4E9UA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with a thiocyanate inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 116
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4e9uA00
3AE0A 1N20A 3LMDA 1YYRA 1V4JA 5DIQF 2VF6A 3LG5A 1N1ZA 1WL3A 2AZKA 2O1OA 5H9DA 3W7FA 1VG2A 1KIYA 1HXGA 3KBKA 1WL0A 1PS1A 4OKZA 4KQSA 3RYEA 1JFGA 3DYFA 4OKMA 2PS8A 2OGDA 3NF2A 2J5CA 1YHMA 3KRPB 5A0JA 2E93A 4DWBA 3NRIA 2ZEVA 3TC1A 1VG3A 3TS7A 5JV2F 5HN8A 3WEKA 3VJAA 3KB9A 3LOMA 3MAVA 2Q9ZA 1KIZA 2P1CA 3OACA 2OA6A 4LIXA 5B03A 2E90A 3Q30A 4JXNA 4L2XF 4LOBA 4LTVA 3PKOA 5DJRF 1HXAA 1WL1A 3P41A 2H8OA 3KRFB 2Q58A 4F6VA 4GA3A 3OABB 4UMJA 4LZ0A 1ZW5A 4E9ZA 4KVDA 2F9KF 3LSNA 1YQ7A 5IK9A 4P0XA 3M9UA 2E8XA 3VJ9A 3RBMA 4LTZA 3LK5A 2Q80A 2E8VA 4NUAA 5DHIA 3AQBB 4H5CF 4OGUA 3KRPA 5IKAA 3V66A 3ZMBA 3IPIA 5HNAA 5HN7A 3CKEA 4NKFA 5JA0F 2AETA 1V4HA 2ONGA 5DGMF 3V1VA 2E4OA 1DGPA 3RYWA 3NPRA 3ZCDA 2PS7A 4OMHA 1RTRA 5KSXF 2E8WA 3ZMCA 5ERMA 1WY0A 5AFXA 3ICMA 4PVXF 3DYHA 1UBWA 2E8TA 3N5HF 4LPHF 2EWGA 4EA2A 3AQCB 1WKZA 3ASXA 5JV1F 2Z4XA 2Z52A 3M01A 5AELA 4N1ZF 5B00A 5DJPF 3QKCA 1HX9A 3AQ0A 4LLTA 4DZWA 3TFPA 3Q1OA 3M00A 4DXJA 3N49F 3N46F 3ZOUA 1YHLA 1V4KA 2AELA 4KKMA 1YHKA 5ILHA 5ILDA 5IM1A 3M02A 4DI5A 3ICNA 2RAHA 4NFKF 3WEGA 3N1WF 3N3LF 4JXYA 5B0MA 3WEFA 3IBAA 3P8LA 4PVYF 5DW7A 1FPSA 3WCFA 4KWDA 1YYSA 4MC8A 5A0IA 3G4FA 5CG5A 3PYBA 3N5JF 3WCLA 5E8HA 3S9VA 4F6XA 5IVGA 3ACYA 1WMWA 3KRCB 3ACXA 5EROA 5ILYA 3LGKA 2Z78A 3WEIA 5ER8A 4RYPA 3LJIA 5A0KA 3VJ8A 3VJDA 5B02A 3APZA 3WE9A 2I19A 3WEHA 2Z7HA 3LLWA 1YYTA 4JZXA 3ICKA 1N23A 4KK2A 1V4EA 3WCCA 2Z4YA 3Q2QA 2OPMA 2F94F 3VJBA 4E1EA 4H5EF 5DHKA 4KFAA 4KQ5A 4WK5A 4K10A 3N0FA 4MC0A 3WSBA 3DYGA 3WCIA 3WCMA 3WEJA 1N21A 4H5DF 5IMNA 5C05A 2Z7IA 4JVJF 3WJNA 4LA6A 4QXSF 3PDEA 3LVSA 5DZ2A 1VG6A 3N1VF 4LLSA 3VJCA 5ILJA 5DJVF 4P0WA 1YV5A 3WCJA 5DGSF 4LFEA 3Q2ZA 3WC9A 3TFVA 4N9UA 4E9UA 4GP1A 3KRCA 5JV0F 4RXCA 4QPFA 5IK0A 2Z4ZA 2Z4VA 3QQVA 2DH4A 4Q23A 5B0KA 1N24A 2Q9YA 4LUUA 5AHUB 5B0IA 3KRFA 4OMGA 3OABA 4LZCA 1VG4A 3N45F 5IL8A 3EZ3A 3WCEA 2ONHA 3WCBA 4LA5A 3OACB 3EFQA 4KPDA 2PS5A 1N22A 1N1BA 1HM4A 3SDUA 2FORA 4KQUA 3P5RA 5IMPA 3MZVA 4KUXA 2F92F 4KVYA 2ZY1A 2F8CF 2F8ZF 3VJEA 5I1UA 3TFNA 3LZ9A 4FP4A 5IK6A 2Z4WA 3LDWA 3KROB 3G4DA 3V1XA 1V4IA 2ZEUA 3WCAA 5DGNF 2ZCRA 4EA0A 3UCAA 2E94A 5EATA 3N3DA 3KRAB 4NG6A 4DEMF 4GAXA 2J1OA 3P5PA 5AYPA 1EZFA 5IKHA 3N0GA 3BNYA 3NPKA 2FTZA 4FJQA 5EAUA 3WCGA 4P0VA 2E92A 2AZJA 4NKEA 4NFIF 1HXCA 1WL2A 5IL3A 3WJOA 3SDQA 4EA1A 4MC3A 5ILZA 3SDVA 1JFAA 3SAEA 1YYQA 4HD1A 5B0LA 3WCDA 1YJ4A 4LZ3A 4ZQ8A 2ZCSA 2PS4A 3ACWA 4RNQA 5ERNA 4KVWA 5E8KA 1RQIA 3N6KF 4LXWA 4KVIA 1HM7A 3KROA 1UBXA 3ICZA 3ADZA 3ID0A 3RMGA 2QISA 3S4JA 4LFGA 4XQTF 4F62A 3ZL6A 2F7MF 4DHDA 5EASA 2AZLA 4JYXA 3PYAA 5HN9A 3KRAA 3SDTA 3BNXA 3WSAA 2F89F 5CG6A 3WCHA 1DI1A 4NFJF 5B0JA 4XQRF 2Z50A 4DWGA 1VG7A 4RXAA 3WJKA 3P8RA 4RXDA 1UBYA 3LEEA 3SDRA 1UBVA 2E91A 2OPNA 3CP6A 2E95A 4JZBA 5E8LA 3OYRA 3PH7A 4RXEA 5ILKA 5IMIA 1YYUA 3M0GA 2AEKA 3CC9A 1RQJA 4LPGF 5B01A 5ILIA 4XQSF 3B7LA 5IN8A 2J1PA 2E8UA 2ZCOA 3LGZB 5JUZF 4LFVF 3EGTA 4KPJA 4GP2A 2ZCQA 2PS6A
