3KRCB

Mint heterotetrameric geranyl pyrophosphate synthase in complex with ipp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGFHGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyl diphosphate synthase large subunit
publication title Structure of a heterotetrameric geranyl pyrophosphate synthase from mint (Mentha piperita) reveals intersubunit regulation
pubmed doi rcsb
source organism Mentha x piperita
total genus 99
structure length 259
sequence length 259
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2009-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3krcB00
5B0KA 5ILYA 4OKZA 5B01A 5CG6A 4P0XA 2Q80A 3N3LF 2FTZA 3N5HF 4LUUA 2ZCRA 4DHDA 5B02A 3EZ3A 3G4FA 3P5RA 2F8CF 2VF6A 2Z4WA 2ONHA 3KRFA 3RYEA 4KQ5A 4MC0A 1VG2A 2FORA 3WCBA 3KRCA 2J1PA 3PDEA 4KUXA 5JA0F 3SAEA 1YYUA 3ZL6A 4LZ3A 1VG7A 1WKZA 2Z4XA 3OABA 3LK5A 4NFIF 3BNXA 3DYHA 4OMHA 2E4OA 4P0VA 5DW7A 5EROA 2QISA 2F8ZF 1N1ZA 5ER8A 3CC9A 3M0GA 3WEFA 3M01A 3KRAA 1N23A 2AZJA 2ZCQA 3LDWA 4EA2A 5EATA 2PS6A 4KK2A 4RYPA 3VJBA 5AFXA 4KVIA 5DJVF 4DXJA 3BNYA 5EAUA 5JV2F 3S4JA 2E90A 5ILIA 1N24A 3LLWA 4L2XF 5DHKA 4OMGA 5DGNF 3VJDA 5E8HA 3TFPA 3M00A 2H8OA 3SDUA 3APZA 2I19A 5HN8A 4DWGA 2OPNA 3LVSA 4XQTF 4JZBA 5E8KA 5IL8A 5HN9A 1HM4A 3CKEA 3N0FA 4NUAA 3PYBA 2F9KF 4H5CF 3WCLA 1WL1A 4LTZA 3WCDA 4GAXA 4JXYA 4KVYA 3UCAA 1HXGA 3N1VF 1YYTA 3N0GA 2F7MF 2E93A 5ERNA 4OKMA 4KWDA 3NPKA 3WCAA 2Z52A 5JV1F 5JUZF 1YQ7A 3QKCA 3WCGA 3V66A 4XQSF 3WJOA 5HNAA 4XQRF 2OGDA 3VJ8A 5ILJA 2PS4A 3ICZA 3Q30A 5ERMA 3VJCA 1JFGA 1N1BA 1YYSA 4KPDA 4MC3A 3B7LA 5DJPF 4QXSF 5B0MA 3DYGA 2F92F 3DYFA 4UMJA 3WEGA 4F6XA 3RYWA 4LFEA 3WCJA 4DZWA 3P8LA 2Z7IA 5EASA 1V4JA 3TC1A 4PVXF 2DH4A 3LZ9A 5ILKA 2PS8A 5AYPA 5ILHA 3WJKA 2AEKA 2E92A 2ZCOA 1DGPA 4RXDA 5A0IA 2F89F 5B00A 2AETA 3KRFB 4KVDA 3SDTA 1N22A 3N46F 2ZY1A 5ILDA 3TFNA 3ACWA 4FP4A 4LZCA 3WCMA 5B03A 1RTRA 4NFJF 3KRCB 5DGMF 4LTVA 4LLTA 5IVGA 1KIZA 3OABB 3IPIA 5E8LA 4JZXA 4LA5A 2Q9ZA 3ZMBA 3ADZA 1UBWA 3TS7A 3WEHA 3AQBB 3ID0A 3KRAB 3P41A 1JFAA 4LIXA 4NKEA 5HN7A 5IK6A 4LA6A 5IMIA 3LEEA 5IN8A 4LLSA 2ZEUA 5B0JA 4H5EF 1RQIA 3LSNA 5C05A 2RAHA 2E95A 5IK9A 3N49F 4MC8A 3PYAA 2Z78A 4FJQA 1YHLA 4LZ0A 5A0KA 3ASXA 1EZFA 4KQSA 4N1ZF 3WCFA 1WY0A 2E8XA 5IMNA 3WEKA 2Z4YA 1V4KA 3KROA 5B0IA 3OACA 2PS5A 2J5CA 4Q23A 1YYQA 2E8VA 3SDRA 1UBYA 3WSAA 2ZEVA 3WCHA 1DI1A 3WE9A 5IK0A 4RNQA 3RMGA 3V1VA 1KIYA 3NRIA 1PS1A 1WL2A 3KRPA 5A0JA 4E9ZA 4GA3A 4DEMF 3AE0A 4EA0A 3ACXA 3P5PA 3WSBA 4ZQ8A 2E94A 2EWGA 2AZLA 1WL3A 3MAVA 5KSXF 3PH7A 1V4EA 5H9DA 2AELA 2OA6A 1YJ4A 5IKHA 3Q1OA 4E9UA 4EA1A 2F94F 4JVJF 1VG4A 3CP6A 2E91A 2O1OA 2Q9YA 3S9VA 3SDVA 3QQVA 5JV0F 3N1WF 4KVWA 1HXCA 4LFGA 2OPMA 4QPFA 1YHMA 4HD1A 5DIQF 3VJEA 5IM1A 4RXCA 3V1XA 3IBAA 4KQUA 1YYRA 1WMWA 1VG6A 3Q2ZA 3WCIA 4JYXA 4JXNA 3LJIA 4F6VA 4F62A 5B0LA 4PVYF 4LPGF 3N5JF 2Z4VA 3N45F 