1V4IA 4NFJF 5JV0F 3VJEA 3G4FA 3AQCB 4JYXA 4OGUA 2J1OA 3CKEA 3PH7A 1WMWA 2E8VA 4EA0A 3EGTA 2Q58A 4KQUA 5B0IA 4JVJF 5H9DA 3WCEA 1YYQA 3W7FA 4LOBA 3KROA 2E8WA 3WCAA 2ONGA 1HM4A 5B0LA 3P5PA 3SAEA 4KQSA 4XQRF 4DWGA 2ZCOA 1WKZA 3P8LA 4KVDA 4Q23A 1UBXA 2AZLA 5E8HA 4LA6A 3LVSA 3LMDA 3LGZB 2E93A 2PS5A 5B03A 5IVGA 3N5HF 4MC3A 3PDEA 1HXGA 4F6XA 3N45F 3M01A 5IKHA 2ZCQA 3PKOA 5AHUB 3DYFA 5JUZF 4DXJA 5KSXF 4KVIA 5B02A 3RBMA 2Z50A 2ZEVA 4F6VA 3N3DA 4XQTF 1HXAA 2OPNA 3VJBA 2PS8A 2O1OA 2AETA 3UCAA 3WCLA 4OMGA 5DGNF 1HM7A 2J5CA 4NKFA 5AELA 3LEEA 1UBYA 2AEKA 4K10A 3WJKA 3OACB 3M9UA 3LDWA 4KPJA 1VG3A 3ACWA 5IK0A 4EA2A 5HN8A 3WEIA 5B0JA 1YYRA 3ACYA 2ONHA 5IN8A 4P0WA 4LIXA 3SDUA 3WEJA 2E90A 3SDVA 4RXDA 5EAUA 3PYAA 2AELA 1VG2A 3KRPB 3KRAB 5IM1A 3KRPA 3KRAA 1DGPA 4KVYA 3V1VA 3SDQA 2F89F 3WE9A 4NKEA 4RXCA 4LFVF 2Z4YA 3NPRA 3CP6A 2ZCRA 4GP2A 3ZMCA 3WCJA 3WCBA 3N49F 3SDRA 2E8XA 3M0GA 3WCFA 4LZ3A 5DZ2A 1N23A 2F92F 1FPSA 3N1VF 4DWBA 5B0MA 4DHDA 2Z4XA 5IMNA 1WL3A 3P5RA 1N20A 2AZKA 1HX9A 2E94A 1UBVA 4KPDA 3WEHA 3WSBA 4WK5A 3TS7A 4QXSF 1WL0A 5IMIA 1YHMA 3SDTA 5ERNA 2E91A 1YJ4A 5C05A 2F94F 4F62A 2E92A 3QKCA 5IL8A 5HN7A 4RNQA 1PS1A 4NUAA 3WEKA 5CG6A 4LFGA 3WC9A 1WL1A 3S4JA 4E1EA 2OA6A 3TFNA 4LXWA 4JXNA 5DHIA 5EATA 3WEGA 3WEFA 3LSNA 4GP1A 4FP4A 4LPGF 4LUUA 2ZCSA 3M02A 3NPKA 1YQ7A 5B0KA 3Q1OA 3Q2ZA 1RQIA 5B01A 3VJ8A 2PS4A 2Z4ZA 3OACA 5JA0F 2VF6A 3TFPA 4LLSA 3EFQA 3RYWA 5IK9A 3AQ0A 2PS7A 4FJQA 4GAXA 3APZA 3MAVA 3KRCB 3OABB 4KQ5A 1YYSA 4ZQ8A 4H5EF 5EASA 3ASXA 3OABA 5ILHA 3P8RA 3S9VA 3V1XA 4LA5A 1JFGA 3VJ9A 1ZW5A 5ERMA 4LFEA 4NFIF 3V66A 4RYPA 2DH4A 1YV5A 5JV2F 4KWDA 2Z7IA 3ZCDA 4P0VA 4KKMA 3PYBA 4KFAA 5IL3A 2F9KF 2I19A 3WCMA 1N1BA 4H5DF 3N0GA 3N1WF 4DI5A 3KRFB 4GA3A 5HNAA 5E8KA 4XQSF 1EZFA 2ZY1A 1JFAA 3KRFA 3QQVA 3ID0A
chains in the Genus database with same CATH superfamily
3WCGA 4LZCA 3ADZA 3ZOUA 1YHLA 4LPHF 3VJCA 5DGSF 4MC8A 2Z4WA 5DJVF 1YHKA 2EWGA 3AE0A 3IPIA 2F8ZF 2E4OA 2F8CF 3LZ9A 5I1UA 2Z7HA 4OKMA 1VG7A 1WL2A 2Q9ZA 3DYGA 4RXAA 3CC9A 5A0IA 4EA1A 5A0KA 3BNYA 5ILKA 5DGMF 5ILZA 2P1CA 3P41A 5ILIA 1YYUA 5HN9A 5IK6A 4HD1A 2OGDA 1KIYA 2FTZA 3KROB 4JZXA 3BNXA 2OPMA 3LOMA 4PVYF 5DIQF 4PVXF 4KK2A 5A0JA 2Z52A 1V4JA 4MC0A 4E9ZA 1RQJA 3WCDA 2Q9YA 3KBKA 3Q2QA 4P0XA 2H8OA 3WCCA 4KVWA 2E95A 1VG6A 1V4KA 2PS6A 4DEMF 3LJIA 4LLTA 3RMGA 2QISA 3ZL6A 4N9UA 4DZWA 1VG4A 4LZ0A 4JZBA 2E8UA 3TC1A 3B7LA 5E8LA 3N0FA 3LG5A 3RYEA 3ICZA 3KB9A 3ZMBA 1WY0A 3DYHA 4JXYA 1N1ZA 1KIZA 4NFKF 3WJNA 5ER8A 4UMJA 4L2XF 5DW7A 1YYTA 2Z78A 5B00A 4KUXA 3N6KF 1RTRA 3N5JF 4N1ZF 3N3LF 3MZVA 3OYRA 5ILJA 4E9UA 3ICNA 4RXEA 2Q80A 2RAHA 2F7MF 3VJAA 2Z4VA 