3KRCB

Mint heterotetrameric geranyl pyrophosphate synthase in complex with ipp
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGFHGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranyl diphosphate synthase large subunit
publication title Structure of a heterotetrameric geranyl pyrophosphate synthase from mint (Mentha piperita) reveals intersubunit regulation
pubmed doi rcsb
source organism Mentha x piperita
molecule tags Transferase
total genus 99
structure length 259
sequence length 259
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2009-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3krcB00
3P41A 3VJEA 2E8VA 2PS8A 5B02A 1YJ4A 4F6VA 3RYEA 3ICKA 4N1ZF 5IK9A 4KKMA 5B0JA 3LMDA 2E95A 3WEHA 5DW7A 4OKMA 3ZCDA 3KBKA 3AE0A 4LUUA 1V4IA 3KROB 5EAUA 3M0GA 2PS7A 4RXCA 3KRPA 4DXJA 4QXSF 4MC8A 3M02A 4WK5A 3TS7A 5A0JA 5I1UA 5DJVF 3N3LF 5B00A 1VG2A 2Z4XA 4RNQA 5B01A 5ILIA 5ILKA 5A0KA 3G4FA 2ZY1A 3TFNA 3WCHA 3ACYA 4N9UA 3LOMA 4L2XF 3VJDA 3CKEA 1YQ7A 3WCCA 1V4EA 3N45F 3VJAA 3WSBA 3LDWA 5DJPF 4NG6A 5JUZF 3RMGA 3WCIA 1JFGA 3P5RA 4LFVF 4OGUA 3NF2A 4KVIA 1HXAA 1YYRA 4E9UA 3AQCB 2PS4A 5ILJA 3EZ3A 2E8TA 4GP1A 1V4HA 3LG5A 5JA0F 3Q30A 3LVSA 3Q2QA 5CG5A 3IPIA 3N6KF 1HM7A 4F62A 3NPRA 5IMPA 3WSAA 1UBVA 1PS1A 4NFKF 3P5PA 3ZMBA 5ER8A 4PVXF 5KSXF 3EGTA 4DHDA 4OMGA 4LZCA 4KQUA 3S9VA 3ASXA 5B0IA 2P1CA 3LSNA 1WL0A 1WKZA 2ONGA 3AQBB 5ILYA 3RYWA 5JV0F 1V4JA 4P0WA 5IKHA 3W7FA 2ZCRA 5IVGA 1N21A 3ZMCA 4LPHF 5ILDA 1YHLA 2Z52A 3ICNA 4Q23A 5HN8A 1VG4A 5AYPA 4JZXA 2FTZA 4DZWA 3G4DA 2ZEUA 4XQTF 5DGSF 1VG7A 4NUAA 4DI5A 4PVYF 4LOBA 3N3DA 3KRFA 5EASA 5DGNF 5CG6A 4LA5A 3OACA 4F6XA 2DH4A 3SDRA 1HXGA 3DYFA 5H9DA 2E4OA 3LEEA 5JV1F 3WEGA 3KRPB 3SDVA 2J5CA 2AETA 2E92A 4H5CF 3N1WF 3OABA 3N0FA 4LTZA 5AFXA 2E8XA 3M9UA 1VG3A 3WCGA 4FJQA 2F94F 4LXWA 1N1ZA 2Z4YA 5C05A 3LZ9A 4RXEA 2VF6A 4H5DF 4H5EF 5DZ2A 3PYBA 1V4KA 3DYHA 3ADZA 3WCFA 4LLSA 