3TFVA 3ICKA 3N6KF 2PS7A 1YHKA 5AELA 4LPHF 3WEIA 2Z7HA 4KPJA 3ICMA 3OYRA 3LMDA 4DI5A 3WCCA 4KKMA 1RQJA 3KBKA 3WC9A 4LXWA 3ICNA 5IKAA 3ZCDA 3ZOUA 4NKFA 4LFVF 4DWBA 5CG5A 4RXAA 1FPSA 2J1OA 3LG5A 3LOMA 2Q58A 3WJNA 2Z50A 1WL0A 2Z4ZA 4LOBA 2ONGA 1HM7A 3SDQA 1HXAA 2E8UA 5DJRF 4K10A 5DHIA 4GP2A 3KB9A 4OGUA 4H5DF 1N20A 4GP1A 4NFKF 5I1UA 5IMPA 3LGZB 3LGKA 3WEJA 1V4HA 1VG3A 1YV5A 2ZCSA 3WCEA 4WK5A 3EGTA 1V4IA 4RXEA 3AQ0A 3M02A 3NF2A 5DGSF 3EFQA 3KROB 3G4DA 4NG6A 3OACB 4E1EA 1UBXA 5DZ2A 4P0WA 3VJAA 3MZVA 5ILZA 3NPRA 3M9UA 2AZKA 1ZW5A 3RBMA 1UBVA 3AQCB 4N9UA 3PKOA 3ZMCA 3Q2QA 2E8WA 3P8RA 5IL3A 1HX9A 3N3DA 5AHUB 2P1CA 2E8TA 3KRPB 3ACYA 3W7FA 1N21A 4KFAA 3VJ9A
chains in the Genus database with same CATH superfamily
5B0KA 5ILYA 4OKZA 5B01A 5CG6A 4P0XA 2Q80A 3N3LF 2FTZA 3N5HF 4LUUA 2ZCRA 4DHDA 5B02A 3EZ3A 3G4FA 3P5RA 2F8CF 2VF6A 2Z4WA 2ONHA 3KRFA 3RYEA 4KQ5A 4MC0A 1VG2A 2FORA 3WCBA 3KRCA 2J1PA 3PDEA 4KUXA 5JA0F 3SAEA 1YYUA 3ZL6A 4LZ3A 1VG7A 1WKZA 2Z4XA 3OABA 3LK5A 4NFIF 3BNXA 3DYHA 4OMHA 2E4OA 4P0VA 5DW7A 5EROA 2QISA 2F8ZF 1N1ZA 5ER8A 3CC9A 3M0GA 3WEFA 3M01A 3KRAA 1N23A 2AZJA 2ZCQA 3LDWA 4EA2A 5EATA 2PS6A 4KK2A 4RYPA 3VJBA 5AFXA 4KVIA 5DJVF 4DXJA 3BNYA 5EAUA 5JV2F 3S4JA 2E90A 5ILIA 1N24A 3LLWA 4L2XF 5DHKA 4OMGA 5DGNF 3VJDA 5E8HA 3TFPA 3M00A 2H8OA 3SDUA 3APZA 2I19A 5HN8A 4DWGA 2OPNA 3LVSA 4XQTF 4JZBA 5E8KA 5IL8A 5HN9A 1HM4A 3CKEA 3N0FA 4NUAA 3PYBA 2F9KF 4H5CF 3WCLA 1WL1A 4LTZA 3WCDA 4GAXA 4JXYA 4KVYA 3UCAA 1HXGA 3N1VF 1YYTA 3N0GA 2F7MF 2E93A 5ERNA 4OKMA 4KWDA 3NPKA 3WCAA 2Z52A 5JV1F 5JUZF 1YQ7A 3QKCA 3WCGA 3V66A 4XQSF 3WJOA 5HNAA 4XQRF 2OGDA 3VJ8A 5ILJA 2PS4A 3ICZA 3Q30A 5ERMA 3VJCA 1JFGA 1N1BA 1YYSA 4KPDA 4MC3A 3B7LA 5DJPF 4QXSF 5B0MA 3DYGA 2F92F 3DYFA 4UMJA 3WEGA 4F6XA 3RYWA 4LFEA 3WCJA 4DZWA 3P8LA 2Z7IA 5EASA 1V4JA 3TC1A 4PVXF 2DH4A 3LZ9A 5ILKA 2PS8A 5AYPA 5ILHA 3WJKA 2AEKA 2E92A 2ZCOA 1DGPA 4RXDA 5A0IA 2F89F 5B00A 2AETA 3KRFB 4KVDA 3SDTA 1N22A 3N46F 2ZY1A 5ILDA 3TFNA 3ACWA 4FP4A 4LZCA 3WCMA 5B03A 1RTRA 4NFJF 3KRCB 5DGMF 4LTVA 4LLTA 5IVGA 1KIZA 3OABB 3IPIA 5E8LA 4JZXA 4LA5A 2Q9ZA 3ZMBA 3ADZA 1UBWA 3TS7A 3WEHA 3AQBB 3ID0A 3KRAB 3P41A 1JFAA 4LIXA 4NKEA 5HN7A 5IK6A 4LA6A 5IMIA 3LEEA 5IN8A 4LLSA 2ZEUA 5B0JA 4H5EF 1RQIA 3LSNA 5C05A 2RAHA 2E95A 5IK9A 3N49F 4MC8A 3PYAA 2Z78A 4FJQA 1YHLA 4LZ0A 5A0KA 3ASXA 1EZFA 4KQSA 4N1ZF 3WCFA 1WY0A 2E8XA 5IMNA 3WEKA 2Z4YA 1V4KA 3KROA 5B0IA 3OACA 2PS5A 2J5CA 4Q23A 1YYQA 2E8VA 3SDRA 1UBYA 3WSAA 2ZEVA 3WCHA 1DI1A 3WE9A 5IK0A 4RNQA 3RMGA 3V1VA 1KIYA 3NRIA 1PS1A 1WL2A 3KRPA 5A0JA 4E9ZA 4GA3A 4DEMF 3AE0A 4EA0A 3ACXA 3P5PA 3WSBA 4ZQ8A 2E94A 2EWGA 2AZLA 1WL3A 3MAVA 5KSXF 3PH7A 1V4EA 5H9DA 2AELA 2OA6A 1YJ4A 5IKHA 3Q1OA 4E9UA 4EA1A 2F94F 4JVJF 1VG4A 3CP6A 2E91A 2O1OA 2Q9YA 3S9VA 3SDVA 3QQVA 5JV0F 3N1WF 4KVWA 1HXCA 4LFGA 2OPMA 4QPFA 1YHMA 4HD1A 5DIQF 3VJEA 5IM1A 4RXCA 