3M00A 3KRCA 1N22A 3LK5A 4QPFA 3ICKA 1UBWA 3WSAA 4OMHA 3VJDA 2E8TA 3G4DA 3ACXA 3LLWA 5IMPA 1DI1A 4H5CF 5DHKA 2AZJA 1V4HA 3NRIA 5ILYA 2FORA 5JV1F 4OKZA 5EROA 1V4EA 3Q30A 5CG5A 2ZEUA 5AFXA 5IKAA 4NG6A 1N24A 3TFVA 5DJPF 3AQBB 3IBAA 5AYPA 3EZ3A 4LTZA 3WCHA 3ICMA 3N46F 1HXCA 5DJRF 3NF2A 5ILDA 4LTVA 2J1PA 1N21A 3LGKA 3WJOA 3WCIA 1V4IA 4NFJF 5JV0F 3VJEA 3G4FA 3AQCB 4JYXA 4OGUA 2J1OA 3CKEA 3PH7A 1WMWA 2E8VA 4EA0A 3EGTA 2Q58A 4KQUA 5B0IA 4JVJF 5H9DA 3WCEA 1YYQA 3W7FA 4LOBA 3KROA 2E8WA 3WCAA 2ONGA 1HM4A 5B0LA 3P5PA 3SAEA 4KQSA 4XQRF 4DWGA 2ZCOA 1WKZA 3P8LA 4KVDA 4Q23A 1UBXA 2AZLA 5E8HA 4LA6A 3LVSA 3LMDA 3LGZB 2E93A 2PS5A 5B03A 5IVGA 3N5HF 4MC3A 3PDEA 1HXGA 4F6XA 3N45F 3M01A 5IKHA 2ZCQA 3PKOA 5AHUB 3DYFA 5JUZF 4DXJA 5KSXF 4KVIA 5B02A 3RBMA 2Z50A 2ZEVA 4F6VA 3N3DA 4XQTF 1HXAA 2OPNA 3VJBA 2PS8A 2O1OA 2AETA 3UCAA 3WCLA 4OMGA 5DGNF 1HM7A 2J5CA 4NKFA 5AELA 3LEEA 1UBYA 2AEKA 4K10A 3WJKA 3OACB 3M9UA 3LDWA 4KPJA 1VG3A 3ACWA 5IK0A 4EA2A 5HN8A 3WEIA 5B0JA 1YYRA 3ACYA 2ONHA 5IN8A 4P0WA 4LIXA 3SDUA 3WEJA 2E90A 3SDVA 4RXDA 5EAUA 3PYAA 2AELA 1VG2A 3KRPB 3KRAB 5IM1A 3KRPA 3KRAA 1DGPA 4KVYA 3V1VA 3SDQA 2F89F 3WE9A 4NKEA 4RXCA 4LFVF 2Z4YA 3NPRA 3CP6A 2ZCRA 4GP2A 3ZMCA 3WCJA 3WCBA 3N49F 3SDRA 2E8XA 3M0GA 3WCFA 4LZ3A 5DZ2A 1N23A 2F92F 1FPSA 3N1VF 4DWBA 5B0MA 4DHDA 2Z4XA 5IMNA 1WL3A 3P5RA 1N20A 2AZKA 1HX9A 2E94A 1UBVA 4KPDA 3WEHA 3WSBA 4WK5A 3TS7A 4QXSF 1WL0A 5IMIA 1YHMA 3SDTA 5ERNA 2E91A 1YJ4A 5C05A 2F94F 4F62A 2E92A 3QKCA 5IL8A 5HN7A 4RNQA 1PS1A 4NUAA 3WEKA 5CG6A 4LFGA 3WC9A 1WL1A 3S4JA 4E1EA 2OA6A 3TFNA 4LXWA 4JXNA 5DHIA 5EATA 3WEGA 3WEFA 3LSNA 4GP1A 4FP4A 4LPGF 4LUUA 2ZCSA 3M02A 3NPKA 1YQ7A 5B0KA 3Q1OA 3Q2ZA 1RQIA 5B01A 3VJ8A 2PS4A 2Z4ZA 3OACA 5JA0F 2VF6A 3TFPA 4LLSA 3EFQA 3RYWA 5IK9A 3AQ0A 2PS7A 4FJQA 4GAXA 3APZA 3MAVA 3KRCB 3OABB 4KQ5A 1YYSA 4ZQ8A 4H5EF 5EASA 3ASXA 3OABA 5ILHA 3P8RA 3S9VA 3V1XA 4LA5A 1JFGA 3VJ9A 1ZW5A 5ERMA 4LFEA 4NFIF 3V66A 4RYPA 2DH4A 1YV5A 5JV2F 4KWDA 2Z7IA 3ZCDA 4P0VA 4KKMA 3PYBA 4KFAA 5IL3A 2F9KF 2I19A 3WCMA 1N1BA 4H5DF 3N0GA 3N1WF 4DI5A 3KRFB 4GA3A 5HNAA 5E8KA 4XQSF 1EZFA 2ZY1A 1JFAA 3KRFA 3QQVA 3ID0A
chains in the Genus database with same CATH topology
3WCGA 4LZCA 3ADZA 3ZOUA 1YHLA 4LPHF 3VJCA 5DGSF 4MC8A 2Z4WA 5DJVF 1YHKA 2EWGA 3AE0A 3IPIA 2F8ZF 2E4OA 2F8CF 3LZ9A 5I1UA 2Z7HA 4OKMA 1VG7A 1WL2A 2Q9ZA 3DYGA 4RXAA 3CC9A 5A0IA 4EA1A 5A0KA 3BNYA 5ILKA 5DGMF 5ILZA 2P1CA 3P41A 5ILIA 1YYUA 5HN9A 5IK6A 4HD1A 2OGDA 1KIYA 2FTZA 3KROB 4JZXA 3BNXA 2OPMA 3LOMA 4PVYF 5DIQF 4PVXF 4KK2A 5A0JA 2Z52A 1V4JA 4MC0A 4E9ZA 1RQJA 3WCDA 2Q9YA 3KBKA 3Q2QA 4P0XA 2H8OA 3WCCA 4KVWA 2E95A 1VG6A 1V4KA 