4E9UA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with a thiocyanate inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 116
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4e9uA00
4RXAA 5AELA 1N24A 2AZLA 3PYAA 3WEHA 1V4IA 2E94A 4EA0A 3RMGA 3IPIA 3LMDA 1YV5A 4RNQA 5HN8A 2ONGA 2E8VA 5B0JA 4LFVF 3LK5A 5JV0F 3M0GA 5B0MA 1FPSA 3KRAA 2J1PA 4XQSF 3N49F 5ILDA 4DWBA 1VG3A 1JFGA 2DH4A 3SDVA 3KRPB 3N5HF 4LTVA 2E8UA 5IMNA 3WCHA 4P0VA 3LSNA 4JXYA 4GP1A 3APZA 3N1WF 2F8CF 2E93A 2AZJA 4LTZA 4E1EA 2J5CA 2Q9ZA 3AQ0A 5JUZF 3RYEA 3DYFA 4QPFA 4DEMF 1N22A 5IM1A 4KK2A 2Z4XA 3TS7A 4LPHF 4EA2A 5DJPF 4KVWA 1RTRA 4LFEA 5AHUB 3ZCDA 3WJNA 4NUAA 4RXDA 2Z78A 5HNAA 1HM4A 2H8OA 5AYPA 5CG5A 3KRCB 3CKEA 5IK9A 4LA5A 2E8XA 5IMIA 3ACYA 5IL3A 3TFPA 3DYGA 3ACWA 3V1VA 3WJOA 3N0FA 5B0KA 3N5JF 3LGZB 2Z4VA 4P0XA 4JZBA 3M9UA 4RXEA 3Q30A 4GA3A 3BNXA 2AETA 3V66A 4LOBA 1N1BA 5IKAA 1HX9A 3SAEA 4RXCA 5DGMF 3KB9A 3KBKA 3MZVA 4KQSA 4E9ZA 5B02A 2Z4WA 3AQCB 4KWDA 5IKHA 4MC3A 4LLSA 3M01A 2RAHA 4RYPA 5B0IA 2F8ZF 4UMJA 5ERNA 3SDUA 4NFIF 5C05A 3ZMBA 5B01A 4PVXF 3KRFB 5JA0F 2E90A 1WMWA 1YQ7A 1YYTA 5A0JA 2F9KF 4DXJA 2OA6A 5IK0A 4F6VA 5B0LA 3WC9A 4LZ0A 2ONHA 3OACA 5E8HA 3NPRA 3ICKA 2ZCSA 3ZMCA 1RQJA 4H5CF 1KIYA 5JV2F 1N21A 3SDRA 3WCLA 5DW7A 3MAVA 3Q1OA 3BNYA 4NG6A 4XQRF 2FORA 1WL2A 4XQTF 4ZQ8A 3ACXA 3VJAA 4KPJA 3S9VA 4H5DF 3WCFA 4GP2A 4OMGA 1PS1A 1V4HA 3KROB 5DHIA 5DGNF 5ILIA 4OKMA 1V4JA 3WSAA 4WK5A 3WE9A 5IN8A 5DZ2A 5EATA 3ID0A 5HN7A 3ICMA 5E8KA 3WEFA 1YHKA 2EWGA 2OGDA 5DJRF 4DI5A 4FP4A 3UCAA 2E8TA 1VG4A 4KUXA 3WCIA 4LZCA 4OKZA 4HD1A 4H5EF 1VG6A 3CC9A 4L2XF 3V1XA 3N0GA 5IVGA 4LFGA 2Z7HA 4KVYA 5DIQF 3OACB 3P5PA 4P0WA 5ILYA 3WEGA 2ZY1A 2Q58A 5IMPA 2ZCOA 1WKZA 2E8WA 2QISA 2VF6A 3KRAB 3WEJA 1DGPA 5JV1F 2ZEUA 4OGUA 5IL8A 3VJ8A 1N23A 4F6XA 5E8LA 1DI1A 5ILKA 2J1OA 3OABA 4FJQA 4E9UA 1UBVA 4K10A 4N9UA 3ICZA 1RQIA 5EAUA 5DHKA 5AFXA 1UBWA 3WCGA 4LA6A 1HXGA 3VJEA 5I1UA 3WSBA 1VG7A 4KQ5A 4KQUA 3RBMA 2AZKA 2F7MF 2F92F 1YJ4A 3SDTA 4LXWA 3CP6A 3TFNA 3WCAA 1V4KA 3M02A 1YYRA 2I19A 1JFAA 3LOMA 3G4FA 3AQBB 1WL1A 4JXNA 1EZFA 3EZ3A 1YYSA 4NFKF 2ZEVA 3LJIA 4N1ZF 3LVSA 4DZWA 4MC8A 5ILHA 2Q9YA 4KPDA 5ER8A 4NKEA 2FTZA 5ILJA 3DYHA 4F62A 3Q2ZA 4DHDA 3OABB 1YYUA 3KRCA 1WY0A 2F94F 3WCEA 3N6KF 2Z4YA 2F89F 3LZ9A 5B00A 2Z4ZA 3PKOA 5EROA 5IK6A 2Z7IA 3N1VF 4Q23A 3TFVA 1UBXA 1N20A 4LLTA 3VJBA 3P8RA 2OPMA 4PVYF 5H9DA 4JYXA 2OPNA 5B03A 3B7LA 3NRIA 2Q80A 4JVJF 3N3LF 3VJCA 2AELA 3TC1A 3N45F 3WCBA 4QXSF 2E91A 2PS4A 3LDWA 1WL0A 3IBAA 4GAXA 1ZW5A 3QQVA 3ZL6A 3VJDA 3PYBA 3RYWA 4KVIA 4LUUA 4NKFA 3PDEA 5A0KA 3ZOUA 2PS7A 1WL3A 1V4EA 3Q2QA 2AEKA 3KRFA 3N46F 3P5RA 3WCMA 3AE0A 4NFJF 3N3DA 3SDQA 3WJKA 3S4JA 1VG2A 2E92A 5KSXF 3OYRA 5CG6A 3W7FA 3LEEA 2E95A 3ADZA 4KVDA 5DJVF 2PS6A 4EA1A 1HXAA 1HXCA 1HM7A 3WEKA 3WEIA 3QKCA 5EASA 1YHMA 3P41A 4LIXA 2O1OA 1YYQA 4KFAA 1N1ZA 4LPGF 3VJ9A 4JZXA 3LG5A 3LGKA 2Z50A 3P8LA 4LZ3A 3KRPA 3LLWA 5ERMA 2ZCRA 4DWGA 1YHLA 2E4OA 1UBYA 3NPKA 2ZCQA 3G4DA 1KIZA 2PS5A 3ICNA 3KROA 2PS8A 2P1CA 5ILZA 3WCJA 4KKMA 3WCDA 2Z52A 5A0IA 4OMHA 3WCCA 3ASXA 3NF2A 5DGSF 4MC0A 3PH7A 3EFQA 5HN9A 3M00A 3EGTA