chains in the Genus database with same CATH superfamily
3AE0A 1N20A 3LMDA 1YYRA 1V4JA 5DIQF 2VF6A 3LG5A 1N1ZA 1WL3A 2AZKA 2O1OA 5H9DA 3W7FA 1VG2A 1KIYA 1HXGA 3KBKA 1WL0A 1PS1A 4OKZA 4KQSA 3RYEA 1JFGA 3DYFA 4OKMA 2PS8A 2OGDA 3NF2A 2J5CA 1YHMA 3KRPB 5A0JA 2E93A 4DWBA 3NRIA 2ZEVA 3TC1A 1VG3A 3TS7A 5JV2F 5HN8A 3WEKA 3VJAA 3KB9A 3LOMA 3MAVA 2Q9ZA 1KIZA 2P1CA 3OACA 2OA6A 4LIXA 5B03A 2E90A 3Q30A 4JXNA 4L2XF 4LOBA 4LTVA 3PKOA 5DJRF 1HXAA 1WL1A 3P41A 2H8OA 3KRFB 2Q58A 4F6VA 4GA3A 3OABB 4UMJA 4LZ0A 1ZW5A 4E9ZA 4KVDA 2F9KF 3LSNA 1YQ7A 5IK9A 4P0XA 3M9UA 2E8XA 3VJ9A 3RBMA 4LTZA 3LK5A 2Q80A 2E8VA 4NUAA 5DHIA 3AQBB 4H5CF 4OGUA 3KRPA 5IKAA 3V66A 3ZMBA 3IPIA 5HNAA 5HN7A 3CKEA 4NKFA 5JA0F 2AETA 1V4HA 2ONGA 5DGMF 3V1VA 2E4OA 1DGPA 3RYWA 3NPRA 3ZCDA 2PS7A 4OMHA 1RTRA 5KSXF 2E8WA 3ZMCA 5ERMA 1WY0A 5AFXA 3ICMA 4PVXF 3DYHA 1UBWA 2E8TA 3N5HF 4LPHF 2EWGA 4EA2A 3AQCB 1WKZA 3ASXA 5JV1F 2Z4XA 2Z52A 3M01A 5AELA 4N1ZF 5B00A 5DJPF 3QKCA 1HX9A 3AQ0A 4LLTA 4DZWA 3TFPA 3Q1OA 3M00A 4DXJA 3N49F 3N46F 3ZOUA 1YHLA 1V4KA 2AELA 4KKMA 1YHKA 5ILHA 5ILDA 5IM1A 3M02A 4DI5A 3ICNA 2RAHA 4NFKF 3WEGA 3N1WF 3N3LF 4JXYA 5B0MA 3WEFA 3IBAA 3P8LA 4PVYF 5DW7A 1FPSA 3WCFA 4KWDA 1YYSA 4MC8A 5A0IA 3G4FA 5CG5A 3PYBA 3N5JF 3WCLA 5E8HA 3S9VA 4F6XA 5IVGA 3ACYA 1WMWA 3KRCB 3ACXA 5EROA 5ILYA 3LGKA 2Z78A 3WEIA 5ER8A 4RYPA 3LJIA 5A0KA 3VJ8A 3VJDA 5B02A 3APZA 3WE9A 2I19A 3WEHA 2Z7HA 3LLWA 1YYTA 4JZXA 3ICKA 1N23A 4KK2A 1V4EA 3WCCA 2Z4YA 3Q2QA 2OPMA 2F94F 3VJBA 4E1EA 4H5EF 5DHKA 4KFAA 4KQ5A 4WK5A 4K10A 3N0FA 4MC0A 3WSBA 3DYGA 3WCIA 3WCMA 3WEJA 1N21A 4H5DF 5IMNA 5C05A 2Z7IA 4JVJF 3WJNA 4LA6A 4QXSF 3PDEA 3LVSA 5DZ2A 1VG6A 3N1VF 4LLSA 3VJCA 5ILJA 5DJVF 4P0WA 1YV5A 3WCJA 5DGSF 4LFEA 3Q2ZA 3WC9A 3TFVA 4N9UA 4E9UA 4GP1A 3KRCA 5JV0F 4RXCA 4QPFA 5IK0A 2Z4ZA 2Z4VA 3QQVA 2DH4A 4Q23A 5B0KA 1N24A 2Q9YA 4LUUA 5AHUB 5B0IA 3KRFA 4OMGA 3OABA 4LZCA 1VG4A 3N45F 5IL8A 3EZ3A 3WCEA 2ONHA 3WCBA 4LA5A 3OACB 3EFQA 4KPDA 2PS5A 1N22A 1N1BA 1HM4A 3SDUA 2FORA 4KQUA 3P5RA 5IMPA 3MZVA 4KUXA 2F92F 4KVYA 2ZY1A 2F8CF 2F8ZF 3VJEA 5I1UA 3TFNA 3LZ9A 4FP4A 5IK6A 2Z4WA 3LDWA 3KROB 3G4DA 3V1XA 1V4IA 2ZEUA 3WCAA 5DGNF 2ZCRA 4EA0A 3UCAA 2E94A 5EATA 3N3DA 3KRAB 4NG6A 4DEMF 4GAXA 2J1OA 3P5PA 5AYPA 1EZFA 5IKHA 3N0GA 3BNYA 3NPKA 2FTZA 4FJQA 5EAUA 3WCGA 4P0VA 2E92A 2AZJA 4NKEA 4NFIF 1HXCA 1WL2A 5IL3A 3WJOA 3SDQA 4EA1A 4MC3A 5ILZA 3SDVA 1JFAA 3SAEA 1YYQA 4HD1A 5B0LA 3WCDA 1YJ4A 4LZ3A 4ZQ8A 2ZCSA 2PS4A 3ACWA 4RNQA 5ERNA 4KVWA 5E8KA 