1FPSA 3V1VA 4KQSA 3WCMA 4NKFA 3VJBA 5B0MA 1RQJA 4RXDA 4K10A 5DJRF 3SDQA 2J1OA 3WJNA 4EA1A 4MC0A 3RBMA 3VJCA 1YYQA 4KFAA 4KK2A 2E8UA 3KRAB 5IM1A 2Z4ZA 3MAVA 4LIXA 1YYSA 2F8CF 1ZW5A 1HXCA 1HX9A 4LA6A 3PDEA 4E1EA 2E90A 2F9KF 5HNAA 1UBXA 3M01A 3LK5A 4UMJA 2Q58A 5IKAA 4OKZA 4LLTA 2F89F 5HN9A 2Q9ZA 3NPKA 3CC9A 3WE9A 2E94A 3Q1OA 2AELA 3BNXA 4P0VA 3PH7A 4LTVA 2ZCQA 2E93A 4LZ3A 4NFJF 3OYRA 3ZL6A 4KQ5A 3CP6A 5EROA 4E9ZA 5A0IA 3DYGA 5AHUB 4GA3A 3KRCA 4RYPA 1EZFA 3ID0A 5ERNA 3BNYA 4QPFA 3UCAA 3EFQA 3MZVA 3APZA 4KPDA 1DGPA 3ICMA 3ZOUA 2OGDA 2ONHA 3SDTA 5DIQF 3WCLA 5JV2F 2H8OA 2PS5A 4MC3A 4RXAA 3ACWA 1UBWA 3TFPA 4KVWA 2E91A 3IBAA 3KRFB 3M00A 1YYUA 3KROA 3OACB 2AZJA 2Q80A 3V1XA 4KPJA 4DWGA 4KVYA 3WJOA 2F8ZF 4LPGF 2QISA 4HD1A 2F7MF 1JFAA 2ZCSA 3KB9A 2ZCOA 3PKOA 4OMHA 3LJIA 1DI1A 3VJ8A 3P8LA 2O1OA 3N1VF 2EWGA 3P8RA 3WC9A 3WEKA 2Z78A 3ACXA 1WL3A 3QKCA 5B03A 3N5JF 3B7LA 5IMIA 3SAEA 3OABB 3VJ9A 3WEIA 3N5HF 4EA2A 4GAXA 2AZLA 3N46F 3N0GA 1YHKA 5E8HA 5DHKA 4LFGA 2Z7HA 4JXNA 4KUXA 4LFEA 3WEJA 5HN7A 4NKEA 5B0LA 3AQ0A 4P0XA 3S4JA 5B0KA 2OPNA 5ILZA 1N20A 2Q9YA 1HM4A 3WCDA 1KIYA 4JZBA 3Q2ZA 1RQIA 3N49F 1WL1A 5DGMF 4DWBA 3V66A 2OPMA 1RTRA 3TFVA 1N22A 3WCAA 3NRIA 4JXYA 4JYXA 3KRAA 1N24A 4ZQ8A 5EATA 4KWDA 3WJKA 2E8WA 3TC1A 3LGKA 2AZKA 2Z50A 4XQRF 4EA0A 3WEFA 3LGZB 1KIZA 2ZEVA 1WY0A 2Z4VA 4LZ0A 2F92F 5IK6A 3SDUA 1WL2A 4DEMF 5E8KA 2OA6A 5IL8A 4GP2A 4XQSF 3WCBA 5DHIA 2RAHA 1N23A 1UBYA 2Z7IA 1VG6A 3LLWA 3ICZA 5E8LA 2J1PA 4NFIF 5IL3A 1WMWA 3WCEA 2FORA 5IK0A 2I19A 2Z4WA 5AELA 1YHMA 1YV5A 1YYTA 3WCJA 2AEKA 3PYAA 4JVJF 5ERMA 1N1BA 3QQVA 2PS6A 5IMNA 5IN8A 4FP4A 3KRCB 5ILHA 4KVDA
chains in the Genus database with same CATH superfamily