2PS6A 4DEMF 3LJIA 4LLTA 3RMGA 2QISA 3ZL6A 4N9UA 4DZWA 1VG4A 4LZ0A 4JZBA 2E8UA 3TC1A 3B7LA 5E8LA 3N0FA 3LG5A 3RYEA 3ICZA 3KB9A 3ZMBA 1WY0A 3DYHA 4JXYA 1N1ZA 1KIZA 4NFKF 3WJNA 5ER8A 4UMJA 4L2XF 5DW7A 1YYTA 2Z78A 5B00A 4KUXA 3N6KF 1RTRA 3N5JF 4N1ZF 3N3LF 3MZVA 3OYRA 5ILJA 4E9UA 3ICNA 4RXEA 2Q80A 2RAHA 2F7MF 3VJAA 2Z4VA 3M00A 3KRCA 1N22A 3LK5A 4QPFA 3ICKA 1UBWA 3WSAA 4OMHA 3VJDA 2E8TA 3G4DA 3ACXA 3LLWA 5IMPA 1DI1A 4H5CF 5DHKA 2AZJA 1V4HA 3NRIA 5ILYA 2FORA 5JV1F 4OKZA 5EROA 1V4EA 3Q30A 5CG5A 2ZEUA 5AFXA 5IKAA 4NG6A 1N24A 3TFVA 5DJPF 3AQBB 3IBAA 5AYPA 3EZ3A 4LTZA 3WCHA 3ICMA 3N46F 1HXCA 5DJRF 3NF2A 5ILDA 4LTVA 2J1PA 1N21A 3LGKA 3WJOA 3WCIA 1V4IA 4NFJF 5JV0F 3VJEA 3G4FA 3AQCB 4JYXA 4OGUA 2J1OA 3CKEA 3PH7A 1WMWA 2E8VA 4EA0A 3EGTA 2Q58A 4KQUA 5B0IA 4JVJF 5H9DA 3WCEA 1YYQA 3W7FA 4LOBA 3KROA 2E8WA 3WCAA 2ONGA 1HM4A 5B0LA 3P5PA 3SAEA 4KQSA 4XQRF 4DWGA 2ZCOA 1WKZA 3P8LA 4KVDA 4Q23A 1UBXA 2AZLA 5E8HA 4LA6A 3LVSA 3LMDA 3LGZB 2E93A 2PS5A 5B03A 5IVGA 3N5HF 4MC3A 3PDEA 1HXGA 4F6XA 3N45F 3M01A 5IKHA 2ZCQA 3PKOA 5AHUB 3DYFA 5JUZF 4DXJA 5KSXF 4KVIA 5B02A 3RBMA 2Z50A 2ZEVA 4F6VA 3N3DA 4XQTF 1HXAA 2OPNA 3VJBA 2PS8A 2O1OA 2AETA 3UCAA 3WCLA 4OMGA 5DGNF 1HM7A 2J5CA 4NKFA 5AELA 3LEEA 1UBYA 2AEKA 4K10A 3WJKA 3OACB 3M9UA 3LDWA 4KPJA 1VG3A 3ACWA 5IK0A 4EA2A 5HN8A 3WEIA 5B0JA 1YYRA 3ACYA 2ONHA 5IN8A 4P0WA 4LIXA 3SDUA 3WEJA 2E90A 3SDVA 4RXDA 5EAUA 3PYAA 2AELA 1VG2A 3KRPB 3KRAB 5IM1A 3KRPA 3KRAA 1DGPA 4KVYA 3V1VA 3SDQA 2F89F 3WE9A 4NKEA 4RXCA 4LFVF 2Z4YA 3NPRA 3CP6A 2ZCRA 4GP2A 3ZMCA 3WCJA 3WCBA 3N49F 3SDRA 2E8XA 3M0GA 3WCFA 4LZ3A 5DZ2A 1N23A 2F92F 1FPSA 3N1VF 4DWBA 5B0MA 4DHDA 2Z4XA 5IMNA 1WL3A 3P5RA 1N20A 2AZKA 1HX9A 2E94A 1UBVA 4KPDA 3WEHA 3WSBA 4WK5A 3TS7A 4QXSF 1WL0A 5IMIA 1YHMA 3SDTA 5ERNA 2E91A 1YJ4A 5C05A 2F94F 4F62A 2E92A 3QKCA 5IL8A 5HN7A 4RNQA 1PS1A 4NUAA 3WEKA 5CG6A 4LFGA 3WC9A 1WL1A 3S4JA 4E1EA 2OA6A 3TFNA 4LXWA 4JXNA 5DHIA 5EATA 3WEGA 3WEFA 3LSNA 4GP1A 4FP4A 4LPGF 4LUUA 2ZCSA 3M02A 3NPKA 1YQ7A 5B0KA 3Q1OA 3Q2ZA 1RQIA 5B01A 3VJ8A 2PS4A 2Z4ZA 3OACA 5JA0F 2VF6A 3TFPA 4LLSA 3EFQA 3RYWA 5IK9A 3AQ0A 2PS7A 4FJQA 4GAXA 3APZA 3MAVA 3KRCB 3OABB 4KQ5A 1YYSA 4ZQ8A 4H5EF 5EASA 3ASXA 3OABA 5ILHA 3P8RA 3S9VA 3V1XA 4LA5A 1JFGA 3VJ9A 1ZW5A 5ERMA 4LFEA 4NFIF 3V66A 4RYPA 2DH4A 1YV5A 5JV2F 4KWDA 2Z7IA 3ZCDA 4P0VA 4KKMA 3PYBA 4KFAA 5IL3A 2F9KF 2I19A 3WCMA 1N1BA 4H5DF 3N0GA 3N1WF 4DI5A 3KRFB 4GA3A 5HNAA 5E8KA 4XQSF 1EZFA 2ZY1A 1JFAA 3KRFA 3QQVA 3ID0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCG A;  4LZC A;  3ADZ A;  3ZOU A;  1YHL A;  4LPH F;  3VJC A;  5DGS F;  4MC8 A;  2Z4W A;  5DJV F;  1YHK A;  