1RQIA 3N6KF 4LXWA 4KVIA 1HM7A 3KROA 1UBXA 3ICZA 3ADZA 3ID0A 3RMGA 2QISA 3S4JA 4LFGA 4XQTF 4F62A 3ZL6A 2F7MF 4DHDA 5EASA 2AZLA 4JYXA 3PYAA 5HN9A 3KRAA 3SDTA 3BNXA 3WSAA 2F89F 5CG6A 3WCHA 1DI1A 4NFJF 5B0JA 4XQRF 2Z50A 4DWGA 1VG7A 4RXAA 3WJKA 3P8RA 4RXDA 1UBYA 3LEEA 3SDRA 1UBVA 2E91A 2OPNA 3CP6A 2E95A 4JZBA 5E8LA 3OYRA 3PH7A 4RXEA 5ILKA 5IMIA 1YYUA 3M0GA 2AEKA 3CC9A 1RQJA 4LPGF 5B01A 5ILIA 4XQSF 3B7LA 5IN8A 2J1PA 2E8UA 2ZCOA 3LGZB 5JUZF 4LFVF 3EGTA 4KPJA 4GP2A 2ZCQA 2PS6A
chains in the Genus database with same CATH topology
3AE0A 1N20A 3LMDA 1YYRA 1V4JA 5DIQF 2VF6A 3LG5A 1N1ZA 1WL3A 2AZKA 2O1OA 5H9DA 3W7FA 1VG2A 1KIYA 1HXGA 3KBKA 1WL0A 1PS1A 4OKZA 4KQSA 3RYEA 1JFGA 3DYFA 4OKMA 2PS8A 2OGDA 3NF2A 2J5CA 1YHMA 3KRPB 5A0JA 2E93A 4DWBA 3NRIA 2ZEVA 3TC1A 1VG3A 3TS7A 5JV2F 5HN8A 3WEKA 3VJAA 3KB9A 3LOMA 3MAVA 2Q9ZA 1KIZA 2P1CA 3OACA 2OA6A 4LIXA 5B03A 2E90A 3Q30A 4JXNA 4L2XF 4LOBA 4LTVA 3PKOA 5DJRF 1HXAA 1WL1A 3P41A 2H8OA 3KRFB 2Q58A 4F6VA 4GA3A 3OABB 4UMJA 4LZ0A 1ZW5A 4E9ZA 4KVDA 2F9KF 3LSNA 1YQ7A 5IK9A 4P0XA 3M9UA 2E8XA 3VJ9A 3RBMA 4LTZA 3LK5A 2Q80A 2E8VA 4NUAA 5DHIA 3AQBB 4H5CF 4OGUA 3KRPA 5IKAA 3V66A 3ZMBA 3IPIA 5HNAA 5HN7A 3CKEA 4NKFA 5JA0F 2AETA 1V4HA 2ONGA 5DGMF 3V1VA 2E4OA 1DGPA 3RYWA 3NPRA 3ZCDA 2PS7A 4OMHA 1RTRA 5KSXF 2E8WA 3ZMCA 5ERMA 1WY0A 5AFXA 3ICMA 4PVXF 3DYHA 1UBWA 2E8TA 3N5HF 4LPHF 2EWGA 4EA2A 3AQCB 1WKZA 3ASXA 5JV1F 2Z4XA 2Z52A 3M01A 5AELA 4N1ZF 5B00A 5DJPF 3QKCA 1HX9A 3AQ0A 4LLTA 4DZWA 3TFPA 3Q1OA 3M00A 4DXJA 3N49F 3N46F 3ZOUA 1YHLA 1V4KA 2AELA 4KKMA 1YHKA 5ILHA 5ILDA 5IM1A 3M02A 4DI5A 3ICNA 2RAHA 4NFKF 3WEGA 3N1WF 3N3LF 4JXYA 5B0MA 3WEFA 3IBAA 3P8LA 4PVYF 5DW7A 1FPSA 3WCFA 4KWDA 1YYSA 4MC8A 5A0IA 3G4FA 5CG5A 3PYBA 3N5JF 3WCLA 5E8HA 3S9VA 4F6XA 5IVGA 3ACYA 1WMWA 3KRCB 3ACXA 5EROA 5ILYA 3LGKA 2Z78A 3WEIA 5ER8A 4RYPA 3LJIA 5A0KA 3VJ8A 3VJDA 5B02A 3APZA 3WE9A 2I19A 3WEHA 2Z7HA 3LLWA 1YYTA 4JZXA 3ICKA 1N23A 4KK2A 1V4EA 3WCCA 2Z4YA 3Q2QA 2OPMA 2F94F 3VJBA 4E1EA 4H5EF 5DHKA 4KFAA 4KQ5A 4WK5A 4K10A 3N0FA 4MC0A 3WSBA 3DYGA 3WCIA 3WCMA 3WEJA 1N21A 4H5DF 5IMNA 5C05A 2Z7IA 4JVJF 3WJNA 4LA6A 4QXSF 3PDEA 3LVSA 5DZ2A 1VG6A 3N1VF 4LLSA 3VJCA 5ILJA 5DJVF 4P0WA 1YV5A 3WCJA 5DGSF 4LFEA 3Q2ZA 3WC9A 3TFVA 4N9UA 4E9UA 4GP1A 3KRCA 5JV0F 4RXCA 4QPFA 5IK0A 2Z4ZA 2Z4VA 3QQVA 2DH4A 4Q23A 5B0KA 1N24A 2Q9YA 4LUUA 5AHUB 5B0IA 3KRFA 4OMGA 3OABA 4LZCA 1VG4A 3N45F 5IL8A 3EZ3A 3WCEA 2ONHA 3WCBA 4LA5A 3OACB 3EFQA 4KPDA 2PS5A 1N22A 1N1BA 1HM4A 3SDUA 2FORA 4KQUA 3P5RA 5IMPA 3MZVA 4KUXA 2F92F 4KVYA 2ZY1A 2F8CF 2F8ZF 3VJEA 5I1UA 3TFNA 3LZ9A 4FP4A 5IK6A 2Z4WA 3LDWA 3KROB 3G4DA 3V1XA 1V4IA 2ZEUA 3WCAA 5DGNF 2ZCRA 4EA0A 3UCAA 2E94A 5EATA 3N3DA 3KRAB 4NG6A 4DEMF 4GAXA 2J1OA 3P5PA 5AYPA 1EZFA 5IKHA 3N0GA 3BNYA 3NPKA 2FTZA 4FJQA 5EAUA 3WCGA 4P0VA 2E92A 2AZJA 