3P41A 3VJEA 2E8VA 2PS8A 5B02A 1YJ4A 4F6VA 3RYEA 3ICKA 4N1ZF 5IK9A 4KKMA 5B0JA 3LMDA 2E95A 3WEHA 5DW7A 4OKMA 3ZCDA 3KBKA 3AE0A 4LUUA 1V4IA 3KROB 5EAUA 3M0GA 2PS7A 4RXCA 3KRPA 4DXJA 4QXSF 4MC8A 3M02A 4WK5A 3TS7A 5A0JA 5I1UA 5DJVF 3N3LF 5B00A 1VG2A 2Z4XA 4RNQA 5B01A 5ILIA 5ILKA 5A0KA 3G4FA 2ZY1A 3TFNA 3WCHA 3ACYA 4N9UA 3LOMA 4L2XF 3VJDA 3CKEA 1YQ7A 3WCCA 1V4EA 3N45F 3VJAA 3WSBA 3LDWA 5DJPF 4NG6A 5JUZF 3RMGA 3WCIA 1JFGA 3P5RA 4LFVF 4OGUA 3NF2A 4KVIA 1HXAA 1YYRA 4E9UA 3AQCB 2PS4A 5ILJA 3EZ3A 2E8TA 4GP1A 1V4HA 3LG5A 5JA0F 3Q30A 3LVSA 3Q2QA 5CG5A 3IPIA 3N6KF 1HM7A 4F62A 3NPRA 5IMPA 3WSAA 1UBVA 1PS1A 4NFKF 3P5PA 3ZMBA 5ER8A 4PVXF 5KSXF 3EGTA 4DHDA 4OMGA 4LZCA 4KQUA 3S9VA 3ASXA 5B0IA 2P1CA 3LSNA 1WL0A 1WKZA 2ONGA 3AQBB 5ILYA 3RYWA 5JV0F 1V4JA 4P0WA 5IKHA 3W7FA 2ZCRA 5IVGA 1N21A 3ZMCA 4LPHF 5ILDA 1YHLA 2Z52A 3ICNA 4Q23A 5HN8A 1VG4A 5AYPA 4JZXA 2FTZA 4DZWA 3G4DA 2ZEUA 4XQTF 5DGSF 1VG7A 4NUAA 4DI5A 4PVYF 4LOBA 3N3DA 3KRFA 5EASA 5DGNF 5CG6A 4LA5A 3OACA 4F6XA 2DH4A 3SDRA 1HXGA 3DYFA 5H9DA 2E4OA 3LEEA 5JV1F 3WEGA 3KRPB 3SDVA 2J5CA 2AETA 2E92A 4H5CF 3N1WF 3OABA 3N0FA 4LTZA 5AFXA 2E8XA 3M9UA 1VG3A 3WCGA 4FJQA 2F94F 4LXWA 1N1ZA 2Z4YA 5C05A 3LZ9A 4RXEA 2VF6A 4H5DF 4H5EF 5DZ2A 3PYBA 1V4KA 3DYHA 3ADZA 3WCFA 4LLSA 1FPSA 3V1VA 4KQSA 3WCMA 4NKFA 3VJBA 5B0MA 1RQJA 4RXDA 4K10A 5DJRF 3SDQA 2J1OA 3WJNA 4EA1A 4MC0A 3RBMA 3VJCA 1YYQA 4KFAA 4KK2A 2E8UA 3KRAB 5IM1A 2Z4ZA 3MAVA 4LIXA 1YYSA 2F8CF 1ZW5A 1HXCA 1HX9A 4LA6A 3PDEA 4E1EA 2E90A 2F9KF 5HNAA 1UBXA 3M01A 3LK5A 4UMJA 2Q58A 5IKAA 4OKZA 4LLTA 2F89F 5HN9A 2Q9ZA 3NPKA 3CC9A 3WE9A 2E94A 3Q1OA 2AELA 3BNXA 4P0VA 3PH7A 4LTVA 2ZCQA 2E93A 4LZ3A 4NFJF 3OYRA 3ZL6A 4KQ5A 3CP6A 5EROA 4E9ZA 5A0IA 3DYGA 5AHUB 4GA3A 3KRCA 4RYPA 1EZFA 3ID0A 5ERNA 3BNYA 4QPFA 3UCAA 3EFQA 3MZVA 3APZA 4KPDA 1DGPA 3ICMA 3ZOUA 2OGDA 2ONHA 3SDTA 5DIQF 3WCLA 5JV2F 2H8OA 2PS5A 4MC3A 4RXAA 3ACWA 1UBWA 3TFPA 4KVWA 2E91A 3IBAA 3KRFB 3M00A 1YYUA 3KROA 3OACB 2AZJA 2Q80A 3V1XA 4KPJA 4DWGA 4KVYA 3WJOA 2F8ZF 4LPGF 2QISA 4HD1A 2F7MF 1JFAA 2ZCSA 3KB9A 2ZCOA 3PKOA 4OMHA 3LJIA 1DI1A 3VJ8A 3P8LA 2O1OA 3N1VF 2EWGA 3P8RA 3WC9A 3WEKA 2Z78A 