2EWG A;  3AE0 A;  3IPI A;  2F8Z F;  2E4O A;  2F8C F;  3LZ9 A;  5I1U A;  2Z7H A;  4OKM A;  1VG7 A;  1WL2 A;  2Q9Z A;  3DYG A;  4RXA A;  3CC9 A;  5A0I A;  4EA1 A;  5A0K A;  3BNY A;  5ILK A;  5DGM F;  5ILZ A;  2P1C A;  3P41 A;  5ILI A;  1YYU A;  5HN9 A;  5IK6 A;  4HD1 A;  2OGD A;  1KIY A;  2FTZ A;  3KRO B;  4JZX A;  3BNX A;  2OPM A;  3LOM A;  4PVY F;  5DIQ F;  4PVX F;  4KK2 A;  5A0J A;  2Z52 A;  1V4J A;  4MC0 A;  4E9Z A;  1RQJ A;  3WCD A;  2Q9Y A;  3KBK A;  3Q2Q A;  4P0X A;  2H8O A;  3WCC A;  4KVW A;  2E95 A;  1VG6 A;  1V4K A;  2PS6 A;  4DEM F;  3LJI A;  4LLT A;  3RMG A;  2QIS A;  3ZL6 A;  4N9U A;  4DZW A;  1VG4 A;  4LZ0 A;  4JZB A;  2E8U A;  3TC1 A;  3B7L A;  5E8L A;  3N0F A;  3LG5 A;  3RYE A;  3ICZ A;  3KB9 A;  3ZMB A;  1WY0 A;  3DYH A;  4JXY A;  1N1Z A;  1KIZ A;  4NFK F;  3WJN A;  5ER8 A;  4UMJ A;  4L2X F;  5DW7 A;  1YYT A;  2Z78 A;  5B00 A;  4KUX A;  3N6K F;  1RTR A;  3N5J F;  4N1Z F;  3N3L F;  3MZV A;  3OYR A;  5ILJ A;  4E9U A;  3ICN A;  4RXE A;  2Q80 A;  2RAH A;  2F7M F;  3VJA A;  2Z4V A;  3M00 A;  3KRC A;  1N22 A;  3LK5 A;  4QPF A;  3ICK A;  1UBW A;  3WSA A;  4OMH A;  3VJD A;  2E8T A;  3G4D A;  3ACX A;  3LLW A;  5IMP A;  1DI1 A;  4H5C F;  5DHK A;  2AZJ A;  1V4H A;  3NRI A;  5ILY A;  2FOR A;  5JV1 F;  4OKZ A;  5ERO A;  1V4E A;  3Q30 A;  5CG5 A;  2ZEU A;  5AFX A;  5IKA A;  4NG6 A;  1N24 A;  3TFV A;  5DJP F;  3AQB B;  3IBA A;  5AYP A;  3EZ3 A;  4LTZ A;  3WCH A;  3ICM A;  3N46 F;  1HXC A;  5DJR F;  3NF2 A;  5ILD A;  4LTV A;  2J1P A;  1N21 A;  3LGK A;  3WJO A;  3WCI A;  1V4I A;  4NFJ F;  5JV0 F;  3VJE A;  3G4F A;  3AQC B;  4JYX A;  4OGU A;  2J1O A;  3CKE A;  3PH7 A;  1WMW A;  2E8V A;  4EA0 A;  3EGT A;  2Q58 A;  4KQU A;  5B0I A;  4JVJ F;  5H9D A;  3WCE A;  1YYQ A;  3W7F A;  4LOB A;  3KRO A;  2E8W A;  3WCA A;  2ONG A;  1HM4 A;  5B0L A;  3P5P A;  3SAE A;  4KQS A;  4XQR F;  4DWG A;  2ZCO A;  1WKZ A;  3P8L A;  4KVD A;  4Q23 A;  1UBX A;  2AZL A;  5E8H A;  4LA6 A;  3LVS A;  3LMD A;  3LGZ B;  2E93 A;  2PS5 A;  5B03 A;  5IVG A;  3N5H F;  4MC3 A;  3PDE A;  1HXG A;  4F6X A;  3N45 F;  3M01 A;  5IKH A;  2ZCQ A;  3PKO A;  5AHU B;  3DYF A;  5JUZ F;  4DXJ A;  5KSX F;  4KVI A;  5B02 A;  3RBM A;  2Z50 A;  2ZEV A;  4F6V A;  3N3D A;  4XQT F;  1HXA A;  2OPN A;  3VJB A;  2PS8 A;  2O1O A;  2AET A;  3UCA A;  3WCL A;  4OMG A;  5DGN F;  1HM7 A;  2J5C A;  4NKF A;  5AEL A;  3LEE A;  1UBY A;  2AEK A;  4K10 A;  3WJK A;  3OAC B;  3M9U A;  3LDW A;  4KPJ A;  1VG3 A;  3ACW A;  5IK0 A;  4EA2 A;  5HN8 A;  3WEI A;  5B0J A;  1YYR A;  3ACY A;  2ONH A;  5IN8 A;  4P0W A;  4LIX A;  3SDU A;  3WEJ A;  2E90 A;  