4NKEA 4NFIF 1HXCA 1WL2A 5IL3A 3WJOA 3SDQA 4EA1A 4MC3A 5ILZA 3SDVA 1JFAA 3SAEA 1YYQA 4HD1A 5B0LA 3WCDA 1YJ4A 4LZ3A 4ZQ8A 2ZCSA 2PS4A 3ACWA 4RNQA 5ERNA 4KVWA 5E8KA 1RQIA 3N6KF 4LXWA 4KVIA 1HM7A 3KROA 1UBXA 3ICZA 3ADZA 3ID0A 3RMGA 2QISA 3S4JA 4LFGA 4XQTF 4F62A 3ZL6A 2F7MF 4DHDA 5EASA 2AZLA 4JYXA 3PYAA 5HN9A 3KRAA 3SDTA 3BNXA 3WSAA 2F89F 5CG6A 3WCHA 1DI1A 4NFJF 5B0JA 4XQRF 2Z50A 4DWGA 1VG7A 4RXAA 3WJKA 3P8RA 4RXDA 1UBYA 3LEEA 3SDRA 1UBVA 2E91A 2OPNA 3CP6A 2E95A 4JZBA 5E8LA 3OYRA 3PH7A 4RXEA 5ILKA 5IMIA 1YYUA 3M0GA 2AEKA 3CC9A 1RQJA 4LPGF 5B01A 5ILIA 4XQSF 3B7LA 5IN8A 2J1PA 2E8UA 2ZCOA 3LGZB 5JUZF 4LFVF 3EGTA 4KPJA 4GP2A 2ZCQA 2PS6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AE0 A;  1N20 A;  3LMD A;  1YYR A;  1V4J A;  5DIQ F;  2VF6 A;  3LG5 A;  1N1Z A;  1WL3 A;  2AZK A;  2O1O A;  5H9D A;  3W7F A;  1VG2 A;  1KIY A;  1HXG A;  3KBK A;  1WL0 A;  1PS1 A;  4OKZ A;  4KQS A;  3RYE A;  1JFG A;  3DYF A;  4OKM A;  2PS8 A;  2OGD A;  3NF2 A;  2J5C A;  1YHM A;  3KRP B;  5A0J A;  2E93 A;  4DWB A;  3NRI A;  2ZEV A;  3TC1 A;  1VG3 A;  3TS7 A;  5JV2 F;  5HN8 A;  3WEK A;  3VJA A;  3KB9 A;  3LOM A;  3MAV A;  2Q9Z A;  1KIZ A;  2P1C A;  3OAC A;  2OA6 A;  4LIX A;  5B03 A;  2E90 A;  3Q30 A;  4JXN A;  4L2X F;  4LOB A;  4LTV A;  3PKO A;  5DJR F;  1HXA A;  1WL1 A;  3P41 A;  2H8O A;  3KRF B;  2Q58 A;  4F6V A;  4GA3 A;  3OAB B;  4UMJ A;  4LZ0 A;  1ZW5 A;  4E9Z A;  4KVD A;  2F9K F;  3LSN A;  1YQ7 A;  5IK9 A;  4P0X A;  3M9U A;  2E8X A;  3VJ9 A;  3RBM A;  4LTZ A;  3LK5 A;  2Q80 A;  2E8V A;  4NUA A;  5DHI A;  3AQB B;  4H5C F;  4OGU A;  3KRP A;  5IKA A;  3V66 A;  3ZMB A;  3IPI A;  5HNA A;  5HN7 A;  3CKE A;  4NKF A;  5JA0 F;  2AET A;  1V4H A;  2ONG A;  5DGM F;  3V1V A;  2E4O A;  1DGP A;  3RYW A;  3NPR A;  3ZCD A;  2PS7 A;  4OMH A;  1RTR A;  5KSX F;  2E8W A;  3ZMC A;  5ERM A;  1WY0 A;  5AFX A;  3ICM A;  4PVX F;  3DYH A;  1UBW A;  2E8T A;  3N5H F;  4LPH F;  2EWG A;  4EA2 A;  3AQC B;  1WKZ A;  3ASX A;  5JV1 F;  2Z4X A;  2Z52 A;  3M01 A;  5AEL A;  4N1Z F;  5B00 A;  5DJP F;  3QKC A;  1HX9 A;  3AQ0 A;  4LLT A;  4DZW A;  3TFP A;  3Q1O A;  3M00 A;  4DXJ A;  3N49 F;  3N46 F;  3ZOU A;  1YHL A;  1V4K A;  2AEL A;  4KKM A;  1YHK A;  5ILH A;  5ILD A;  5IM1 A;  3M02 A;  4DI5 A;  3ICN A;  2RAH A;  4NFK F;  3WEG A;  3N1W F;  3N3L F;  4JXY A;  5B0M A;  3WEF A;  3IBA A;  3P8L A;  4PVY F;  5DW7 A;  1FPS A;  3WCF A;  4KWD A;  1YYS A;  4MC8 A;  5A0I A;  3G4F A;  5CG5 A;  3PYB A;  3N5J F;  3WCL A;  5E8H A;  3S9V A;  4F6X A;  5IVG A;  3ACY A;  1WMW A;  3KRC B;  3ACX A;  5ERO A;  5ILY A;  3LGK A;  2Z78 A;  3WEI A;  5ER8 A;  4RYP A;  3LJI A;  5A0K A;  3VJ8 A;  3VJD A;  5B02 A;  3APZ A;  3WE9 A;  2I19 A;  3WEH A;  2Z7H A;  3LLW A;  1YYT A;  4JZX A;  3ICK A;  1N23 A;  4KK2 A;  1V4E