3ACXA 1WL3A 3QKCA 5B03A 3N5JF 3B7LA 5IMIA 3SAEA 3OABB 3VJ9A 3WEIA 3N5HF 4EA2A 4GAXA 2AZLA 3N46F 3N0GA 1YHKA 5E8HA 5DHKA 4LFGA 2Z7HA 4JXNA 4KUXA 4LFEA 3WEJA 5HN7A 4NKEA 5B0LA 3AQ0A 4P0XA 3S4JA 5B0KA 2OPNA 5ILZA 1N20A 2Q9YA 1HM4A 3WCDA 1KIYA 4JZBA 3Q2ZA 1RQIA 3N49F 1WL1A 5DGMF 4DWBA 3V66A 2OPMA 1RTRA 3TFVA 1N22A 3WCAA 3NRIA 4JXYA 4JYXA 3KRAA 1N24A 4ZQ8A 5EATA 4KWDA 3WJKA 2E8WA 3TC1A 3LGKA 2AZKA 2Z50A 4XQRF 4EA0A 3WEFA 3LGZB 1KIZA 2ZEVA 1WY0A 2Z4VA 4LZ0A 2F92F 5IK6A 3SDUA 1WL2A 4DEMF 5E8KA 2OA6A 5IL8A 4GP2A 4XQSF 3WCBA 5DHIA 2RAHA 1N23A 1UBYA 2Z7IA 1VG6A 3LLWA 3ICZA 5E8LA 2J1PA 4NFIF 5IL3A 1WMWA 3WCEA 2FORA 5IK0A 2I19A 2Z4WA 5AELA 1YHMA 1YV5A 1YYTA 3WCJA 2AEKA 3PYAA 4JVJF 5ERMA 1N1BA 3QQVA 2PS6A 5IMNA 5IN8A 4FP4A 3KRCB 5ILHA 4KVDA
chains in the Genus database with same CATH topology
3P41A 3VJEA 2E8VA 2PS8A 5B02A 1YJ4A 4F6VA 3RYEA 3ICKA 4N1ZF 5IK9A 4KKMA 5B0JA 3LMDA 2E95A 3WEHA 5DW7A 4OKMA 3ZCDA 3KBKA 3AE0A 4LUUA 1V4IA 3KROB 5EAUA 3M0GA 2PS7A 4RXCA 3KRPA 4DXJA 4QXSF 4MC8A 3M02A 4WK5A 3TS7A 5A0JA 5I1UA 5DJVF 3N3LF 5B00A 1VG2A 2Z4XA 4RNQA 5B01A 5ILIA 5ILKA 5A0KA 3G4FA 2ZY1A 3TFNA 3WCHA 3ACYA 4N9UA 3LOMA 4L2XF 3VJDA 3CKEA 1YQ7A 3WCCA 1V4EA 3N45F 3VJAA 3WSBA 3LDWA 5DJPF 4NG6A 5JUZF 3RMGA 3WCIA 1JFGA 3P5RA 4LFVF 4OGUA 3NF2A 4KVIA 1HXAA 1YYRA 4E9UA 3AQCB 2PS4A 5ILJA 3EZ3A 2E8TA 4GP1A 1V4HA 3LG5A 5JA0F 3Q30A 3LVSA 3Q2QA 5CG5A 3IPIA 3N6KF 1HM7A 4F62A 3NPRA 5IMPA 3WSAA 1UBVA 1PS1A 4NFKF 3P5PA 3ZMBA 5ER8A 4PVXF 5KSXF 3EGTA 4DHDA 4OMGA 4LZCA 4KQUA 3S9VA 3ASXA 5B0IA 2P1CA 3LSNA 1WL0A 1WKZA 2ONGA 3AQBB 5ILYA 3RYWA 5JV0F 1V4JA 4P0WA 5IKHA 3W7FA 2ZCRA 5IVGA 1N21A 3ZMCA 4LPHF 5ILDA 1YHLA 2Z52A 3ICNA 4Q23A 5HN8A 1VG4A 5AYPA 4JZXA 2FTZA 4DZWA 3G4DA 2ZEUA 4XQTF 5DGSF 1VG7A 4NUAA 4DI5A 4PVYF 4LOBA 3N3DA 3KRFA 5EASA 5DGNF 5CG6A 4LA5A 3OACA 4F6XA 2DH4A 3SDRA 1HXGA 3DYFA 5H9DA 2E4OA 3LEEA 5JV1F 3WEGA 3KRPB 3SDVA 2J5CA 2AETA 2E92A 