3V1XA 3IBAA 4KQUA 1YYRA 1WMWA 1VG6A 3Q2ZA 3WCIA 4JYXA 4JXNA 3LJIA 4F6VA 4F62A 5B0LA 4PVYF 4LPGF 3N5JF 2Z4VA 3N45F 3TFVA 3ICKA 3N6KF 2PS7A 1YHKA 5AELA 4LPHF 3WEIA 2Z7HA 4KPJA 3ICMA 3OYRA 3LMDA 4DI5A 3WCCA 4KKMA 1RQJA 3KBKA 3WC9A 4LXWA 3ICNA 5IKAA 3ZCDA 3ZOUA 4NKFA 4LFVF 4DWBA 5CG5A 4RXAA 1FPSA 2J1OA 3LG5A 3LOMA 2Q58A 3WJNA 2Z50A 1WL0A 2Z4ZA 4LOBA 2ONGA 1HM7A 3SDQA 1HXAA 2E8UA 5DJRF 4K10A 5DHIA 4GP2A 3KB9A 4OGUA 4H5DF 1N20A 4GP1A 4NFKF 5I1UA 5IMPA 3LGZB 3LGKA 3WEJA 1V4HA 1VG3A 1YV5A 2ZCSA 3WCEA 4WK5A 3EGTA 1V4IA 4RXEA 3AQ0A 3M02A 3NF2A 5DGSF 3EFQA 3KROB 3G4DA 4NG6A 3OACB 4E1EA 1UBXA 5DZ2A 4P0WA 3VJAA 3MZVA 5ILZA 3NPRA 3M9UA 2AZKA 1ZW5A 3RBMA 1UBVA 3AQCB 4N9UA 3PKOA 3ZMCA 3Q2QA 2E8WA 3P8RA 5IL3A 1HX9A 3N3DA 5AHUB 2P1CA 2E8TA 3KRPB 3ACYA 3W7FA 1N21A 4KFAA 3VJ9A
chains in the Genus database with same CATH topology
5B0KA 5ILYA 4OKZA 5B01A 5CG6A 4P0XA 2Q80A 3N3LF 2FTZA 3N5HF 4LUUA 2ZCRA 4DHDA 5B02A 3EZ3A 3G4FA 3P5RA 2F8CF 2VF6A 2Z4WA 2ONHA 3KRFA 3RYEA 4KQ5A 4MC0A 1VG2A 2FORA 3WCBA 3KRCA 2J1PA 3PDEA 4KUXA 5JA0F 3SAEA 1YYUA 3ZL6A 4LZ3A 1VG7A 1WKZA 2Z4XA 3OABA 3LK5A 4NFIF 3BNXA 3DYHA 4OMHA 2E4OA 4P0VA 5DW7A 5EROA 2QISA 2F8ZF 1N1ZA 5ER8A 3CC9A 3M0GA 3WEFA 3M01A 3KRAA 1N23A 2AZJA 2ZCQA 3LDWA 4EA2A 5EATA 2PS6A 4KK2A 4RYPA 3VJBA 5AFXA 4KVIA 5DJVF 4DXJA 3BNYA 5EAUA 5JV2F 3S4JA 2E90A 5ILIA 1N24A 3LLWA 4L2XF 5DHKA 4OMGA 5DGNF 3VJDA 5E8HA 3TFPA 3M00A 2H8OA 3SDUA 3APZA 2I19A 5HN8A 4DWGA 2OPNA 3LVSA 4XQTF 4JZBA 5E8KA 5IL8A 5HN9A 1HM4A 3CKEA 3N0FA 4NUAA 3PYBA 2F9KF 4H5CF 3WCLA 1WL1A 4LTZA 3WCDA 4GAXA 4JXYA 4KVYA 3UCAA 1HXGA 3N1VF 1YYTA 3N0GA 2F7MF 2E93A 5ERNA 4OKMA 4KWDA 3NPKA 3WCAA 2Z52A 5JV1F 5JUZF 1YQ7A 3QKCA 3WCGA 3V66A 4XQSF 3WJOA 5HNAA 4XQRF 2OGDA 3VJ8A 5ILJA 2PS4A 3ICZA 3Q30A 5ERMA 3VJCA 1JFGA 1N1BA 1YYSA 4KPDA 4MC3A 3B7LA 5DJPF 4QXSF 5B0MA 3DYGA 2F92F 3DYFA 4UMJA 3WEGA 4F6XA 3RYWA 4LFEA 3WCJA 4DZWA 3P8LA 2Z7IA 5EASA 1V4JA 3TC1A 4PVXF 2DH4A 3LZ9A 5ILKA 2PS8A 5AYPA 5ILHA 3WJKA 2AEKA 2E92A 2ZCOA 1DGPA 4RXDA 5A0IA 2F89F 5B00A 2AETA 3KRFB 4KVDA 3SDTA 1N22A 3N46F 2ZY1A 5ILDA 3TFNA 3ACWA 4FP4A 4LZCA 3WCMA 5B03A 1RTRA 4NFJF 3KRCB 5DGMF 4LTVA 4LLTA 5IVGA 1KIZA 3OABB 3IPIA 5E8LA 4JZXA 4LA5A 2Q9ZA 3ZMBA 3ADZA 1UBWA 3TS7A 3WEHA 3AQBB 3ID0A 3KRAB 3P41A 1JFAA 4LIXA 4NKEA 5HN7A 5IK6A 4LA6A 5IMIA 3LEEA 5IN8A 4LLSA 2ZEUA 5B0JA 4H5EF 1RQIA 3LSNA 5C05A 2RAHA 2E95A 5IK9A 3N49F 4MC8A 3PYAA 2Z78A 4FJQA 1YHLA 4LZ0A 5A0KA 3ASXA 1EZFA 4KQSA 4N1ZF 3WCFA 1WY0A 2E8XA 5IMNA 3WEKA 2Z4YA 1V4KA 3KROA 5B0IA 3OACA 2PS5A 2J5CA 4Q23A 1YYQA 2E8VA 3SDRA 1UBYA 3WSAA 2ZEVA 3WCHA 1DI1A 3WE9A 5IK0A 4RNQA 3RMGA 3V1VA 1KIYA 3NRIA 1PS1A 1WL2A 3KRPA 5A0JA 4E9ZA 4GA3A 4DEMF 3AE0A 4EA0A 3ACXA 3P5PA 3WSBA 4ZQ8A 2E94A 2EWGA 2AZLA 1WL3A 3MAVA 5KSXF 3PH7A 1V4EA 5H9DA 2AELA 2OA6A 1YJ4A 5IKHA 3Q1OA 4E9UA 4EA1A 2F94F 4JVJF 1VG4A 3CP6A 