chains in the Genus database with same CATH superfamily
4RXAA 5AELA 1N24A 2AZLA 3PYAA 3WEHA 1V4IA 2E94A 4EA0A 3RMGA 3IPIA 3LMDA 1YV5A 4RNQA 5HN8A 2ONGA 2E8VA 5B0JA 4LFVF 3LK5A 5JV0F 3M0GA 5B0MA 1FPSA 3KRAA 2J1PA 4XQSF 3N49F 5ILDA 4DWBA 1VG3A 1JFGA 2DH4A 3SDVA 3KRPB 3N5HF 4LTVA 2E8UA 5IMNA 3WCHA 4P0VA 3LSNA 4JXYA 4GP1A 3APZA 3N1WF 2F8CF 2E93A 2AZJA 4LTZA 4E1EA 2J5CA 2Q9ZA 3AQ0A 5JUZF 3RYEA 3DYFA 4QPFA 4DEMF 1N22A 5IM1A 4KK2A 2Z4XA 3TS7A 4LPHF 4EA2A 5DJPF 4KVWA 1RTRA 4LFEA 5AHUB 3ZCDA 3WJNA 4NUAA 4RXDA 2Z78A 5HNAA 1HM4A 2H8OA 5AYPA 5CG5A 3KRCB 3CKEA 5IK9A 4LA5A 2E8XA 5IMIA 3ACYA 5IL3A 3TFPA 3DYGA 3ACWA 3V1VA 3WJOA 3N0FA 5B0KA 3N5JF 3LGZB 2Z4VA 4P0XA 4JZBA 3M9UA 4RXEA 3Q30A 4GA3A 3BNXA 2AETA 3V66A 4LOBA 1N1BA 5IKAA 1HX9A 3SAEA 4RXCA 5DGMF 3KB9A 3KBKA 3MZVA 4KQSA 4E9ZA 5B02A 2Z4WA 3AQCB 4KWDA 5IKHA 4MC3A 4LLSA 3M01A 2RAHA 4RYPA 5B0IA 2F8ZF 4UMJA 5ERNA 3SDUA 4NFIF 5C05A 3ZMBA 5B01A 4PVXF 3KRFB 5JA0F 2E90A 1WMWA 1YQ7A 1YYTA 5A0JA 2F9KF 4DXJA 2OA6A 5IK0A 4F6VA 5B0LA 3WC9A 4LZ0A 2ONHA 3OACA 5E8HA 3NPRA 3ICKA 2ZCSA 3ZMCA 1RQJA 4H5CF 1KIYA 5JV2F 1N21A 3SDRA 3WCLA 5DW7A 3MAVA 3Q1OA 3BNYA 4NG6A 4XQRF 2FORA 1WL2A 4XQTF 4ZQ8A 3ACXA 3VJAA 4KPJA 3S9VA 4H5DF 3WCFA 4GP2A 4OMGA 1PS1A 1V4HA 3KROB 5DHIA 5DGNF 5ILIA 4OKMA 1V4JA 3WSAA 4WK5A 3WE9A 5IN8A 5DZ2A 5EATA 3ID0A 5HN7A 3ICMA 5E8KA 3WEFA 1YHKA 2EWGA 2OGDA 5DJRF 4DI5A 4FP4A 3UCAA 2E8TA 1VG4A 4KUXA 3WCIA 4LZCA 4OKZA 4HD1A 4H5EF 1VG6A 3CC9A 4L2XF 3V1XA 3N0GA 5IVGA 4LFGA 2Z7HA 4KVYA 5DIQF 3OACB 3P5PA 4P0WA 5ILYA 3WEGA 2ZY1A 2Q58A 5IMPA 2ZCOA 1WKZA 2E8WA 2QISA 2VF6A 3KRAB 3WEJA 1DGPA 5JV1F 2ZEUA 4OGUA 5IL8A 3VJ8A 1N23A 4F6XA 5E8LA 1DI1A 5ILKA 2J1OA 3OABA 4FJQA 4E9UA 1UBVA 4K10A 4N9UA 3ICZA 1RQIA 5EAUA 5DHKA 5AFXA 1UBWA 3WCGA 4LA6A 1HXGA 3VJEA 5I1UA 3WSBA 1VG7A 4KQ5A 4KQUA 3RBMA 2AZKA 2F7MF 2F92F 1YJ4A 3SDTA 4LXWA 3CP6A 3TFNA 3WCAA 1V4KA 3M02A 1YYRA 2I19A 1JFAA 3LOMA 3G4FA 3AQBB 1WL1A 4JXNA 1EZFA 3EZ3A 1YYSA 4NFKF 2ZEVA 3LJIA 4N1ZF 3LVSA 4DZWA 4MC8A 5ILHA 2Q9YA 4KPDA 5ER8A 4NKEA 2FTZA 5ILJA 3DYHA 4F62A 3Q2ZA 4DHDA 3OABB 1YYUA 3KRCA 1WY0A 2F94F 3WCEA 3N6KF 2Z4YA 2F89F 3LZ9A 5B00A 2Z4ZA 3PKOA 5EROA 5IK6A 2Z7IA 3N1VF 4Q23A 3TFVA 1UBXA 1N20A 4LLTA 3VJBA 3P8RA 2OPMA 4PVYF 5H9DA 4JYXA 2OPNA 5B03A 3B7LA 3NRIA 2Q80A 4JVJF 3N3LF 3VJCA 2AELA 3TC1A 3N45F 3WCBA 4QXSF 2E91A 2PS4A 3LDWA 1WL0A 3IBAA 4GAXA 1ZW5A 3QQVA 3ZL6A 3VJDA 3PYBA 3RYWA 4KVIA 4LUUA 4NKFA 3PDEA 5A0KA 3ZOUA 2PS7A 1WL3A 1V4EA 3Q2QA 2AEKA 