4H5CF 3N1WF 3OABA 3N0FA 4LTZA 5AFXA 2E8XA 3M9UA 1VG3A 3WCGA 4FJQA 2F94F 4LXWA 1N1ZA 2Z4YA 5C05A 3LZ9A 4RXEA 2VF6A 4H5DF 4H5EF 5DZ2A 3PYBA 1V4KA 3DYHA 3ADZA 3WCFA 4LLSA 1FPSA 3V1VA 4KQSA 3WCMA 4NKFA 3VJBA 5B0MA 1RQJA 4RXDA 4K10A 5DJRF 3SDQA 2J1OA 3WJNA 4EA1A 4MC0A 3RBMA 3VJCA 1YYQA 4KFAA 4KK2A 2E8UA 3KRAB 5IM1A 2Z4ZA 3MAVA 4LIXA 1YYSA 2F8CF 1ZW5A 1HXCA 1HX9A 4LA6A 3PDEA 4E1EA 2E90A 2F9KF 5HNAA 1UBXA 3M01A 3LK5A 4UMJA 2Q58A 5IKAA 4OKZA 4LLTA 2F89F 5HN9A 2Q9ZA 3NPKA 3CC9A 3WE9A 2E94A 3Q1OA 2AELA 3BNXA 4P0VA 3PH7A 4LTVA 2ZCQA 2E93A 4LZ3A 4NFJF 3OYRA 3ZL6A 4KQ5A 3CP6A 5EROA 4E9ZA 5A0IA 3DYGA 5AHUB 4GA3A 3KRCA 4RYPA 1EZFA 3ID0A 5ERNA 3BNYA 4QPFA 3UCAA 3EFQA 3MZVA 3APZA 4KPDA 1DGPA 3ICMA 3ZOUA 2OGDA 2ONHA 3SDTA 5DIQF 3WCLA 5JV2F 2H8OA 2PS5A 4MC3A 4RXAA 3ACWA 1UBWA 3TFPA 4KVWA 2E91A 3IBAA 3KRFB 3M00A 1YYUA 3KROA 3OACB 2AZJA 2Q80A 3V1XA 4KPJA 4DWGA 4KVYA 3WJOA 2F8ZF 4LPGF 2QISA 4HD1A 2F7MF 1JFAA 2ZCSA 3KB9A 2ZCOA 3PKOA 4OMHA 3LJIA 1DI1A 3VJ8A 3P8LA 2O1OA 3N1VF 2EWGA 3P8RA 3WC9A 3WEKA 2Z78A 3ACXA 1WL3A 3QKCA 5B03A 3N5JF 3B7LA 5IMIA 3SAEA 3OABB 3VJ9A 3WEIA 3N5HF 4EA2A 4GAXA 2AZLA 3N46F 3N0GA 1YHKA 5E8HA 5DHKA 4LFGA 2Z7HA 4JXNA 4KUXA 4LFEA 3WEJA 5HN7A 4NKEA 5B0LA 3AQ0A 4P0XA 3S4JA 5B0KA 2OPNA 5ILZA 1N20A 2Q9YA 1HM4A 3WCDA 1KIYA 4JZBA 3Q2ZA 1RQIA 3N49F 1WL1A 5DGMF 4DWBA 3V66A 2OPMA 1RTRA 3TFVA 1N22A 3WCAA 3NRIA 4JXYA 4JYXA 3KRAA 1N24A 4ZQ8A 5EATA 4KWDA 3WJKA 2E8WA 3TC1A 3LGKA 2AZKA 2Z50A 4XQRF 4EA0A 3WEFA 3LGZB 1KIZA 2ZEVA 1WY0A 2Z4VA 4LZ0A 2F92F 5IK6A 3SDUA 1WL2A 4DEMF 5E8KA 2OA6A 5IL8A 4GP2A 4XQSF 3WCBA 5DHIA 2RAHA 1N23A 1UBYA 2Z7IA 1VG6A 3LLWA 3ICZA 5E8LA 2J1PA 4NFIF 5IL3A 1WMWA 3WCEA 2FORA 5IK0A 2I19A 2Z4WA 5AELA 1YHMA 1YV5A 1YYTA 3WCJA 2AEKA 3PYAA 4JVJF 5ERMA 1N1BA 3QQVA 2PS6A 5IMNA 5IN8A 4FP4A 3KRCB 5ILHA 4KVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P41 A;  3VJE A;  2E8V A;  2PS8 A;  5B02 A;  1YJ4 