2E91A 2O1OA 2Q9YA 3S9VA 3SDVA 3QQVA 5JV0F 3N1WF 4KVWA 1HXCA 4LFGA 2OPMA 4QPFA 1YHMA 4HD1A 5DIQF 3VJEA 5IM1A 4RXCA 3V1XA 3IBAA 4KQUA 1YYRA 1WMWA 1VG6A 3Q2ZA 3WCIA 4JYXA 4JXNA 3LJIA 4F6VA 4F62A 5B0LA 4PVYF 4LPGF 3N5JF 2Z4VA 3N45F 3TFVA 3ICKA 3N6KF 2PS7A 1YHKA 5AELA 4LPHF 3WEIA 2Z7HA 4KPJA 3ICMA 3OYRA 3LMDA 4DI5A 3WCCA 4KKMA 1RQJA 3KBKA 3WC9A 4LXWA 3ICNA 5IKAA 3ZCDA 3ZOUA 4NKFA 4LFVF 4DWBA 5CG5A 4RXAA 1FPSA 2J1OA 3LG5A 3LOMA 2Q58A 3WJNA 2Z50A 1WL0A 2Z4ZA 4LOBA 2ONGA 1HM7A 3SDQA 1HXAA 2E8UA 5DJRF 4K10A 5DHIA 4GP2A 3KB9A 4OGUA 4H5DF 1N20A 4GP1A 4NFKF 5I1UA 5IMPA 3LGZB 3LGKA 3WEJA 1V4HA 1VG3A 1YV5A 2ZCSA 3WCEA 4WK5A 3EGTA 1V4IA 4RXEA 3AQ0A 3M02A 3NF2A 5DGSF 3EFQA 3KROB 3G4DA 4NG6A 3OACB 4E1EA 1UBXA 5DZ2A 4P0WA 3VJAA 3MZVA 5ILZA 3NPRA 3M9UA 2AZKA 1ZW5A 3RBMA 1UBVA 3AQCB 4N9UA 3PKOA 3ZMCA 3Q2QA 2E8WA 3P8RA 5IL3A 1HX9A 3N3DA 5AHUB 2P1CA 2E8TA 3KRPB 3ACYA 3W7FA 1N21A 4KFAA 3VJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0K A;  5ILY A;  4OKZ A;  5B01 A;  5CG6 A;  4P0X A;  2Q80 A;  3N3L F;  2FTZ A;  3N5H F;  4LUU A;  2ZCR A;  4DHD A;  5B02 A;  3EZ3 A;  3G4F A;  3P5R A;  2F8C F;  2VF6 A;  2Z4W A;  2ONH A;  3KRF A;  3RYE A;  4KQ5 A;  4MC0 A;  1VG2 A;  2FOR A;  3WCB A;  3KRC A;  2J1P A;  3PDE A;  4KUX A;  5JA0 F;  3SAE A;  1YYU A;  3ZL6 A;  4LZ3 A;  1VG7 A;  1WKZ A;  2Z4X A;  3OAB A;  3LK5 A;  4NFI F;  3BNX A;  3DYH A;  4OMH A;  2E4O A;  4P0V A;  5DW7 A;  5ERO A;  2QIS A;  2F8Z F;  1N1Z A;  5ER8 A;  3CC9 A;  3M0G A;  3WEF A;  3M01 A;  3KRA A;  1N23 A;  2AZJ A;  2ZCQ A;  3LDW A;  4EA2 A;  5EAT A;  2PS6 A;  4KK2 A;  4RYP A;  3VJB A;  5AFX A;  4KVI A;  5DJV F;  4DXJ A;  3BNY A;  5EAU A;  5JV2 F;  3S4J A;  2E90 A;  5ILI A;  1N24 A;  3LLW A;  4L2X F;  5DHK A;  4OMG A;  5DGN F;  3VJD A;  5E8H A;  3TFP A;  3M00 A;  2H8O A;  3SDU A;  3APZ A;  2I19 A;  5HN8 A;  4DWG A;  2OPN A;  3LVS A;  4XQT F;  4JZB A;  5E8K A;  5IL8 A;  5HN9 A;  1HM4 A;  3CKE A;  3N0F A;  4NUA A;  3PYB A;  2F9K F;  4H5C F;  3WCL A;  1WL1 A;  4LTZ A;  3WCD A;  4GAX A;  4JXY A;  4KVY A;  3UCA A;  1HXG A;  3N1V F;  1YYT A;  3N0G A;  2F7M F;  2E93 A;  5ERN A;  4OKM A;  4KWD A;  3NPK A;  3WCA A;  2Z52 A;  5JV1 F;  5JUZ F;  1YQ7 A;  3QKC A;  3WCG A;  3V66 A;  4XQS F;  3WJO A;  5HNA A;  4XQR F;  2OGD A;  3VJ8 A;  5ILJ A;  2PS4 A;  3ICZ A;  3Q30 A;  5ERM A;  3VJC A;  1JFG A;  1N1B A;  1YYS A;  4KPD A;  4MC3 A;  3B7L A;  5DJP F;  4QXS F;  5B0M A;  3DYG A;  2F92 F;  3DYF A;  4UMJ A;  3WEG A;  4F6X A;  3RYW A;  4LFE A;  3WCJ A;  4DZW A;  3P8L A;  2Z7I A;  5EAS A;  1V4J A;  3TC1 A;  4PVX F;  2DH4 A;  3LZ9 A;  5ILK A;  2PS8 A;  5AYP A;  5ILH A;  3WJK A;  2AEK A;  2E92 A;  2ZCO A;  1DGP A;  4RXD A;  5A0I A;  2F89 F;  5B00 A;  2AET A;  3KRF B;  4KVD A;  3SDT A;  1N22 A;  3N46 F;  2ZY1 A;  5ILD A;  3TFN A;  3ACW A;  4FP4 A;  4LZC