3KRFA 3N46F 3P5RA 3WCMA 3AE0A 4NFJF 3N3DA 3SDQA 3WJKA 3S4JA 1VG2A 2E92A 5KSXF 3OYRA 5CG6A 3W7FA 3LEEA 2E95A 3ADZA 4KVDA 5DJVF 2PS6A 4EA1A 1HXAA 1HXCA 1HM7A 3WEKA 3WEIA 3QKCA 5EASA 1YHMA 3P41A 4LIXA 2O1OA 1YYQA 4KFAA 1N1ZA 4LPGF 3VJ9A 4JZXA 3LG5A 3LGKA 2Z50A 3P8LA 4LZ3A 3KRPA 3LLWA 5ERMA 2ZCRA 4DWGA 1YHLA 2E4OA 1UBYA 3NPKA 2ZCQA 3G4DA 1KIZA 2PS5A 3ICNA 3KROA 2PS8A 2P1CA 5ILZA 3WCJA 4KKMA 3WCDA 2Z52A 5A0IA 4OMHA 3WCCA 3ASXA 3NF2A 5DGSF 4MC0A 3PH7A 3EFQA 5HN9A 3M00A 3EGTA
chains in the Genus database with same CATH topology
4RXAA 5AELA 1N24A 2AZLA 3PYAA 3WEHA 1V4IA 2E94A 4EA0A 3RMGA 3IPIA 3LMDA 1YV5A 4RNQA 5HN8A 2ONGA 2E8VA 5B0JA 4LFVF 3LK5A 5JV0F 3M0GA 5B0MA 1FPSA 3KRAA 2J1PA 4XQSF 3N49F 5ILDA 4DWBA 1VG3A 1JFGA 2DH4A 3SDVA 3KRPB 3N5HF 4LTVA 2E8UA 5IMNA 3WCHA 4P0VA 3LSNA 4JXYA 4GP1A 3APZA 3N1WF 2F8CF 2E93A 2AZJA 4LTZA 4E1EA 2J5CA 2Q9ZA 3AQ0A 5JUZF 3RYEA 3DYFA 4QPFA 4DEMF 1N22A 5IM1A 4KK2A 2Z4XA 3TS7A 4LPHF 4EA2A 5DJPF 4KVWA 1RTRA 4LFEA 5AHUB 3ZCDA 3WJNA 4NUAA 4RXDA 2Z78A 5HNAA 1HM4A 2H8OA 5AYPA 5CG5A 3KRCB 3CKEA 5IK9A 4LA5A 2E8XA 5IMIA 3ACYA 5IL3A 3TFPA 3DYGA 3ACWA 3V1VA 3WJOA 3N0FA 5B0KA 3N5JF 3LGZB 2Z4VA 4P0XA 4JZBA 3M9UA 4RXEA 3Q30A 4GA3A 3BNXA 2AETA 3V66A 4LOBA 1N1BA 5IKAA 1HX9A 3SAEA 4RXCA 5DGMF 3KB9A 3KBKA 3MZVA 4KQSA 4E9ZA 5B02A 2Z4WA 3AQCB 4KWDA 5IKHA 4MC3A 4LLSA 3M01A 2RAHA 4RYPA 5B0IA 2F8ZF 4UMJA 5ERNA 3SDUA 4NFIF 5C05A 3ZMBA 5B01A 4PVXF 3KRFB 5JA0F 2E90A 1WMWA 1YQ7A 1YYTA 5A0JA 2F9KF 4DXJA 2OA6A 5IK0A 4F6VA 5B0LA 3WC9A 4LZ0A 2ONHA 3OACA 5E8HA 3NPRA 3ICKA 2ZCSA 3ZMCA 1RQJA 4H5CF 1KIYA 5JV2F 1N21A 3SDRA 3WCLA 5DW7A 3MAVA 3Q1OA 3BNYA 4NG6A 4XQRF 2FORA 1WL2A 4XQTF 4ZQ8A 3ACXA 3VJAA 4KPJA 3S9VA 4H5DF 3WCFA 4GP2A 4OMGA 1PS1A 1V4HA 3KROB 5DHIA 5DGNF 5ILIA 4OKMA 1V4JA 3WSAA 4WK5A 3WE9A 5IN8A 5DZ2A 5EATA 3ID0A 5HN7A 3ICMA 5E8KA 3WEFA 1YHKA 2EWGA 2OGDA 5DJRF 4DI5A 4FP4A 3UCAA 2E8TA 1VG4A 4KUXA 3WCIA 4LZCA 4OKZA 4HD1A 4H5EF 1VG6A 3CC9A 4L2XF 3V1XA 3N0GA 5IVGA 4LFGA 2Z7HA 4KVYA 5DIQF 3OACB 3P5PA 4P0WA 5ILYA 3WEGA 2ZY1A 2Q58A 5IMPA 2ZCOA 1WKZA 2E8WA 2QISA 2VF6A 3KRAB 3WEJA 1DGPA 5JV1F 2ZEUA 4OGUA 5IL8A 3VJ8A 1N23A 4F6XA 5E8LA 1DI1A 5ILKA 2J1OA 3OABA 4FJQA 4E9UA 1UBVA 4K10A 4N9UA 3ICZA 1RQIA 5EAUA 5DHKA 5AFXA 1UBWA 3WCGA 4LA6A 1HXGA 3VJEA 5I1UA 3WSBA 1VG7A 4KQ5A 4KQUA 3RBMA 2AZKA 2F7MF 2F92F 1YJ4A 3SDTA 4LXWA 3CP6A 3TFNA 3WCAA 1V4KA 3M02A 1YYRA 2I19A 1JFAA 3LOMA 3G4FA 3AQBB 1WL1A 4JXNA 1EZFA 3EZ3A 1YYSA 4NFKF 2ZEVA 3LJIA 4N1ZF 3LVSA 4DZWA 4MC8A 5ILHA 2Q9YA 4KPDA 5ER8A 4NKEA 2FTZA 5ILJA 3DYHA 4F62A 3Q2ZA 4DHDA 3OABB 1YYUA 3KRCA 1WY0A 2F94F 3WCEA 3N6KF 2Z4YA 2F89F 3LZ9A 5B00A 2Z4ZA 3PKOA 5EROA 5IK6A 2Z7IA 3N1VF 4Q23A 3TFVA 1UBXA 1N20A 4LLTA 3VJBA 3P8RA 2OPMA 4PVYF 5H9DA 4JYXA 2OPNA 5B03A 3B7LA 3NRIA 2Q80A 4JVJF 3N3LF 3VJCA 2AELA 