A;  4F6V A;  3RYE A;  3ICK A;  4N1Z F;  5IK9 A;  4KKM A;  5B0J A;  3LMD A;  2E95 A;  3WEH A;  5DW7 A;  4OKM A;  3ZCD A;  3KBK A;  3AE0 A;  4LUU A;  1V4I A;  3KRO B;  5EAU A;  3M0G A;  2PS7 A;  4RXC A;  3KRP A;  4DXJ A;  4QXS F;  4MC8 A;  3M02 A;  4WK5 A;  3TS7 A;  5A0J A;  5I1U A;  5DJV F;  3N3L F;  5B00 A;  1VG2 A;  2Z4X A;  4RNQ A;  5B01 A;  5ILI A;  5ILK A;  5A0K A;  3G4F A;  2ZY1 A;  3TFN A;  3WCH A;  3ACY A;  4N9U A;  3LOM A;  4L2X F;  3VJD A;  3CKE A;  1YQ7 A;  3WCC A;  1V4E A;  3N45 F;  3VJA A;  3WSB A;  3LDW A;  5DJP F;  4NG6 A;  5JUZ F;  3RMG A;  3WCI A;  1JFG A;  3P5R A;  4LFV F;  4OGU A;  3NF2 A;  4KVI A;  1HXA A;  1YYR A;  4E9U A;  3AQC B;  2PS4 A;  5ILJ A;  3EZ3 A;  2E8T A;  4GP1 A;  1V4H A;  3LG5 A;  5JA0 F;  3Q30 A;  3LVS A;  3Q2Q A;  5CG5 A;  3IPI A;  3N6K F;  1HM7 A;  4F62 A;  3NPR A;  5IMP A;  3WSA A;  1UBV A;  1PS1 A;  4NFK F;  3P5P A;  3ZMB A;  5ER8 A;  4PVX F;  5KSX F;  3EGT A;  4DHD A;  4OMG A;  4LZC A;  4KQU A;  3S9V A;  3ASX A;  5B0I A;  2P1C A;  3LSN A;  1WL0 A;  1WKZ A;  2ONG A;  3AQB B;  5ILY A;  3RYW A;  5JV0 F;  1V4J A;  4P0W A;  5IKH A;  3W7F A;  2ZCR A;  5IVG A;  1N21 A;  3ZMC A;  4LPH F;  5ILD A;  1YHL A;  2Z52 A;  3ICN A;  4Q23 A;  5HN8 A;  1VG4 A;  5AYP A;  4JZX A;  2FTZ A;  4DZW A;  3G4D A;  2ZEU A;  4XQT F;  5DGS F;  1VG7 A;  4NUA A;  4DI5 A;  4PVY F;  4LOB A;  3N3D A;  3KRF A;  5EAS A;  5DGN F;  5CG6 A;  4LA5 A;  3OAC A;  4F6X A;  2DH4 A;  3SDR A;  1HXG A;  3DYF A;  5H9D A;  2E4O A;  3LEE A;  5JV1 F;  3WEG A;  3KRP B;  3SDV A;  2J5C A;  2AET A;  2E92 A;  4H5C F;  3N1W F;  3OAB A;  3N0F A;  4LTZ A;  5AFX A;  2E8X A;  3M9U A;  1VG3 A;  3WCG A;  4FJQ A;  2F94 F;  4LXW A;  1N1Z A;  2Z4Y A;  5C05 A;  3LZ9 A;  4RXE A;  2VF6 A;  4H5D F;  4H5E F;  5DZ2 A;  3PYB A;  1V4K A;  3DYH A;  3ADZ A;  3WCF A;  4LLS A;  1FPS A;  3V1V A;  4KQS A;  3WCM A;  4NKF A;  3VJB A;  5B0M A;  