A;  3WCC A;  2Z4Y A;  3Q2Q A;  2OPM A;  2F94 F;  3VJB A;  4E1E A;  4H5E F;  5DHK A;  4KFA A;  4KQ5 A;  4WK5 A;  4K10 A;  3N0F A;  4MC0 A;  3WSB A;  3DYG A;  3WCI A;  3WCM A;  3WEJ A;  1N21 A;  4H5D F;  5IMN A;  5C05 A;  2Z7I A;  4JVJ F;  3WJN A;  4LA6 A;  4QXS F;  3PDE A;  3LVS A;  5DZ2 A;  1VG6 A;  3N1V F;  4LLS A;  3VJC A;  5ILJ A;  5DJV F;  4P0W A;  1YV5 A;  3WCJ A;  5DGS F;  4LFE A;  3Q2Z A;  3WC9 A;  3TFV A;  4N9U A;  4E9U A;  4GP1 A;  3KRC A;  5JV0 F;  4RXC A;  4QPF A;  5IK0 A;  2Z4Z A;  2Z4V A;  3QQV A;  2DH4 A;  4Q23 A;  5B0K A;  1N24 A;  2Q9Y A;  4LUU A;  5AHU B;  5B0I A;  3KRF A;  4OMG A;  3OAB A;  4LZC A;  1VG4 A;  3N45 F;  5IL8 A;  3EZ3 A;  3WCE A;  2ONH A;  3WCB A;  4LA5 A;  3OAC B;  3EFQ A;  4KPD A;  2PS5 A;  1N22 A;  1N1B A;  1HM4 A;  3SDU A;  2FOR A;  4KQU A;  3P5R A;  5IMP A;  3MZV A;  4KUX A;  2F92 F;  4KVY A;  2ZY1 A;  2F8C F;  2F8Z F;  3VJE A;  5I1U A;  3TFN A;  3LZ9 A;  4FP4 A;  5IK6 A;  2Z4W A;  3LDW A;  3KRO B;  3G4D A;  3V1X A;  1V4I A;  2ZEU A;  3WCA A;  5DGN F;  2ZCR A;  4EA0 A;  3UCA A;  2E94 A;  5EAT A;  3N3D A;  3KRA B;  4NG6 A;  4DEM F;  4GAX A;  2J1O A;  3P5P A;  5AYP A;  1EZF A;  5IKH A;  3N0G A;  3BNY A;  3NPK A;  2FTZ A;  4FJQ A;  5EAU A;  3WCG A;  4P0V A;  2E92 A;  2AZJ A;  4NKE A;  4NFI F;  1HXC A;  1WL2 A;  5IL3 A;  3WJO A;  3SDQ A;  4EA1 A;  4MC3 A;  5ILZ A;  3SDV A;  1JFA A;  3SAE A;  1YYQ A;  4HD1 A;  5B0L A;  3WCD A;  1YJ4 A;  4LZ3 A;  4ZQ8 A;  2ZCS A;  2PS4 A;  3ACW A;  4RNQ A;  5ERN A;  4KVW A;  5E8K A;  1RQI A;  3N6K F;  4LXW A;  4KVI A;  1HM7 A;  3KRO A;  1UBX A;  3ICZ A;  3ADZ A;  3ID0 A;  3RMG A;  2QIS A;  3S4J A;  4LFG A;  4XQT F;  4F62 A;  3ZL6 A;  2F7M F;  4DHD A;  5EAS A;  2AZL A;  4JYX A;  3PYA A;  5HN9 A;  3KRA A;  3SDT A;  3BNX A;  3WSA A;  2F89 F;  5CG6 A;  3WCH A;  1DI1 A;  4NFJ F;  5B0J A;  4XQR F;  2Z50 A;  4DWG A;  1VG7 A;  4RXA A;  3WJK A;  3P8R A;  4RXD A;  1UBY A;  3LEE A;  3SDR A;  1UBV A;  2E91 A;  2OPN A;  3CP6 A;  2E95 A;  4JZB A;  5E8L A;  3OYR A;  3PH7 A;  4RXE A;  5ILK A;  5IMI A;  1YYU A;  3M0G A;  2AEK A;  3CC9 A;  1RQJ A;  4LPG F;  5B01 A;  5ILI A;  4XQS F;  3B7L A;  5IN8 A;  2J1P A;  2E8U A;  2ZCO A;  3LGZ B;  5JUZ F;  4LFV F;  3EGT A;  4KPJ A;  4GP2 A;  2ZCQ A;  2PS6 A; 
#chains in the Genus database with same CATH topology
 3AE0 A;  1N20 A;  3LMD A;  1YYR A;  1V4J A;  5DIQ F;  2VF6 A;  3LG5 A;  1N1Z A;  1WL3 A;  2AZK A;  2O1O A;  5H9D A;  3W7F A;  1VG2 A;  1KIY A;  1HXG A;  3KBK A;  1WL0 A;  1PS1 A;  4OKZ A;  4KQS A;  3RYE A;  1JFG A;  3DYF A;  4OKM A;  2PS8 A;  2OGD A;  3NF2 A;  2J5C A;  1YHM A;  3KRP B;  5A0J A;  2E93 A;  4DWB A;  3NRI A;  2ZEV A;  3TC1 A;  1VG3 A;  3TS7 A;  5JV2 F;  5HN8 A;  3WEK A;  3VJA A;  3KB9 A;  3LOM A;  3MAV A;  2Q9Z A;  