A;  3WCM A;  5B03 A;  1RTR A;  4NFJ F;  3KRC B;  5DGM F;  4LTV A;  4LLT A;  5IVG A;  1KIZ A;  3OAB B;  3IPI A;  5E8L A;  4JZX A;  4LA5 A;  2Q9Z A;  3ZMB A;  3ADZ A;  1UBW A;  3TS7 A;  3WEH A;  3AQB B;  3ID0 A;  3KRA B;  3P41 A;  1JFA A;  4LIX A;  4NKE A;  5HN7 A;  5IK6 A;  4LA6 A;  5IMI A;  3LEE A;  5IN8 A;  4LLS A;  2ZEU A;  5B0J A;  4H5E F;  1RQI A;  3LSN A;  5C05 A;  2RAH A;  2E95 A;  5IK9 A;  3N49 F;  4MC8 A;  3PYA A;  2Z78 A;  4FJQ A;  1YHL A;  4LZ0 A;  5A0K A;  3ASX A;  1EZF A;  4KQS A;  4N1Z F;  3WCF A;  1WY0 A;  2E8X A;  5IMN A;  3WEK A;  2Z4Y A;  1V4K A;  3KRO A;  5B0I A;  3OAC A;  2PS5 A;  2J5C A;  4Q23 A;  1YYQ A;  2E8V A;  3SDR A;  1UBY A;  3WSA A;  2ZEV A;  3WCH A;  1DI1 A;  3WE9 A;  5IK0 A;  4RNQ A;  3RMG A;  3V1V A;  1KIY A;  3NRI A;  1PS1 A;  1WL2 A;  3KRP A;  5A0J A;  4E9Z A;  4GA3 A;  4DEM F;  3AE0 A;  4EA0 A;  3ACX A;  3P5P A;  3WSB A;  4ZQ8 A;  2E94 A;  2EWG A;  2AZL A;  1WL3 A;  3MAV A;  5KSX F;  3PH7 A;  1V4E A;  5H9D A;  2AEL A;  2OA6 A;  1YJ4 A;  5IKH A;  3Q1O A;  4E9U A;  4EA1 A;  2F94 F;  4JVJ F;  1VG4 A;  3CP6 A;  2E91 A;  2O1O A;  2Q9Y A;  3S9V A;  3SDV A;  3QQV A;  5JV0 F;  3N1W F;  4KVW A;  1HXC A;  4LFG A;  2OPM A;  4QPF A;  1YHM A;  4HD1 A;  5DIQ F;  3VJE A;  5IM1 A;  4RXC A;  3V1X A;  3IBA A;  4KQU A;  1YYR A;  1WMW A;  1VG6 A;  3Q2Z A;  3WCI A;  4JYX A;  4JXN A;  3LJI A;  4F6V A;  4F62 A;  5B0L A;  4PVY F;  4LPG F;  3N5J F;  2Z4V A;  3N45 F;  3TFV A;  3ICK A;  3N6K F;  2PS7 A;  1YHK A;  5AEL A;  4LPH F;  3WEI A;  2Z7H A;  4KPJ A;  3ICM A;  3OYR A;  3LMD A;  4DI5 A;  3WCC A;  4KKM A;  1RQJ A;  3KBK A;  3WC9 A;  4LXW A;  3ICN A;  5IKA A;  3ZCD A;  3ZOU A;  4NKF A;  4LFV F;  4DWB A;  5CG5 A;  4RXA A;  1FPS A;  2J1O A;  3LG5 A;  3LOM A;  2Q58 A;  3WJN A;  2Z50 A;  1WL0 A;  2Z4Z A;  4LOB A;  2ONG A;  1HM7 A;  3SDQ A;  1HXA A;  2E8U A;  5DJR F;  4K10 A;  5DHI A;  4GP2 A;  3KB9 A;  4OGU A;  4H5D F;  1N20 A;  4GP1 A;  4NFK F;  5I1U A;  5IMP A;  3LGZ B;  3LGK A;  3WEJ A;  1V4H A;  1VG3 A;  1YV5 A;  2ZCS A;  3WCE A;  4WK5 A;  3EGT A;  1V4I A;  4RXE A;  3AQ0 A;  3M02 A;  3NF2 A;  5DGS F;  3EFQ A;  3KRO B;  3G4D A;  4NG6 A;  3OAC B;  4E1E A;  1UBX A;  5DZ2 A;  4P0W A;  3VJA A;  3MZV A;  5ILZ A;  3NPR A;  3M9U A;  2AZK A;  1ZW5 A;  3RBM A;  1UBV A;  3AQC B;  4N9U A;  3PKO A;  3ZMC A;  3Q2Q A;  2E8W A;  3P8R A;  5IL3 A;  1HX9 A;  3N3D A;  5AHU B;  2P1C A;  2E8T A;  3KRP B;  3ACY A;  3W7F A;  1N21 A;  4KFA A;  3VJ9 A; 
#chains in the Genus database with same CATH topology