3SDV A;  4RXD A;  5EAU A;  3PYA A;  2AEL A;  1VG2 A;  3KRP B;  3KRA B;  5IM1 A;  3KRP A;  3KRA A;  1DGP A;  4KVY A;  3V1V A;  3SDQ A;  2F89 F;  3WE9 A;  4NKE A;  4RXC A;  4LFV F;  2Z4Y A;  3NPR A;  3CP6 A;  2ZCR A;  4GP2 A;  3ZMC A;  3WCJ A;  3WCB A;  3N49 F;  3SDR A;  2E8X A;  3M0G A;  3WCF A;  4LZ3 A;  5DZ2 A;  1N23 A;  2F92 F;  1FPS A;  3N1V F;  4DWB A;  5B0M A;  4DHD A;  2Z4X A;  5IMN A;  1WL3 A;  3P5R A;  1N20 A;  2AZK A;  1HX9 A;  2E94 A;  1UBV A;  4KPD A;  3WEH A;  3WSB A;  4WK5 A;  3TS7 A;  4QXS F;  1WL0 A;  5IMI A;  1YHM A;  3SDT A;  5ERN A;  2E91 A;  1YJ4 A;  5C05 A;  2F94 F;  4F62 A;  2E92 A;  3QKC A;  5IL8 A;  5HN7 A;  4RNQ A;  1PS1 A;  4NUA A;  3WEK A;  5CG6 A;  4LFG A;  3WC9 A;  1WL1 A;  3S4J A;  4E1E A;  2OA6 A;  3TFN A;  4LXW A;  4JXN A;  5DHI A;  5EAT A;  3WEG A;  3WEF A;  3LSN A;  4GP1 A;  4FP4 A;  4LPG F;  4LUU A;  2ZCS A;  3M02 A;  3NPK A;  1YQ7 A;  5B0K A;  3Q1O A;  3Q2Z A;  1RQI A;  5B01 A;  3VJ8 A;  2PS4 A;  2Z4Z A;  3OAC A;  5JA0 F;  2VF6 A;  3TFP A;  4LLS A;  3EFQ A;  3RYW A;  5IK9 A;  3AQ0 A;  2PS7 A;  4FJQ A;  4GAX A;  3APZ A;  3MAV A;  3KRC B;  3OAB B;  4KQ5 A;  1YYS A;  4ZQ8 A;  4H5E F;  5EAS A;  3ASX A;  3OAB A;  5ILH A;  3P8R A;  3S9V A;  3V1X A;  4LA5 A;  1JFG A;  3VJ9 A;  1ZW5 A;  5ERM A;  4LFE A;  4NFI F;  3V66 A;  4RYP A;  2DH4 A;  1YV5 A;  5JV2 F;  4KWD A;  2Z7I A;  3ZCD A;  4P0V A;  4KKM A;  3PYB A;  4KFA A;  5IL3 A;  2F9K F;  2I19 A;  3WCM A;  1N1B A;  4H5D F;  3N0G A;  3N1W F;  4DI5 A;  3KRF B;  4GA3 A;  5HNA A;  5E8K A;  4XQS F;  1EZF A;  2ZY1 A;  1JFA A;  3KRF A;  3QQV A;  3ID0 A; 
#chains in the Genus database with same CATH topology
 3WCG A;  4LZC A;  3ADZ A;  3ZOU A;  1YHL A;  4LPH F;  3VJC A;  5DGS F;  4MC8 A;  2Z4W A;  5DJV F;  1YHK A;  2EWG A;  3AE0 A;  3IPI A;  2F8Z F;  2E4O A;  2F8C F;  3LZ9 A;  5I1U A;  2Z7H A;  4OKM A;  1VG7 A;  1WL2 A;  2Q9Z A;  3DYG A;  4RXA A;  3CC9 A;  5A0I A;  4EA1 A;  5A0K A;  3BNY A;  5ILK A;  5DGM F;  5ILZ A;  2P1C A;  3P41 A;  5ILI A;  1YYU A;  5HN9 A;  5IK6 A;  4HD1 A;  2OGD A;  1KIY A;  2FTZ A;  3KRO B;  4JZX A;  3BNX A;  2OPM A;  3LOM A;  4PVY F;  5DIQ F;  4PVX F;  4KK2 A;  5A0J A;  2Z52 A;  1V4J A;  4MC0 A;  4E9Z A;  1RQJ A;  3WCD A;  2Q9Y A;  3KBK A;  3Q2Q A;  4P0X A;  2H8O A;  3WCC A;  4KVW A;  2E95 A;  1VG6 A;  1V4K A;  2PS6 A;  4DEM F;  3LJI A;  4LLT A;  3RMG A;  2QIS A;  3ZL6 A;  4N9U A;  4DZW A;  1VG4 A;  4LZ0 A;  4JZB A;  2E8U A;  3TC1 A;  3B7L A;  5E8L A;  3N0F A;  3LG5 A;  3RYE A;  3ICZ A;  3KB9 A;  3ZMB A;  1WY0 A;  3DYH A;  4JXY A;  1N1Z A;  1KIZ A;  4NFK F;  3WJN A;  5ER8 A;  