1KIZ A;  2P1C A;  3OAC A;  2OA6 A;  4LIX A;  5B03 A;  2E90 A;  3Q30 A;  4JXN A;  4L2X F;  4LOB A;  4LTV A;  3PKO A;  5DJR F;  1HXA A;  1WL1 A;  3P41 A;  2H8O A;  3KRF B;  2Q58 A;  4F6V A;  4GA3 A;  3OAB B;  4UMJ A;  4LZ0 A;  1ZW5 A;  4E9Z A;  4KVD A;  2F9K F;  3LSN A;  1YQ7 A;  5IK9 A;  4P0X A;  3M9U A;  2E8X A;  3VJ9 A;  3RBM A;  4LTZ A;  3LK5 A;  2Q80 A;  2E8V A;  4NUA A;  5DHI A;  3AQB B;  4H5C F;  4OGU A;  3KRP A;  5IKA A;  3V66 A;  3ZMB A;  3IPI A;  5HNA A;  5HN7 A;  3CKE A;  4NKF A;  5JA0 F;  2AET A;  1V4H A;  2ONG A;  5DGM F;  3V1V A;  2E4O A;  1DGP A;  3RYW A;  3NPR A;  3ZCD A;  2PS7 A;  4OMH A;  1RTR A;  5KSX F;  2E8W A;  3ZMC A;  5ERM A;  1WY0 A;  5AFX A;  3ICM A;  4PVX F;  3DYH A;  1UBW A;  2E8T A;  3N5H F;  4LPH F;  2EWG A;  4EA2 A;  3AQC B;  1WKZ A;  3ASX A;  5JV1 F;  2Z4X A;  2Z52 A;  3M01 A;  5AEL A;  4N1Z F;  5B00 A;  5DJP F;  3QKC A;  1HX9 A;  3AQ0 A;  4LLT A;  4DZW A;  3TFP A;  3Q1O A;  3M00 A;  4DXJ A;  3N49 F;  3N46 F;  3ZOU A;  1YHL A;  1V4K A;  2AEL A;  4KKM A;  1YHK A;  5ILH A;  5ILD A;  5IM1 A;  3M02 A;  4DI5 A;  3ICN A;  2RAH A;  4NFK F;  3WEG A;  3N1W F;  3N3L F;  4JXY A;  5B0M A;  3WEF A;  3IBA A;  3P8L A;  4PVY F;  5DW7 A;  1FPS A;  3WCF A;  4KWD A;  1YYS A;  4MC8 A;  5A0I A;  3G4F A;  5CG5 A;  3PYB A;  3N5J F;  3WCL A;  5E8H A;  3S9V A;  4F6X A;  5IVG A;  3ACY A;  1WMW A;  3KRC B;  3ACX A;  5ERO A;  5ILY A;  3LGK A;  2Z78 A;  3WEI A;  5ER8 A;  4RYP A;  3LJI A;  5A0K A;  3VJ8 A;  3VJD A;  5B02 A;  3APZ A;  3WE9 A;  2I19 A;  3WEH A;  2Z7H A;  3LLW A;  1YYT A;  4JZX A;  3ICK A;  1N23 A;  4KK2 A;  1V4E A;  3WCC A;  2Z4Y A;  3Q2Q A;  2OPM A;  2F94 F;  3VJB A;  4E1E A;  4H5E F;  5DHK A;  4KFA A;  4KQ5 A;  4WK5 A;  4K10 A;  3N0F A;  4MC0 A;  3WSB A;  3DYG A;  3WCI A;  3WCM A;  3WEJ A;  1N21 A;  4H5D F;  5IMN A;  5C05 A;  2Z7I A;  4JVJ F;  3WJN A;  4LA6 A;  4QXS F;  3PDE A;  3LVS A;  5DZ2 A;  1VG6 A;  3N1V F;  4LLS A;  3VJC A;  5ILJ A;  5DJV F;  4P0W A;  1YV5 A;  3WCJ A;  5DGS F;  4LFE A;  3Q2Z A;  3WC9 A;  3TFV A;  4N9U A;  4E9U A;  4GP1 A;  3KRC A;  5JV0 F;  4RXC A;  4QPF A;  5IK0 A;  2Z4Z A;  2Z4V A;  3QQV A;  2DH4 A;  4Q23 A;  5B0K A;  1N24 A;  2Q9Y A;  4LUU A;  5AHU B;  5B0I A;  3KRF A;  4OMG A;  3OAB A;  4LZC A;  1VG4 A;  3N45 F;  5IL8 A;  3EZ3 A;  3WCE A;  2ONH A;  3WCB A;  4LA5 A;  3OAC B;  3EFQ A;  4KPD A;  2PS5 A;  1N22 A;  1N1B A;  1HM4 A;  3SDU A;  2FOR A;  4KQU A;  3P5R A;  5IMP A;  3MZV A;  4KUX A;  2F92 F;  4KVY A;  2ZY1 A;  2F8C F;  2F8Z F;  3VJE A;  5I1U A;  3TFN A;  3LZ9 A;  4FP4 A;  5IK6 A;  2Z4W A;  3LDW A;  3KRO B;  3G4D A;  3V1X A;  1V4I A;  2ZEU A;  3WCA A;  5DGN F;  2ZCR A;  4EA0 A;  3UCA A;  2E94 A;  5EAT A;  3N3D A;  3KRA B;  4NG6 A;  4DEM F;  4GAX A;  2J1O A;  3P5P A;  5AYP