 5B0K A;  5ILY A;  4OKZ A;  5B01 A;  5CG6 A;  4P0X A;  2Q80 A;  3N3L F;  2FTZ A;  3N5H F;  4LUU A;  2ZCR A;  4DHD A;  5B02 A;  3EZ3 A;  3G4F A;  3P5R A;  2F8C F;  2VF6 A;  2Z4W A;  2ONH A;  3KRF A;  3RYE A;  4KQ5 A;  4MC0 A;  1VG2 A;  2FOR A;  3WCB A;  3KRC A;  2J1P A;  3PDE A;  4KUX A;  5JA0 F;  3SAE A;  1YYU A;  3ZL6 A;  4LZ3 A;  1VG7 A;  1WKZ A;  2Z4X A;  3OAB A;  3LK5 A;  4NFI F;  3BNX A;  3DYH A;  4OMH A;  2E4O A;  4P0V A;  5DW7 A;  5ERO A;  2QIS A;  2F8Z F;  1N1Z A;  5ER8 A;  3CC9 A;  3M0G A;  3WEF A;  3M01 A;  3KRA A;  1N23 A;  2AZJ A;  2ZCQ A;  3LDW A;  4EA2 A;  5EAT A;  2PS6 A;  4KK2 A;  4RYP A;  3VJB A;  5AFX A;  4KVI A;  5DJV F;  4DXJ A;  3BNY A;  5EAU A;  5JV2 F;  3S4J A;  2E90 A;  5ILI A;  1N24 A;  3LLW A;  4L2X F;  5DHK A;  4OMG A;  5DGN F;  3VJD A;  5E8H A;  3TFP A;  3M00 A;  2H8O A;  3SDU A;  3APZ A;  2I19 A;  5HN8 A;  4DWG A;  2OPN A;  3LVS A;  4XQT F;  4JZB A;  5E8K A;  5IL8 A;  5HN9 A;  1HM4 A;  3CKE A;  3N0F A;  4NUA A;  3PYB A;  2F9K F;  4H5C F;  3WCL A;  1WL1 A;  4LTZ A;  3WCD A;  4GAX A;  4JXY A;  4KVY A;  3UCA A;  1HXG A;  3N1V F;  1YYT A;  3N0G A;  2F7M F;  2E93 A;  5ERN A;  4OKM A;  4KWD A;  3NPK A;  3WCA A;  2Z52 A;  5JV1 F;  5JUZ F;  1YQ7 A;  3QKC A;  3WCG A;  3V66 A;  4XQS F;  3WJO A;  5HNA A;  4XQR F;  2OGD A;  3VJ8 A;  5ILJ A;  2PS4 A;  3ICZ A;  3Q30 A;  5ERM A;  3VJC A;  1JFG A;  1N1B A;  1YYS A;  4KPD A;  4MC3 A;  3B7L A;  5DJP F;  4QXS F;  5B0M A;  3DYG A;  2F92 F;  3DYF A;  4UMJ A;  3WEG A;  4F6X A;  3RYW A;  4LFE A;  3WCJ A;  4DZW A;  3P8L A;  2Z7I A;  5EAS A;  1V4J A;  3TC1 A;  4PVX F;  2DH4 A;  3LZ9 A;  5ILK A;  2PS8 A;  5AYP A;  5ILH A;  3WJK A;  2AEK A;  2E92 A;  2ZCO A;  1DGP A;  4RXD A;  5A0I A;  2F89 F;  5B00 A;  2AET A;  3KRF B;  4KVD A;  3SDT A;  1N22 A;  3N46 F;  2ZY1 A;  5ILD A;  3TFN A;  3ACW A;  4FP4 A;  4LZC A;  3WCM A;  5B03 A;  1RTR A;  4NFJ F;  3KRC B;  5DGM F;  4LTV A;  4LLT A;  5IVG A;  1KIZ A;  3OAB B;  3IPI A;  5E8L A;  4JZX A;  4LA5 A;  2Q9Z A;  3ZMB A;  3ADZ A;  1UBW A;  3TS7 A;  3WEH A;  3AQB B;  3ID0 A;  3KRA B;  3P41 A;  1JFA A;  4LIX A;  4NKE A;  5HN7 A;  5IK6 A;  4LA6 A;  5IMI A;  3LEE A;  5IN8 A;  4LLS A;  2ZEU A;  5B0J A;  4H5E F;  1RQI A;  3LSN A;  5C05 A;  2RAH A;  2E95 A;  5IK9 A;  3N49 F;  4MC8 A;  3PYA A;  2Z78 A;  4FJQ A;  1YHL A;  4LZ0 A;  5A0K A;  3ASX A;  1EZF A;  4KQS A;  4N1Z F;  3WCF A;  1WY0 A;  2E8X A;  5IMN A;  3WEK A;  2Z4Y A;  1V4K A;  3KRO A;  5B0I A;  3OAC A;  2PS5 A;  2J5C A;  4Q23 A;  1YYQ A;  2E8V A;  3SDR A;  1UBY A;  3WSA A;  2ZEV A;  3WCH A;  1DI1 A;  3WE9 A;  5IK0 A;  4RNQ A;  3RMG A;  3V1V A;  1KIY A;  3NRI A;  1PS1 A;  1WL2 A;  3KRP A;  5A0J A;  4E9Z A;  4GA3 A;  4DEM F;  3AE0 A;  4EA0 A;  3ACX A;  3P5P A;  3WSB A;  4ZQ8 A;  2E94 A;  2EWG A;  2AZL A;  1WL3 A;  3MAV A;  5KSX F;  3PH7 A;  1V4E A;  5H9D A;  2AEL A;  2OA6 A;  1YJ4 A;  5IKH A;  3Q1O A;  4E9U A;  4EA1 A;  2F94 F;  4JVJ F;  1VG4 A;  3CP6 A;  2E91 A;  2O1O A;  2Q9Y A;  3S9V A;  3SDV A;  3QQV A;  5JV0 F;  3N1W F;  4KVW A;  1HXC A;  4LFG A;  2OPM A;  4QPF A;  1YHM A;  4HD1 A;  5DIQ F;  3VJE A;  5IM1 