1RQJ A;  4RXD A;  4K10 A;  5DJR F;  3SDQ A;  2J1O A;  3WJN A;  4EA1 A;  4MC0 A;  3RBM A;  3VJC A;  1YYQ A;  4KFA A;  4KK2 A;  2E8U A;  3KRA B;  5IM1 A;  2Z4Z A;  3MAV A;  4LIX A;  1YYS A;  2F8C F;  1ZW5 A;  1HXC A;  1HX9 A;  4LA6 A;  3PDE A;  4E1E A;  2E90 A;  2F9K F;  5HNA A;  1UBX A;  3M01 A;  3LK5 A;  4UMJ A;  2Q58 A;  5IKA A;  4OKZ A;  4LLT A;  2F89 F;  5HN9 A;  2Q9Z A;  3NPK A;  3CC9 A;  3WE9 A;  2E94 A;  3Q1O A;  2AEL A;  3BNX A;  4P0V A;  3PH7 A;  4LTV A;  2ZCQ A;  2E93 A;  4LZ3 A;  4NFJ F;  3OYR A;  3ZL6 A;  4KQ5 A;  3CP6 A;  5ERO A;  4E9Z A;  5A0I A;  3DYG A;  5AHU B;  4GA3 A;  3KRC A;  4RYP A;  1EZF A;  3ID0 A;  5ERN A;  3BNY A;  4QPF A;  3UCA A;  3EFQ A;  3MZV A;  3APZ A;  4KPD A;  1DGP A;  3ICM A;  3ZOU A;  2OGD A;  2ONH A;  3SDT A;  5DIQ F;  3WCL A;  5JV2 F;  2H8O A;  2PS5 A;  4MC3 A;  4RXA A;  3ACW A;  1UBW A;  3TFP A;  4KVW A;  2E91 A;  3IBA A;  3KRF B;  3M00 A;  1YYU A;  3KRO A;  3OAC B;  2AZJ A;  2Q80 A;  3V1X A;  4KPJ A;  4DWG A;  4KVY A;  3WJO A;  2F8Z F;  4LPG F;  2QIS A;  4HD1 A;  2F7M F;  1JFA A;  2ZCS A;  3KB9 A;  2ZCO A;  3PKO A;  4OMH A;  3LJI A;  1DI1 A;  3VJ8 A;  3P8L A;  2O1O A;  3N1V F;  2EWG A;  3P8R A;  3WC9 A;  3WEK A;  2Z78 A;  3ACX A;  1WL3 A;  3QKC A;  5B03 A;  3N5J F;  3B7L A;  5IMI A;  3SAE A;  3OAB B;  3VJ9 A;  3WEI A;  3N5H F;  4EA2 A;  4GAX A;  2AZL A;  3N46 F;  3N0G A;  1YHK A;  5E8H A;  5DHK A;  4LFG A;  2Z7H A;  4JXN A;  4KUX A;  4LFE A;  3WEJ A;  5HN7 A;  4NKE A;  5B0L A;  3AQ0 A;  4P0X A;  3S4J A;  5B0K A;  2OPN A;  5ILZ A;  1N20 A;  2Q9Y A;  1HM4 A;  3WCD A;  1KIY A;  4JZB A;  3Q2Z A;  1RQI A;  3N49 F;  1WL1 A;  5DGM F;  4DWB A;  3V66 A;  2OPM A;  1RTR A;  3TFV A;  1N22 A;  3WCA A;  3NRI A;  4JXY A;  4JYX A;  3KRA A;  1N24 A;  4ZQ8 A;  5EAT A;  4KWD A;  3WJK A;  2E8W A;  3TC1 A;  3LGK A;  2AZK A;  2Z50 A;  4XQR F;  4EA0 A;  3WEF A;  3LGZ B;  1KIZ A;  2ZEV