A;  1EZF A;  5IKH A;  3N0G A;  3BNY A;  3NPK A;  2FTZ A;  4FJQ A;  5EAU A;  3WCG A;  4P0V A;  2E92 A;  2AZJ A;  4NKE A;  4NFI F;  1HXC A;  1WL2 A;  5IL3 A;  3WJO A;  3SDQ A;  4EA1 A;  4MC3 A;  5ILZ A;  3SDV A;  1JFA A;  3SAE A;  1YYQ A;  4HD1 A;  5B0L A;  3WCD A;  1YJ4 A;  4LZ3 A;  4ZQ8 A;  2ZCS A;  2PS4 A;  3ACW A;  4RNQ A;  5ERN A;  4KVW A;  5E8K A;  1RQI A;  3N6K F;  4LXW A;  4KVI A;  1HM7 A;  3KRO A;  1UBX A;  3ICZ A;  3ADZ A;  3ID0 A;  3RMG A;  2QIS A;  3S4J A;  4LFG A;  4XQT F;  4F62 A;  3ZL6 A;  2F7M F;  4DHD A;  5EAS A;  2AZL A;  4JYX A;  3PYA A;  5HN9 A;  3KRA A;  3SDT A;  3BNX A;  3WSA A;  2F89 F;  5CG6 A;  3WCH A;  1DI1 A;  4NFJ F;  5B0J A;  4XQR F;  2Z50 A;  4DWG A;  1VG7 A;  4RXA A;  3WJK A;  3P8R A;  4RXD A;  1UBY A;  3LEE A;  3SDR A;  1UBV A;  2E91 A;  2OPN A;  3CP6 A;  2E95 A;  4JZB A;  5E8L A;  3OYR A;  3PH7 A;  4RXE A;  5ILK A;  5IMI A;  1YYU A;  3M0G A;  2AEK A;  3CC9 A;  1RQJ A;  4LPG F;  5B01 A;  5ILI A;  4XQS F;  3B7L A;  5IN8 A;  2J1P A;  2E8U A;  2ZCO A;  3LGZ B;  5JUZ F;  4LFV F;  3EGT A;  4KPJ A;  4GP2 A;  2ZCQ A;  2PS6 A; 
#chains in the Genus database with same CATH homology
 3AE0 A;  1N20 A;  3LMD A;  1YYR A;  1V4J A;  5DIQ F;  2VF6 A;  3LG5 A;  1N1Z A;  1WL3 A;  2AZK A;  2O1O A;  5H9D A;  3W7F A;  1VG2 A;  1KIY A;  1HXG A;  3KBK A;  1WL0 A;  1PS1 A;  4OKZ A;  4KQS A;  3RYE A;  1JFG A;  3DYF A;  4OKM A;  2PS8 A;  2OGD A;  3NF2 A;  2J5C A;  1YHM A;  3KRP B;  5A0J A;  2E93 A;  4DWB A;  3NRI A;  2ZEV A;  3TC1 A;  1VG3 A;  3TS7 A;  5JV2 F;  5HN8 A;  3WEK A;  3VJA A;  3KB9 A;  3LOM A;  3MAV A;  2Q9Z A;  1KIZ A;  2P1C A;  3OAC A;  2OA6 A;  4LIX A;  5B03 A;  2E90 A;  3Q30 A;  4JXN A;  4L2X F;  4LOB A;  4LTV A;  3PKO A;  5DJR F;  1HXA A;  1WL1 A;  3P41 A;  2H8O A;  3KRF B;  2Q58 A;  4F6V A;  4GA3 A;  3OAB B;  4UMJ A;  4LZ0 A;  1ZW5 A;  4E9Z A;  4KVD A;  2F9K F;  3LSN A;  1YQ7 A;  5IK9 A;  4P0X A;  3M9U A;  2E8X A;  3VJ9 A;  3RBM A;  4LTZ A;  3LK5 A;  2Q80 A;  2E8V A;  4NUA A;  5DHI A;  3AQB B;  4H5C F;  4OGU A;  3KRP A;  5IKA A;  3V66 A;  3ZMB A;  3IPI A;  5HNA A;  5HN7 A;  3CKE A;  4NKF A;  5JA0 F;  2AET A;  1V4H A;  2ONG A;  5DGM F;  3V1V A;  2E4O A;  1DGP A;  3RYW A;  3NPR A;  3ZCD A;  2PS7 A;  4OMH A;  1RTR A;  5KSX F;  2E8W A;  3ZMC A;  5ERM A;  1WY0 A;  5AFX A;  3ICM A;  4PVX F;  3DYH A;  1UBW A;  2E8T A;  3N5H F;  4LPH F;  2EWG A;  4EA2 A;  3AQC B;  1WKZ A;  3ASX A;  5JV1 F;  2Z4X A;  2Z52 A;  3M01 A;  5AEL A;  4N1Z F;  5B00 A;  5DJP F;  3QKC A;  1HX9 A;  3AQ0 A;  4LLT A;  4DZW A;  3TFP A;  3Q1O A;  3M00 A;  4DXJ A;  3N49 F;  3N46 F;  3ZOU A;  1YHL A;  1V4K A;  2AEL A;  4KKM A;  1YHK A;  5ILH A;  5ILD A;  5IM1 A;  3M02 A;  4DI5 A;  3ICN A;  2RAH A;  4NFK F;  3WEG A;  3N1W F;  3N3L F;  4JXY A;  