3TC1A 3N45F 3WCBA 4QXSF 2E91A 2PS4A 3LDWA 1WL0A 3IBAA 4GAXA 1ZW5A 3QQVA 3ZL6A 3VJDA 3PYBA 3RYWA 4KVIA 4LUUA 4NKFA 3PDEA 5A0KA 3ZOUA 2PS7A 1WL3A 1V4EA 3Q2QA 2AEKA 3KRFA 3N46F 3P5RA 3WCMA 3AE0A 4NFJF 3N3DA 3SDQA 3WJKA 3S4JA 1VG2A 2E92A 5KSXF 3OYRA 5CG6A 3W7FA 3LEEA 2E95A 3ADZA 4KVDA 5DJVF 2PS6A 4EA1A 1HXAA 1HXCA 1HM7A 3WEKA 3WEIA 3QKCA 5EASA 1YHMA 3P41A 4LIXA 2O1OA 1YYQA 4KFAA 1N1ZA 4LPGF 3VJ9A 4JZXA 3LG5A 3LGKA 2Z50A 3P8LA 4LZ3A 3KRPA 3LLWA 5ERMA 2ZCRA 4DWGA 1YHLA 2E4OA 1UBYA 3NPKA 2ZCQA 3G4DA 1KIZA 2PS5A 3ICNA 3KROA 2PS8A 2P1CA 5ILZA 3WCJA 4KKMA 3WCDA 2Z52A 5A0IA 4OMHA 3WCCA 3ASXA 3NF2A 5DGSF 4MC0A 3PH7A 3EFQA 5HN9A 3M00A 3EGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RXA A;  5AEL A;  1N24 A;  2AZL A;  3PYA A;  3WEH A;  1V4I A;  2E94 A;  4EA0 A;  3RMG A;  3IPI A;  3LMD A;  1YV5 A;  4RNQ A;  5HN8 A;  2ONG A;  2E8V A;  5B0J A;  4LFV F;  3LK5 A;  5JV0 F;  3M0G A;  5B0M A;  1FPS A;  3KRA A;  2J1P A;  4XQS F;  3N49 F;  5ILD A;  4DWB A;  1VG3 A;  1JFG A;  2DH4 A;  3SDV A;  3KRP B;  3N5H F;  4LTV A;  2E8U A;  5IMN A;  3WCH A;  4P0V A;  3LSN A;  4JXY A;  4GP1 A;  3APZ A;  3N1W F;  2F8C F;  2E93 A;  2AZJ A;  4LTZ A;  4E1E A;  2J5C A;  2Q9Z A;  3AQ0 A;  5JUZ F;  3RYE A;  3DYF A;  4QPF A;  4DEM F;  1N22 A;  5IM1 A;  4KK2 A;  2Z4X A;  3TS7 A;  4LPH F;  4EA2 A;  5DJP F;  4KVW A;  1RTR A;  4LFE A;  5AHU B;  3ZCD A;  3WJN A;  4NUA A;  4RXD A;  2Z78 A;  5HNA A;  1HM4 A;  2H8O A;  5AYP A;  5CG5 A;  3KRC B;  3CKE A;  5IK9 A;  4LA5 A;  2E8X A;  5IMI A;  3ACY A;  5IL3 A;  3TFP A;  3DYG A;  3ACW A;  3V1V A;  3WJO A;  3N0F A;  5B0K A;  3N5J F;  3LGZ B;  2Z4V A;  4P0X A;  4JZB A;  3M9U A;  4RXE A;  3Q30 A;  4GA3 A;  3BNX A;  2AET A;  3V66 A;  4LOB A;  1N1B A;  5IKA A;  1HX9 A;  3SAE A;  4RXC A;  5DGM F;  3KB9 A;  3KBK A;  3MZV A;  4KQS A;  4E9Z A;  5B02 A;  2Z4W A;  3AQC B;  4KWD A;  5IKH A;  4MC3 A;  4LLS A;  3M01 A;  2RAH A;  4RYP A;  5B0I A;  2F8Z F;  4UMJ A;  5ERN A;  3SDU A;  4NFI F;  5C05 A;  3ZMB A;  5B01 A;  4PVX F;  3KRF B;  5JA0 F;  2E90 A;  1WMW A;  1YQ7 A;  1YYT A;  5A0J A;  2F9K F;  4DXJ A;  2OA6 A;  5IK0 A;  4F6V A;  5B0L A;  3WC9 A;  4LZ0 A;  2ONH A;  3OAC A;  5E8H A;  3NPR A;  3ICK A;  2ZCS A;  3ZMC A;  1RQJ A;  4H5C F;  1KIY A;  5JV2 F;  1N21 A;  3SDR A;  3WCL A;  5DW7 A;  3MAV A;  3Q1O A;  3BNY A;  4NG6 A;  4XQR F;  2FOR A;  1WL2 A;  4XQT F;  4ZQ8 A;  3ACX A;  3VJA A;  4KPJ A;  3S9V A;  4H5D F;  3WCF A;  4GP2 A;  4OMG A;  1PS1 A;  1V4H A;  3KRO B;  5DHI A;  5DGN F;  5ILI A;  4OKM A;  1V4J A;  3WSA A;  4WK5 A;  3WE9 A;  5IN8 A;  5DZ2 A;  5EAT A;  3ID0 A;  5HN7 A;  3ICM A;  5E8K A;  3WEF A;  1YHK A;  2EWG A;  2OGD A;  5DJR F;  4DI5 A;  4FP4 A;  3UCA A;  2E8T A;  1VG4 A;  4KUX A;  3WCI A;  4LZC A;  4OKZ A;  4HD1 A;  4H5E