4UMJ A;  4L2X F;  5DW7 A;  1YYT A;  2Z78 A;  5B00 A;  4KUX A;  3N6K F;  1RTR A;  3N5J F;  4N1Z F;  3N3L F;  3MZV A;  3OYR A;  5ILJ A;  4E9U A;  3ICN A;  4RXE A;  2Q80 A;  2RAH A;  2F7M F;  3VJA A;  2Z4V A;  3M00 A;  3KRC A;  1N22 A;  3LK5 A;  4QPF A;  3ICK A;  1UBW A;  3WSA A;  4OMH A;  3VJD A;  2E8T A;  3G4D A;  3ACX A;  3LLW A;  5IMP A;  1DI1 A;  4H5C F;  5DHK A;  2AZJ A;  1V4H A;  3NRI A;  5ILY A;  2FOR A;  5JV1 F;  4OKZ A;  5ERO A;  1V4E A;  3Q30 A;  5CG5 A;  2ZEU A;  5AFX A;  5IKA A;  4NG6 A;  1N24 A;  3TFV A;  5DJP F;  3AQB B;  3IBA A;  5AYP A;  3EZ3 A;  4LTZ A;  3WCH A;  3ICM A;  3N46 F;  1HXC A;  5DJR F;  3NF2 A;  5ILD A;  4LTV A;  2J1P A;  1N21 A;  3LGK A;  3WJO A;  3WCI A;  1V4I A;  4NFJ F;  5JV0 F;  3VJE A;  3G4F A;  3AQC B;  4JYX A;  4OGU A;  2J1O A;  3CKE A;  3PH7 A;  1WMW A;  2E8V A;  4EA0 A;  3EGT A;  2Q58 A;  4KQU A;  5B0I A;  4JVJ F;  5H9D A;  3WCE A;  1YYQ A;  3W7F A;  4LOB A;  3KRO A;  2E8W A;  3WCA A;  2ONG A;  1HM4 A;  5B0L A;  3P5P A;  3SAE A;  4KQS A;  4XQR F;  4DWG A;  2ZCO A;  1WKZ A;  3P8L A;  4KVD A;  4Q23 A;  1UBX A;  2AZL A;  5E8H A;  4LA6 A;  3LVS A;  3LMD A;  3LGZ B;  2E93 A;  2PS5 A;  5B03 A;  5IVG A;  3N5H F;  4MC3 A;  3PDE A;  1HXG A;  4F6X A;  3N45 F;  3M01 A;  5IKH A;  2ZCQ A;  3PKO A;  5AHU B;  3DYF A;  5JUZ F;  4DXJ A;  5KSX F;  4KVI A;  5B02 A;  3RBM A;  2Z50 A;  2ZEV A;  4F6V A;  3N3D A;  4XQT F;  1HXA A;  2OPN A;  3VJB A;  2PS8 A;  2O1O A;  2AET A;  3UCA A;  3WCL A;  4OMG A;  5DGN F;  1HM7 A;  2J5C A;  4NKF A;  5AEL A;  3LEE A;  1UBY A;  2AEK A;  4K10 A;  3WJK A;  3OAC B;  3M9U A;  3LDW A;  4KPJ A;  1VG3 A;  3ACW A;  5IK0 A;  4EA2 A;  5HN8 A;  3WEI A;  5B0J A;  1YYR A;  3ACY A;  2ONH A;  5IN8 A;  4P0W A;  4LIX A;  3SDU A;  3WEJ A;  2E90 A;  3SDV A;  4RXD A;  5EAU A;  3PYA A;  2AEL A;  1VG2 A;  3KRP B;  3KRA B;  5IM1 A;  3KRP A;  3KRA A;  1DGP A;  4KVY A;  3V1V A;  3SDQ A;  2F89 F;  3WE9 A;  4NKE A;  4RXC A;  4LFV F;  2Z4Y A;  3NPR A;  3CP6 A;  2ZCR A;  4GP2 A;  3ZMC A;  3WCJ A;  3WCB A;  3N49 F;  3SDR A;  2E8X A;  3M0G A;  3WCF A;  4LZ3 A;  5DZ2 A;  1N23 A;  2F92 F;  1FPS A;  3N1V F;  4DWB A;  5B0M A;  4DHD A;  2Z4X A;  5IMN A;  1WL3 A;  3P5R A;  1N20 A;  2AZK A;  1HX9 A;  2E94 A;  1UBV A;  4KPD A;  3WEH A;  3WSB A;  4WK5 A;  3TS7 A;  4QXS F;  1WL0 A;  5IMI A;  1YHM A;  3SDT A;  5ERN A;  2E91 A;  1YJ4 A;  5C05 A;  2F94 F;  4F62 A;  2E92 A;  3QKC A;  5IL8 A;  5HN7 A;  4RNQ A;  1PS1 A;  4NUA A;  3WEK A;  5CG6 A;  4LFG A;  3WC9 A;  1WL1 A;  3S4J A;  4E1E A;  2OA6 A;  3TFN A;  4LXW A;  4JXN A;  5DHI A;  5EAT A;  3WEG A;  3WEF A;  