A;  4RXC A;  3V1X A;  3IBA A;  4KQU A;  1YYR A;  1WMW A;  1VG6 A;  3Q2Z A;  3WCI A;  4JYX A;  4JXN A;  3LJI A;  4F6V A;  4F62 A;  5B0L A;  4PVY F;  4LPG F;  3N5J F;  2Z4V A;  3N45 F;  3TFV A;  3ICK A;  3N6K F;  2PS7 A;  1YHK A;  5AEL A;  4LPH F;  3WEI A;  2Z7H A;  4KPJ A;  3ICM A;  3OYR A;  3LMD A;  4DI5 A;  3WCC A;  4KKM A;  1RQJ A;  3KBK A;  3WC9 A;  4LXW A;  3ICN A;  5IKA A;  3ZCD A;  3ZOU A;  4NKF A;  4LFV F;  4DWB A;  5CG5 A;  4RXA A;  1FPS A;  2J1O A;  3LG5 A;  3LOM A;  2Q58 A;  3WJN A;  2Z50 A;  1WL0 A;  2Z4Z A;  4LOB A;  2ONG A;  1HM7 A;  3SDQ A;  1HXA A;  2E8U A;  5DJR F;  4K10 A;  5DHI A;  4GP2 A;  3KB9 A;  4OGU A;  4H5D F;  1N20 A;  4GP1 A;  4NFK F;  5I1U A;  5IMP A;  3LGZ B;  3LGK A;  3WEJ A;  1V4H A;  1VG3 A;  1YV5 A;  2ZCS A;  3WCE A;  4WK5 A;  3EGT A;  1V4I A;  4RXE A;  3AQ0 A;  3M02 A;  3NF2 A;  5DGS F;  3EFQ A;  3KRO B;  3G4D A;  4NG6 A;  3OAC B;  4E1E A;  1UBX A;  5DZ2 A;  4P0W A;  3VJA A;  3MZV A;  5ILZ A;  3NPR A;  3M9U A;  2AZK A;  1ZW5 A;  3RBM A;  1UBV A;  3AQC B;  4N9U A;  3PKO A;  3ZMC A;  3Q2Q A;  2E8W A;  3P8R A;  5IL3 A;  1HX9 A;  3N3D A;  5AHU B;  2P1C A;  2E8T A;  3KRP B;  3ACY A;  3W7F A;  1N21 A;  4KFA A;  3VJ9 A; 
#chains in the Genus database with same CATH homology
 5B0K A;  5ILY A;  4OKZ A;  5B01 A;  5CG6 A;  4P0X A;  2Q80 A;  3N3L F;  2FTZ A;  3N5H F;  4LUU A;  2ZCR A;  4DHD A;  5B02 A;  3EZ3 A;  3G4F A;  3P5R A;  2F8C F;  2VF6 A;  2Z4W A;  2ONH A;  3KRF A;  3RYE A;  4KQ5 A;  4MC0 A;  1VG2 A;  2FOR A;  3WCB A;  3KRC A;  2J1P A;  3PDE A;  4KUX A;  5JA0 F;  3SAE A;  1YYU A;  3ZL6 A;  4LZ3 A;  1VG7 A;  1WKZ A;  2Z4X A;  3OAB A;  3LK5 A;  4NFI F;  3BNX A;  3DYH A;  4OMH A;  2E4O A;  4P0V A;  5DW7 A;  5ERO A;  2QIS A;  2F8Z F;  1N1Z A;  5ER8 A;  3CC9 A;  3M0G A;  3WEF A;  3M01 A;  3KRA A;  1N23 A;  2AZJ A;  2ZCQ A;  3LDW A;  4EA2 A;  5EAT A;  2PS6 A;  4KK2 A;  4RYP A;  3VJB A;  5AFX A;  4KVI A;  5DJV F;  4DXJ A;  3BNY A;  5EAU A;  5JV2 F;  3S4J A;  2E90 A;  5ILI A;  1N24 A;  3LLW A;  4L2X F;  5DHK A;  4OMG A;  5DGN F;  3VJD A;  5E8H A;  3TFP A;  3M00 A;  2H8O A;  3SDU A;  3APZ A;  2I19 A;  5HN8 A;  4DWG A;  2OPN A;  3LVS A;  4XQT F;  4JZB A;  5E8K A;  5IL8 A;  5HN9 A;  1HM4 A;  3CKE A;  3N0F A;  4NUA A;  3PYB A;  2F9K F;  4H5C F;  3WCL A;  1WL1 A;  4LTZ A;  3WCD A;  4GAX A;  4JXY A;  4KVY A;  3UCA A;  1HXG A;  3N1V F;  1YYT A;  3N0G A;  2F7M F;  2E93 A;  5ERN A;  4OKM A;  4KWD A;  3NPK A;  3WCA A;  2Z52 A;  5JV1 F;  5JUZ F;  1YQ7 A;  3QKC A;  3WCG A;  3V66 A;  4XQS F;  3WJO A;  5HNA A;  4XQR F;  2OGD A;  3VJ8 A;  5ILJ A;  2PS4 A;  3ICZ A;  3Q30 A;  5ERM A;  3VJC A;  1JFG A;  1N1B A;  1YYS A;  4KPD A;  4MC3 A;  3B7L A;  5DJP F;  4QXS F;  5B0M A;  3DYG A;  2F92 F;  3DYF A;  4UMJ A;  3WEG A;  4F6X A;  3RYW A;  4LFE A;  3WCJ A;  4DZW A;  3P8L