F;  1VG6 A;  3CC9 A;  4L2X F;  3V1X A;  3N0G A;  5IVG A;  4LFG A;  2Z7H A;  4KVY A;  5DIQ F;  3OAC B;  3P5P A;  4P0W A;  5ILY A;  3WEG A;  2ZY1 A;  2Q58 A;  5IMP A;  2ZCO A;  1WKZ A;  2E8W A;  2QIS A;  2VF6 A;  3KRA B;  3WEJ A;  1DGP A;  5JV1 F;  2ZEU A;  4OGU A;  5IL8 A;  3VJ8 A;  1N23 A;  4F6X A;  5E8L A;  1DI1 A;  5ILK A;  2J1O A;  3OAB A;  4FJQ A;  4E9U A;  1UBV A;  4K10 A;  4N9U A;  3ICZ A;  1RQI A;  5EAU A;  5DHK A;  5AFX A;  1UBW A;  3WCG A;  4LA6 A;  1HXG A;  3VJE A;  5I1U A;  3WSB A;  1VG7 A;  4KQ5 A;  4KQU A;  3RBM A;  2AZK A;  2F7M F;  2F92 F;  1YJ4 A;  3SDT A;  4LXW A;  3CP6 A;  3TFN A;  3WCA A;  1V4K A;  3M02 A;  1YYR A;  2I19 A;  1JFA A;  3LOM A;  3G4F A;  3AQB B;  1WL1 A;  4JXN A;  1EZF A;  3EZ3 A;  1YYS A;  4NFK F;  2ZEV A;  3LJI A;  4N1Z F;  3LVS A;  4DZW A;  4MC8 A;  5ILH A;  2Q9Y A;  4KPD A;  5ER8 A;  4NKE A;  2FTZ A;  5ILJ A;  3DYH A;  4F62 A;  3Q2Z A;  4DHD A;  3OAB B;  1YYU A;  3KRC A;  1WY0 A;  2F94 F;  3WCE A;  3N6K F;  2Z4Y A;  2F89 F;  3LZ9 A;  5B00 A;  2Z4Z A;  3PKO A;  5ERO A;  5IK6 A;  2Z7I A;  3N1V F;  4Q23 A;  3TFV A;  1UBX A;  1N20 A;  4LLT A;  3VJB A;  3P8R A;  2OPM A;  4PVY F;  5H9D A;  4JYX A;  2OPN A;  5B03 A;  3B7L A;  3NRI A;  2Q80 A;  4JVJ F;  3N3L F;  3VJC A;  2AEL A;  3TC1 A;  3N45 F;  3WCB A;  4QXS F;  2E91 A;  2PS4 A;  3LDW A;  1WL0 A;  3IBA A;  4GAX A;  1ZW5 A;  3QQV A;  3ZL6 A;  3VJD A;  3PYB A;  3RYW A;  4KVI A;  4LUU A;  4NKF A;  3PDE A;  5A0K A;  3ZOU A;  2PS7 A;  1WL3 A;  1V4E A;  3Q2Q A;  2AEK A;  3KRF A;  3N46 F;  3P5R A;  3WCM A;  3AE0 A;  4NFJ F;  3N3D A;  3SDQ A;  3WJK A;  3S4J A;  1VG2 A;  2E92 A;  5KSX F;  3OYR A;  5CG6 A;  3W7F A;  3LEE A;  2E95 A;  3ADZ A;  4KVD A;  5DJV F;  2PS6 A;  4EA1 A;  1HXA A;  1HXC A;  1HM7 A;  3WEK A;  3WEI A;  3QKC A;  5EAS A;  1YHM A;  3P41 A;  4LIX A;  2O1O A;  1YYQ A;  4KFA A;  1N1Z A;  4LPG F;  3VJ9 A;  4JZX A;  3LG5 A;  3LGK A;  2Z50 A;  3P8L A;  4LZ3 A;  3KRP A;  3LLW A;  5ERM A;  2ZCR A;  4DWG A;  1YHL A;  2E4O A;  1UBY A;  3NPK A;  2ZCQ A;  3G4D A;  1KIZ A;  2PS5 A;  3ICN A;  3KRO A;  2PS8 A;  2P1C A;  5ILZ A;  3WCJ A;  4KKM A;  3WCD A;  2Z52 A;  5A0I A;  4OMH A;  3WCC A;  3ASX A;  3NF2 A;  5DGS F;  4MC0 A;  3PH7 A;  3EFQ A;  5HN9 A;  3M00 A;  3EGT A; 
#chains in the Genus database with same CATH topology
 4RXA A;  5AEL A;  1N24 A;  2AZL A;  3PYA A;  3WEH A;  1V4I A;  2E94 A;  4EA0 A;  3RMG A;  3IPI A;  3LMD A;  1YV5 A;  4RNQ A;  5HN8 A;  2ONG A;  2E8V A;  5B0J A;  4LFV F;  3LK5 A;  5JV0 F;  3M0G A;  5B0M A;  1FPS A;  3KRA A;  2J1P A;  4XQS F;  3N49 F;  5ILD A;  4DWB A;  1VG3 A;  1JFG A;  2DH4 A;  3SDV A;  3KRP B;  3N5H F;  4LTV A;  2E8U A;  5IMN A;  3WCH A;  4P0V A;  3LSN A;  4JXY A;  4GP1 A;  3APZ A;  3N1W F;  2F8C F;  2E93 A;  