3LSN A;  4GP1 A;  4FP4 A;  4LPG F;  4LUU A;  2ZCS A;  3M02 A;  3NPK A;  1YQ7 A;  5B0K A;  3Q1O A;  3Q2Z A;  1RQI A;  5B01 A;  3VJ8 A;  2PS4 A;  2Z4Z A;  3OAC A;  5JA0 F;  2VF6 A;  3TFP A;  4LLS A;  3EFQ A;  3RYW A;  5IK9 A;  3AQ0 A;  2PS7 A;  4FJQ A;  4GAX A;  3APZ A;  3MAV A;  3KRC B;  3OAB B;  4KQ5 A;  1YYS A;  4ZQ8 A;  4H5E F;  5EAS A;  3ASX A;  3OAB A;  5ILH A;  3P8R A;  3S9V A;  3V1X A;  4LA5 A;  1JFG A;  3VJ9 A;  1ZW5 A;  5ERM A;  4LFE A;  4NFI F;  3V66 A;  4RYP A;  2DH4 A;  1YV5 A;  5JV2 F;  4KWD A;  2Z7I A;  3ZCD A;  4P0V A;  4KKM A;  3PYB A;  4KFA A;  5IL3 A;  2F9K F;  2I19 A;  3WCM A;  1N1B A;  4H5D F;  3N0G A;  3N1W F;  4DI5 A;  3KRF B;  4GA3 A;  5HNA A;  5E8K A;  4XQS F;  1EZF A;  2ZY1 A;  1JFA A;  3KRF A;  3QQV A;  3ID0 A; 
#chains in the Genus database with same CATH homology
 3WCG A;  4LZC A;  3ADZ A;  3ZOU A;  1YHL A;  4LPH F;  3VJC A;  5DGS F;  4MC8 A;  2Z4W A;  5DJV F;  1YHK A;  2EWG A;  3AE0 A;  3IPI A;  2F8Z F;  2E4O A;  2F8C F;  3LZ9 A;  5I1U A;  2Z7H A;  4OKM A;  1VG7 A;  1WL2 A;  2Q9Z A;  3DYG A;  4RXA A;  3CC9 A;  5A0I A;  4EA1 A;  5A0K A;  3BNY A;  5ILK A;  5DGM F;  5ILZ A;  2P1C A;  3P41 A;  5ILI A;  1YYU A;  5HN9 A;  5IK6 A;  4HD1 A;  2OGD A;  1KIY A;  2FTZ A;  3KRO B;  4JZX A;  3BNX A;  2OPM A;  3LOM A;  4PVY F;  5DIQ F;  4PVX F;  4KK2 A;  5A0J A;  2Z52 A;  1V4J A;  4MC0 A;  4E9Z A;  1RQJ A;  3WCD A;  2Q9Y A;  3KBK A;  3Q2Q A;  4P0X A;  2H8O A;  3WCC A;  4KVW A;  2E95 A;  1VG6 A;  1V4K A;  2PS6 A;  4DEM F;  3LJI A;  4LLT A;  3RMG A;  2QIS A;  3ZL6 A;  4N9U A;  4DZW A;  1VG4 A;  4LZ0 A;  4JZB A;  2E8U A;  3TC1 A;  3B7L A;  5E8L A;  3N0F A;  3LG5 A;  3RYE A;  3ICZ A;  3KB9 A;  3ZMB A;  1WY0 A;  3DYH A;  4JXY A;  1N1Z A;  1KIZ A;  4NFK F;  3WJN A;  5ER8 A;  4UMJ A;  4L2X F;  5DW7 A;  1YYT A;  2Z78 A;  5B00 A;  4KUX A;  3N6K F;  1RTR A;  3N5J F;  4N1Z F;  3N3L F;  3MZV A;  3OYR A;  5ILJ A;  4E9U A;  3ICN A;  4RXE A;  2Q80 A;  2RAH A;  2F7M F;  3VJA A;  2Z4V A;  3M00 A;  3KRC A;  1N22 A;  3LK5 A;  4QPF A;  3ICK A;  1UBW A;  3WSA A;  4OMH A;  3VJD A;  2E8T A;  3G4D A;  3ACX A;  3LLW A;  5IMP A;  1DI1 A;  4H5C F;  5DHK A;  2AZJ A;  1V4H A;  3NRI A;  5ILY A;  2FOR A;  5JV1 F;  4OKZ A;  5ERO A;  1V4E A;  3Q30 A;  5CG5 A;  2ZEU A;  5AFX A;  5IKA A;  4NG6 A;  1N24 A;  3TFV A;  5DJP F;  3AQB B;  3IBA A;  5AYP A;  3EZ3 A;  4LTZ A;  3WCH A;  3ICM A;  3N46 F;  1HXC A;  5DJR F;  3NF2 A;  5ILD A;  4LTV A;  2J1P A;  1N21 A;  3LGK A;  3WJO A;  3WCI A;  1V4I A;  4NFJ F;  5JV0 F;  3VJE A;  3G4F A;  3AQC B;  4JYX A;  4OGU A;  2J1O A;  3CKE A;  3PH7 A;  1WMW