5B0M A;  3WEF A;  3IBA A;  3P8L A;  4PVY F;  5DW7 A;  1FPS A;  3WCF A;  4KWD A;  1YYS A;  4MC8 A;  5A0I A;  3G4F A;  5CG5 A;  3PYB A;  3N5J F;  3WCL A;  5E8H A;  3S9V A;  4F6X A;  5IVG A;  3ACY A;  1WMW A;  3KRC B;  3ACX A;  5ERO A;  5ILY A;  3LGK A;  2Z78 A;  3WEI A;  5ER8 A;  4RYP A;  3LJI A;  5A0K A;  3VJ8 A;  3VJD A;  5B02 A;  3APZ A;  3WE9 A;  2I19 A;  3WEH A;  2Z7H A;  3LLW A;  1YYT A;  4JZX A;  3ICK A;  1N23 A;  4KK2 A;  1V4E A;  3WCC A;  2Z4Y A;  3Q2Q A;  2OPM A;  2F94 F;  3VJB A;  4E1E A;  4H5E F;  5DHK A;  4KFA A;  4KQ5 A;  4WK5 A;  4K10 A;  3N0F A;  4MC0 A;  3WSB A;  3DYG A;  3WCI A;  3WCM A;  3WEJ A;  1N21 A;  4H5D F;  5IMN A;  5C05 A;  2Z7I A;  4JVJ F;  3WJN A;  4LA6 A;  4QXS F;  3PDE A;  3LVS A;  5DZ2 A;  1VG6 A;  3N1V F;  4LLS A;  3VJC A;  5ILJ A;  5DJV F;  4P0W A;  1YV5 A;  3WCJ A;  5DGS F;  4LFE A;  3Q2Z A;  3WC9 A;  3TFV A;  4N9U A;  4E9U A;  4GP1 A;  3KRC A;  5JV0 F;  4RXC A;  4QPF A;  5IK0 A;  2Z4Z A;  2Z4V A;  3QQV A;  2DH4 A;  4Q23 A;  5B0K A;  1N24 A;  2Q9Y A;  4LUU A;  5AHU B;  5B0I A;  3KRF A;  4OMG A;  3OAB A;  4LZC A;  1VG4 A;  3N45 F;  5IL8 A;  3EZ3 A;  3WCE A;  2ONH A;  3WCB A;  4LA5 A;  3OAC B;  3EFQ A;  4KPD A;  2PS5 A;  1N22 A;  1N1B A;  1HM4 A;  3SDU A;  2FOR A;  4KQU A;  3P5R A;  5IMP A;  3MZV A;  4KUX A;  2F92 F;  4KVY A;  2ZY1 A;  2F8C F;  2F8Z F;  3VJE A;  5I1U A;  3TFN A;  3LZ9 A;  4FP4 A;  5IK6 A;  2Z4W A;  3LDW A;  3KRO B;  3G4D A;  3V1X A;  1V4I A;  2ZEU A;  3WCA A;  5DGN F;  2ZCR A;  4EA0 A;  3UCA A;  2E94 A;  5EAT A;  3N3D A;  3KRA B;  4NG6 A;  4DEM F;  4GAX A;  2J1O A;  3P5P A;  5AYP A;  1EZF A;  5IKH A;  3N0G A;  3BNY A;  3NPK A;  2FTZ A;  4FJQ A;  5EAU A;  3WCG A;  4P0V A;  2E92 A;  2AZJ A;  4NKE A;  4NFI F;  1HXC A;  1WL2 A;  5IL3 A;  3WJO A;  3SDQ A;  4EA1 A;  4MC3 A;  5ILZ A;  3SDV A;  1JFA A;  3SAE A;  1YYQ A;  4HD1 A;  5B0L A;  3WCD A;  1YJ4 A;  4LZ3 A;  4ZQ8 A;  2ZCS A;  2PS4 A;  3ACW A;  4RNQ A;  5ERN A;  4KVW A;  5E8K A;  1RQI A;  3N6K F;  4LXW A;  4KVI A;  1HM7 A;  3KRO A;  1UBX A;  3ICZ A;  3ADZ A;  3ID0 A;  3RMG A;  2QIS A;  3S4J A;  4LFG A;  4XQT F;  4F62 A;  3ZL6 A;  2F7M F;  4DHD A;  5EAS A;  2AZL A;  4JYX A;  3PYA A;  5HN9 A;  3KRA A;  3SDT A;  3BNX A;  3WSA A;  2F89 F;  5CG6 A;  3WCH A;  1DI1 A;  4NFJ F;  5B0J A;  4XQR F;  2Z50 A;  4DWG A;  1VG7 A;  4RXA A;  3WJK A;  3P8R A;  4RXD A;  1UBY A;  3LEE A;  3SDR A;  1UBV A;  2E91 A;  2OPN A;  3CP6 A;  2E95 A;  4JZB A;  5E8L A;  3OYR A;  3PH7 A;  4RXE A;  5ILK A;  5IMI A;  1YYU A;  3M0G A;  2AEK A;  3CC9 A;  1RQJ A;  4LPG F;  5B01 A;  5ILI A;  4XQS F;  3B7L A;  5IN8 A;  2J1P A;  2E8U A;  2ZCO A;  3LGZ B;  5JUZ F;  4LFV F;  3EGT A;  4KPJ A;  4GP2 A;  2ZCQ A;  2PS6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...