2AZJ A;  4LTZ A;  4E1E A;  2J5C A;  2Q9Z A;  3AQ0 A;  5JUZ F;  3RYE A;  3DYF A;  4QPF A;  4DEM F;  1N22 A;  5IM1 A;  4KK2 A;  2Z4X A;  3TS7 A;  4LPH F;  4EA2 A;  5DJP F;  4KVW A;  1RTR A;  4LFE A;  5AHU B;  3ZCD A;  3WJN A;  4NUA A;  4RXD A;  2Z78 A;  5HNA A;  1HM4 A;  2H8O A;  5AYP A;  5CG5 A;  3KRC B;  3CKE A;  5IK9 A;  4LA5 A;  2E8X A;  5IMI A;  3ACY A;  5IL3 A;  3TFP A;  3DYG A;  3ACW A;  3V1V A;  3WJO A;  3N0F A;  5B0K A;  3N5J F;  3LGZ B;  2Z4V A;  4P0X A;  4JZB A;  3M9U A;  4RXE A;  3Q30 A;  4GA3 A;  3BNX A;  2AET A;  3V66 A;  4LOB A;  1N1B A;  5IKA A;  1HX9 A;  3SAE A;  4RXC A;  5DGM F;  3KB9 A;  3KBK A;  3MZV A;  4KQS A;  4E9Z A;  5B02 A;  2Z4W A;  3AQC B;  4KWD A;  5IKH A;  4MC3 A;  4LLS A;  3M01 A;  2RAH A;  4RYP A;  5B0I A;  2F8Z F;  4UMJ A;  5ERN A;  3SDU A;  4NFI F;  5C05 A;  3ZMB A;  5B01 A;  4PVX F;  3KRF B;  5JA0 F;  2E90 A;  1WMW A;  1YQ7 A;  1YYT A;  5A0J A;  2F9K F;  4DXJ A;  2OA6 A;  5IK0 A;  4F6V A;  5B0L A;  3WC9 A;  4LZ0 A;  2ONH A;  3OAC A;  5E8H A;  3NPR A;  3ICK A;  2ZCS A;  3ZMC A;  1RQJ A;  4H5C F;  1KIY A;  5JV2 F;  1N21 A;  3SDR A;  3WCL A;  5DW7 A;  3MAV A;  3Q1O A;  3BNY A;  4NG6 A;  4XQR F;  2FOR A;  1WL2 A;  4XQT F;  4ZQ8 A;  3ACX A;  3VJA A;  4KPJ A;  3S9V A;  4H5D F;  3WCF A;  4GP2 A;  4OMG A;  1PS1 A;  1V4H A;  3KRO B;  5DHI A;  5DGN F;  5ILI A;  4OKM A;  1V4J A;  3WSA A;  4WK5 A;  3WE9 A;  5IN8 A;  5DZ2 A;  5EAT A;  3ID0 A;  5HN7 A;  3ICM A;  5E8K A;  3WEF A;  1YHK A;  2EWG A;  2OGD A;  5DJR F;  4DI5 A;  4FP4 A;  3UCA A;  2E8T A;  1VG4 A;  4KUX A;  3WCI A;  4LZC A;  4OKZ A;  4HD1 A;  4H5E F;  1VG6 A;  3CC9 A;  4L2X F;  3V1X A;  3N0G A;  5IVG A;  4LFG A;  2Z7H A;  4KVY A;  5DIQ F;  3OAC B;  3P5P A;  4P0W A;  5ILY A;  3WEG A;  2ZY1 A;  2Q58 A;  5IMP A;  2ZCO A;  1WKZ A;  2E8W A;  2QIS A;  2VF6 A;  3KRA B;  3WEJ A;  1DGP A;  5JV1 F;  2ZEU A;  4OGU A;  5IL8 A;  3VJ8 A;  1N23 A;  4F6X A;  5E8L A;  1DI1 A;  5ILK A;  2J1O A;  3OAB A;  4FJQ A;  4E9U A;  1UBV A;  4K10 A;  4N9U A;  3ICZ A;  1RQI A;  5EAU A;  5DHK A;  5AFX A;  1UBW A;  3WCG A;  4LA6 A;  1HXG A;  3VJE A;  5I1U A;  3WSB A;  1VG7 A;  4KQ5 A;  4KQU A;  3RBM A;  2AZK A;  2F7M F;  2F92 F;  1YJ4 A;  3SDT A;  4LXW A;  3CP6 A;  3TFN A;  3WCA A;  1V4K A;  3M02 A;  1YYR A;  2I19 A;  1JFA A;  3LOM A;  3G4F A;  3AQB B;  1WL1 A;  4JXN A;  1EZF A;  3EZ3 A;  1YYS A;  4NFK F;  2ZEV A;  3LJI A;  4N1Z F;  3LVS A;  4DZW A;  4MC8 A;  5ILH A;  2Q9Y A;  4KPD A;  5ER8 A;  4NKE A;  2FTZ A;  5ILJ A;  3DYH A;  4F62 A;  3Q2Z A;  4DHD A;  3OAB B;  1YYU A;  3KRC A;  1WY0 A;  2F94 F;  3WCE A;  3N6K F;  2Z4Y A;  2F89 F;  3LZ9 A;  5B00 A;  2Z4Z A;  3PKO A;  5ERO A;  5IK6 A;  2Z7I A;  3N1V F;  4Q23 A;  3TFV A;  1UBX A;  1N20 A;  4LLT A;  3VJB A;  3P8R A;  2OPM