A;  2Z7I A;  5EAS A;  1V4J A;  3TC1 A;  4PVX F;  2DH4 A;  3LZ9 A;  5ILK A;  2PS8 A;  5AYP A;  5ILH A;  3WJK A;  2AEK A;  2E92 A;  2ZCO A;  1DGP A;  4RXD A;  5A0I A;  2F89 F;  5B00 A;  2AET A;  3KRF B;  4KVD A;  3SDT A;  1N22 A;  3N46 F;  2ZY1 A;  5ILD A;  3TFN A;  3ACW A;  4FP4 A;  4LZC A;  3WCM A;  5B03 A;  1RTR A;  4NFJ F;  3KRC B;  5DGM F;  4LTV A;  4LLT A;  5IVG A;  1KIZ A;  3OAB B;  3IPI A;  5E8L A;  4JZX A;  4LA5 A;  2Q9Z A;  3ZMB A;  3ADZ A;  1UBW A;  3TS7 A;  3WEH A;  3AQB B;  3ID0 A;  3KRA B;  3P41 A;  1JFA A;  4LIX A;  4NKE A;  5HN7 A;  5IK6 A;  4LA6 A;  5IMI A;  3LEE A;  5IN8 A;  4LLS A;  2ZEU A;  5B0J A;  4H5E F;  1RQI A;  3LSN A;  5C05 A;  2RAH A;  2E95 A;  5IK9 A;  3N49 F;  4MC8 A;  3PYA A;  2Z78 A;  4FJQ A;  1YHL A;  4LZ0 A;  5A0K A;  3ASX A;  1EZF A;  4KQS A;  4N1Z F;  3WCF A;  1WY0 A;  2E8X A;  5IMN A;  3WEK A;  2Z4Y A;  1V4K A;  3KRO A;  5B0I A;  3OAC A;  2PS5 A;  2J5C A;  4Q23 A;  1YYQ A;  2E8V A;  3SDR A;  1UBY A;  3WSA A;  2ZEV A;  3WCH A;  1DI1 A;  3WE9 A;  5IK0 A;  4RNQ A;  3RMG A;  3V1V A;  1KIY A;  3NRI A;  1PS1 A;  1WL2 A;  3KRP A;  5A0J A;  4E9Z A;  4GA3 A;  4DEM F;  3AE0 A;  4EA0 A;  3ACX A;  3P5P A;  3WSB A;  4ZQ8 A;  2E94 A;  2EWG A;  2AZL A;  1WL3 A;  3MAV A;  5KSX F;  3PH7 A;  1V4E A;  5H9D A;  2AEL A;  2OA6 A;  1YJ4 A;  5IKH A;  3Q1O A;  4E9U A;  4EA1 A;  2F94 F;  4JVJ F;  1VG4 A;  3CP6 A;  2E91 A;  2O1O A;  2Q9Y A;  3S9V A;  3SDV A;  3QQV A;  5JV0 F;  3N1W F;  4KVW A;  1HXC A;  4LFG A;  2OPM A;  4QPF A;  1YHM A;  4HD1 A;  5DIQ F;  3VJE A;  5IM1 A;  4RXC A;  3V1X A;  3IBA A;  4KQU A;  1YYR A;  1WMW A;  1VG6 A;  3Q2Z A;  3WCI A;  4JYX A;  4JXN A;  3LJI A;  4F6V A;  4F62 A;  5B0L A;  4PVY F;  4LPG F;  3N5J F;  2Z4V A;  3N45 F;  3TFV A;  3ICK A;  3N6K F;  2PS7 A;  1YHK A;  5AEL A;  4LPH F;  3WEI A;  2Z7H A;  4KPJ A;  3ICM A;  3OYR A;  3LMD A;  4DI5 A;  3WCC A;  4KKM A;  1RQJ A;  3KBK A;  3WC9 A;  4LXW A;  3ICN A;  5IKA A;  3ZCD A;  3ZOU A;  4NKF A;  4LFV F;  4DWB A;  5CG5 A;  4RXA A;  1FPS A;  2J1O A;  3LG5 A;  3LOM A;  2Q58 A;  3WJN A;  2Z50 A;  1WL0 A;  2Z4Z A;  4LOB A;  2ONG A;  1HM7 A;  3SDQ A;  1HXA A;  2E8U A;  5DJR F;  4K10 A;  5DHI A;  4GP2 A;  3KB9 A;  4OGU A;  4H5D F;  1N20 A;  4GP1 A;  4NFK F;  5I1U A;  5IMP A;  3LGZ B;  3LGK A;  3WEJ A;  1V4H A;  1VG3 A;  1YV5 A;  2ZCS A;  3WCE A;  4WK5 A;  3EGT A;  1V4I A;  4RXE A;  3AQ0 A;  3M02 A;  3NF2 A;  5DGS F;  3EFQ A;  3KRO B;  3G4D A;  4NG6 A;  3OAC B;  4E1E A;  1UBX A;  5DZ2 A;  4P0W A;  3VJA A;  3MZV A;  5ILZ A;  3NPR A;  3M9U A;  2AZK A;  1ZW5 A;  3RBM A;  1UBV A;  3AQC B;  4N9U A;  3PKO A;  3ZMC A;  3Q2Q A;  2E8W A;  3P8R A;  5IL3 A;  1HX9 A;  3N3D A;  5AHU B;  2P1C A;  2E8T A;  3KRP B;  3ACY A;  3W7F A;  1N21 A;  4KFA A;  3VJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...