A;  2E8V A;  4EA0 A;  3EGT A;  2Q58 A;  4KQU A;  5B0I A;  4JVJ F;  5H9D A;  3WCE A;  1YYQ A;  3W7F A;  4LOB A;  3KRO A;  2E8W A;  3WCA A;  2ONG A;  1HM4 A;  5B0L A;  3P5P A;  3SAE A;  4KQS A;  4XQR F;  4DWG A;  2ZCO A;  1WKZ A;  3P8L A;  4KVD A;  4Q23 A;  1UBX A;  2AZL A;  5E8H A;  4LA6 A;  3LVS A;  3LMD A;  3LGZ B;  2E93 A;  2PS5 A;  5B03 A;  5IVG A;  3N5H F;  4MC3 A;  3PDE A;  1HXG A;  4F6X A;  3N45 F;  3M01 A;  5IKH A;  2ZCQ A;  3PKO A;  5AHU B;  3DYF A;  5JUZ F;  4DXJ A;  5KSX F;  4KVI A;  5B02 A;  3RBM A;  2Z50 A;  2ZEV A;  4F6V A;  3N3D A;  4XQT F;  1HXA A;  2OPN A;  3VJB A;  2PS8 A;  2O1O A;  2AET A;  3UCA A;  3WCL A;  4OMG A;  5DGN F;  1HM7 A;  2J5C A;  4NKF A;  5AEL A;  3LEE A;  1UBY A;  2AEK A;  4K10 A;  3WJK A;  3OAC B;  3M9U A;  3LDW A;  4KPJ A;  1VG3 A;  3ACW A;  5IK0 A;  4EA2 A;  5HN8 A;  3WEI A;  5B0J A;  1YYR A;  3ACY A;  2ONH A;  5IN8 A;  4P0W A;  4LIX A;  3SDU A;  3WEJ A;  2E90 A;  3SDV A;  4RXD A;  5EAU A;  3PYA A;  2AEL A;  1VG2 A;  3KRP B;  3KRA B;  5IM1 A;  3KRP A;  3KRA A;  1DGP A;  4KVY A;  3V1V A;  3SDQ A;  2F89 F;  3WE9 A;  4NKE A;  4RXC A;  4LFV F;  2Z4Y A;  3NPR A;  3CP6 A;  2ZCR A;  4GP2 A;  3ZMC A;  3WCJ A;  3WCB A;  3N49 F;  3SDR A;  2E8X A;  3M0G A;  3WCF A;  4LZ3 A;  5DZ2 A;  1N23 A;  2F92 F;  1FPS A;  3N1V F;  4DWB A;  5B0M A;  4DHD A;  2Z4X A;  5IMN A;  1WL3 A;  3P5R A;  1N20 A;  2AZK A;  1HX9 A;  2E94 A;  1UBV A;  4KPD A;  3WEH A;  3WSB A;  4WK5 A;  3TS7 A;  4QXS F;  1WL0 A;  5IMI A;  1YHM A;  3SDT A;  5ERN A;  2E91 A;  1YJ4 A;  5C05 A;  2F94 F;  4F62 A;  2E92 A;  3QKC A;  5IL8 A;  5HN7 A;  4RNQ A;  1PS1 A;  4NUA A;  3WEK A;  5CG6 A;  4LFG A;  3WC9 A;  1WL1 A;  3S4J A;  4E1E A;  2OA6 A;  3TFN A;  4LXW A;  4JXN A;  5DHI A;  5EAT A;  3WEG A;  3WEF A;  3LSN A;  4GP1 A;  4FP4 A;  4LPG F;  4LUU A;  2ZCS A;  3M02 A;  3NPK A;  1YQ7 A;  5B0K A;  3Q1O A;  3Q2Z A;  1RQI A;  5B01 A;  3VJ8 A;  2PS4 A;  2Z4Z A;  3OAC A;  5JA0 F;  2VF6 A;  3TFP A;  4LLS A;  3EFQ A;  3RYW A;  5IK9 A;  3AQ0 A;  2PS7 A;  4FJQ A;  4GAX A;  3APZ A;  3MAV A;  3KRC B;  3OAB B;  4KQ5 A;  1YYS A;  4ZQ8 A;  4H5E F;  5EAS A;  3ASX A;  3OAB A;  5ILH A;  3P8R A;  3S9V A;  3V1X A;  4LA5 A;  1JFG A;  3VJ9 A;  1ZW5 A;  5ERM A;  4LFE A;  4NFI F;  3V66 A;  4RYP A;  2DH4 A;  1YV5 A;  5JV2 F;  4KWD A;  2Z7I A;  3ZCD A;  4P0V A;  4KKM A;  3PYB A;  4KFA A;  5IL3 A;  2F9K F;  2I19 A;  3WCM A;  1N1B A;  4H5D F;  3N0G A;  3N1W F;  4DI5 A;  3KRF B;  4GA3 A;  5HNA A;  5E8K A;  4XQS F;  1EZF A;  2ZY1 A;  1JFA A;  3KRF A;  3QQV A;  3ID0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...