A;  4PVY F;  5H9D A;  4JYX A;  2OPN A;  5B03 A;  3B7L A;  3NRI A;  2Q80 A;  4JVJ F;  3N3L F;  3VJC A;  2AEL A;  3TC1 A;  3N45 F;  3WCB A;  4QXS F;  2E91 A;  2PS4 A;  3LDW A;  1WL0 A;  3IBA A;  4GAX A;  1ZW5 A;  3QQV A;  3ZL6 A;  3VJD A;  3PYB A;  3RYW A;  4KVI A;  4LUU A;  4NKF A;  3PDE A;  5A0K A;  3ZOU A;  2PS7 A;  1WL3 A;  1V4E A;  3Q2Q A;  2AEK A;  3KRF A;  3N46 F;  3P5R A;  3WCM A;  3AE0 A;  4NFJ F;  3N3D A;  3SDQ A;  3WJK A;  3S4J A;  1VG2 A;  2E92 A;  5KSX F;  3OYR A;  5CG6 A;  3W7F A;  3LEE A;  2E95 A;  3ADZ A;  4KVD A;  5DJV F;  2PS6 A;  4EA1 A;  1HXA A;  1HXC A;  1HM7 A;  3WEK A;  3WEI A;  3QKC A;  5EAS A;  1YHM A;  3P41 A;  4LIX A;  2O1O A;  1YYQ A;  4KFA A;  1N1Z A;  4LPG F;  3VJ9 A;  4JZX A;  3LG5 A;  3LGK A;  2Z50 A;  3P8L A;  4LZ3 A;  3KRP A;  3LLW A;  5ERM A;  2ZCR A;  4DWG A;  1YHL A;  2E4O A;  1UBY A;  3NPK A;  2ZCQ A;  3G4D A;  1KIZ A;  2PS5 A;  3ICN A;  3KRO A;  2PS8 A;  2P1C A;  5ILZ A;  3WCJ A;  4KKM A;  3WCD A;  2Z52 A;  5A0I A;  4OMH A;  3WCC A;  3ASX A;  3NF2 A;  5DGS F;  4MC0 A;  3PH7 A;  3EFQ A;  5HN9 A;  3M00 A;  3EGT A; 
#chains in the Genus database with same CATH homology
 4RXA A;  5AEL A;  1N24 A;  2AZL A;  3PYA A;  3WEH A;  1V4I A;  2E94 A;  4EA0 A;  3RMG A;  3IPI A;  3LMD A;  1YV5 A;  4RNQ A;  5HN8 A;  2ONG A;  2E8V A;  5B0J A;  4LFV F;  3LK5 A;  5JV0 F;  3M0G A;  5B0M A;  1FPS A;  3KRA A;  2J1P A;  4XQS F;  3N49 F;  5ILD A;  4DWB A;  1VG3 A;  1JFG A;  2DH4 A;  3SDV A;  3KRP B;  3N5H F;  4LTV A;  2E8U A;  5IMN A;  3WCH A;  4P0V A;  3LSN A;  4JXY A;  4GP1 A;  3APZ A;  3N1W F;  2F8C F;  2E93 A;  2AZJ A;  4LTZ A;  4E1E A;  2J5C A;  2Q9Z A;  3AQ0 A;  5JUZ F;  3RYE A;  3DYF A;  4QPF A;  4DEM F;  1N22 A;  5IM1 A;  4KK2 A;  2Z4X A;  3TS7 A;  4LPH F;  4EA2 A;  5DJP F;  4KVW A;  1RTR A;  4LFE A;  5AHU B;  3ZCD A;  3WJN A;  4NUA A;  4RXD A;  2Z78 A;  5HNA A;  1HM4 A;  2H8O A;  5AYP A;  5CG5 A;  3KRC B;  3CKE A;  5IK9 A;  4LA5 A;  2E8X A;  5IMI A;  3ACY A;  5IL3 A;  3TFP A;  3DYG A;  3ACW A;  3V1V A;  3WJO A;  3N0F A;  5B0K A;  3N5J F;  3LGZ B;  2Z4V A;  4P0X A;  4JZB A;  3M9U A;  4RXE A;  3Q30 A;  4GA3 A;  3BNX A;  2AET A;  3V66 A;  4LOB A;  1N1B A;  5IKA A;  1HX9 A;  3SAE A;  4RXC A;  5DGM F;  3KB9 A;  3KBK A;  3MZV A;  4KQS A;  4E9Z A;  5B02 A;  2Z4W A;  3AQC B;  4KWD A;  5IKH A;  4MC3 A;  4LLS A;  3M01 A;  2RAH A;  4RYP A;  5B0I A;  2F8Z F;  4UMJ A;  5ERN A;  3SDU A;  4NFI F;  5C05 A;  3ZMB A;  5B01 A;  4PVX F;  3KRF B;  5JA0 F;  2E90 A;  1WMW A;  1YQ7 A;  1YYT A;  5A0J A;  2F9K F;  4DXJ A;  2OA6 A;  5IK0 A;  4F6V A;  5B0L A;  3WC9 A;  4LZ0 A;  2ONH A;  3OAC A;  5E8H A;  3NPR A;  3ICK A;  2ZCS A;  3ZMC A;  1RQJ A;  4H5C F;  1KIY A;  5JV2 F;  1N21 A;  3SDR A;  3WCL A;  5DW7 A;  3MAV A;  3Q1O A;  3BNY A;  4NG6 A;  4XQR F;  2FOR A;  1WL2 A;  4XQT F;  4ZQ8 A;  3ACX A;  3VJA A;  4KPJ A;  3S9V A;  4H5D F;  3WCF A;  4GP2 A;  4OMG A;  1PS1 A;  1V4H A;  3KRO B;  5DHI A;  5DGN F;  5ILI A;  4OKM A;  1V4J A;  3WSA A;  4WK5 A;  3WE9 A;  5IN8 A;  5DZ2 A;  5EAT A;  3ID0 A;  5HN7 A;  3ICM A;  5E8K A;  3WEF A;  1YHK A;  2EWG A;  2OGD A;  5DJR F;  4DI5 A;  4FP4 A;  3UCA A;  2E8T A;  1VG4 A;  4KUX A;  3WCI A;  4LZC A;  4OKZ A;  4HD1 A;  4H5E F;  1VG6 A;  3CC9 A;  4L2X F;  3V1X A;  3N0G A;  5IVG A;  4LFG A;  2Z7H A;  4KVY A;  5DIQ F;  3OAC B;  3P5P A;  4P0W A;  5ILY A;  3WEG A;  2ZY1 A;  2Q58 A;  5IMP A;  2ZCO A;  1WKZ A;  2E8W A;  2QIS A;  2VF6 A;  3KRA B;  3WEJ A;  1DGP A;  5JV1 F;  2ZEU A;  4OGU A;  5IL8 A;  3VJ8 A;  1N23 A;  4F6X A;  5E8L A;  1DI1 A;  5ILK A;  2J1O A;  3OAB A;  4FJQ A;  4E9U A;  1UBV A;  4K10 A;  4N9U A;  3ICZ A;  1RQI A;  5EAU A;  5DHK A;  5AFX A;  1UBW A;  3WCG A;  4LA6 A;  1HXG A;  3VJE A;  5I1U A;  3WSB A;  1VG7 A;  4KQ5 A;  4KQU A;  3RBM A;  2AZK A;  2F7M F;  2F92 F;  1YJ4 A;  3SDT A;  4LXW A;  3CP6 A;  3TFN A;  3WCA A;  1V4K A;  3M02 A;  1YYR A;  2I19 A;  1JFA A;  3LOM A;  3G4F A;  3AQB B;  1WL1 A;  4JXN A;  1EZF A;  3EZ3 A;  1YYS A;  4NFK F;  2ZEV A;  3LJI A;  4N1Z F;  3LVS A;  4DZW A;  4MC8 A;  5ILH A;  2Q9Y A;  4KPD A;  5ER8 A;  4NKE A;  2FTZ A;  5ILJ A;  3DYH A;  4F62 A;  3Q2Z A;  4DHD A;  3OAB B;  1YYU A;  3KRC A;  1WY0 A;  2F94 F;  3WCE A;  3N6K F;  2Z4Y A;  2F89 F;  3LZ9 A;  5B00 A;  2Z4Z A;  3PKO A;  5ERO A;  5IK6 A;  2Z7I A;  3N1V F;  4Q23 A;  3TFV A;  1UBX A;  1N20 A;  4LLT A;  3VJB A;  3P8R A;  2OPM A;  4PVY F;  5H9D A;  4JYX A;  2OPN A;  5B03 A;  3B7L A;  3NRI A;  2Q80 A;  4JVJ F;  3N3L F;  3VJC A;  2AEL A;  3TC1 A;  3N45 F;  3WCB A;  4QXS F;  2E91 A;  2PS4 A;  3LDW A;  1WL0 A;  3IBA A;  4GAX A;  1ZW5 A;  3QQV A;  3ZL6 A;  3VJD A;  3PYB A;  3RYW A;  4KVI A;  4LUU A;  4NKF A;  3PDE A;  5A0K A;  3ZOU A;  2PS7 A;  1WL3 A;  1V4E A;  3Q2Q A;  2AEK A;  3KRF A;  3N46 F;  3P5R A;  3WCM A;  3AE0 A;  4NFJ F;  3N3D A;  3SDQ A;  3WJK A;  3S4J A;  1VG2 A;  2E92 A;  5KSX F;  3OYR A;  5CG6 A;  3W7F A;  3LEE A;  2E95 A;  3ADZ A;  4KVD A;  5DJV F;  2PS6 A;  4EA1 A;  1HXA A;  1HXC A;  1HM7 A;  3WEK A;  3WEI A;  3QKC A;  5EAS A;  1YHM A;  3P41 A;  4LIX A;  2O1O A;  1YYQ A;  4KFA A;  1N1Z A;  4LPG F;  3VJ9 A;  4JZX A;  3LG5 A;  3LGK A;  2Z50 A;  3P8L A;  4LZ3 A;  3KRP A;  3LLW A;  5ERM A;  2ZCR A;  4DWG A;  1YHL A;  2E4O A;  1UBY A;  3NPK A;  2ZCQ A;  3G4D A;  1KIZ A;  2PS5 A;  3ICN A;  3KRO A;  2PS8 A;  2P1C A;  5ILZ A;  3WCJ A;  4KKM A;  3WCD A;  2Z52 A;  5A0I A;  4OMH A;  3WCC A;  3ASX A;  3NF2 A;  5DGS F;  4MC0 A;  3PH7 A;  3EFQ A;  5HN9 A;  3M00 A;  3EGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...