A;  1WY0 A;  2Z4V A;  4LZ0 A;  2F92 F;  5IK6 A;  3SDU A;  1WL2 A;  4DEM F;  5E8K A;  2OA6 A;  5IL8 A;  4GP2 A;  4XQS F;  3WCB A;  5DHI A;  2RAH A;  1N23 A;  1UBY A;  2Z7I A;  1VG6 A;  3LLW A;  3ICZ A;  5E8L A;  2J1P A;  4NFI F;  5IL3 A;  1WMW A;  3WCE A;  2FOR A;  5IK0 A;  2I19 A;  2Z4W A;  5AEL A;  1YHM A;  1YV5 A;  1YYT A;  3WCJ A;  2AEK A;  3PYA A;  4JVJ F;  5ERM A;  1N1B A;  3QQV A;  2PS6 A;  5IMN A;  5IN8 A;  4FP4 A;  3KRC B;  5ILH A;  4KVD A; 
#chains in the Genus database with same CATH topology
 3P41 A;  3VJE A;  2E8V A;  2PS8 A;  5B02 A;  1YJ4 A;  4F6V A;  3RYE A;  3ICK A;  4N1Z F;  5IK9 A;  4KKM A;  5B0J A;  3LMD A;  2E95 A;  3WEH A;  5DW7 A;  4OKM A;  3ZCD A;  3KBK A;  3AE0 A;  4LUU A;  1V4I A;  3KRO B;  5EAU A;  3M0G A;  2PS7 A;  4RXC A;  3KRP A;  4DXJ A;  4QXS F;  4MC8 A;  3M02 A;  4WK5 A;  3TS7 A;  5A0J A;  5I1U A;  5DJV F;  3N3L F;  5B00 A;  1VG2 A;  2Z4X A;  4RNQ A;  5B01 A;  5ILI A;  5ILK A;  5A0K A;  3G4F A;  2ZY1 A;  3TFN A;  3WCH A;  3ACY A;  4N9U A;  3LOM A;  4L2X F;  3VJD A;  3CKE A;  1YQ7 A;  3WCC A;  1V4E A;  3N45 F;  3VJA A;  3WSB A;  3LDW A;  5DJP F;  4NG6 A;  5JUZ F;  3RMG A;  3WCI A;  1JFG A;  3P5R A;  4LFV F;  4OGU A;  3NF2 A;  4KVI A;  1HXA A;  1YYR A;  4E9U A;  3AQC B;  2PS4 A;  5ILJ A;  3EZ3 A;  2E8T A;  4GP1 A;  1V4H A;  3LG5 A;  5JA0 F;  3Q30 A;  3LVS A;  3Q2Q A;  5CG5 A;  3IPI A;  3N6K F;  1HM7 A;  4F62 A;  3NPR A;  5IMP A;  3WSA A;  1UBV A;  1PS1 A;  4NFK F;  3P5P A;  3ZMB A;  5ER8 A;  4PVX F;  5KSX F;  3EGT A;  4DHD A;  4OMG A;  4LZC A;  4KQU A;  3S9V A;  3ASX A;  5B0I A;  2P1C A;  3LSN A;  1WL0 A;  1WKZ A;  2ONG A;  3AQB B;  5ILY A;  3RYW A;  5JV0 F;  1V4J A;  4P0W A;  5IKH A;  3W7F A;  2ZCR A;  5IVG A;  1N21 A;  3ZMC A;  4LPH F;  5ILD A;  1YHL A;  2Z52 A;  3ICN A;  4Q23 A;  5HN8 A;  1VG4 A;  5AYP A;  4JZX A;  2FTZ A;  4DZW A;  3G4D A;  2ZEU A;  4XQT F;  5DGS F;  1VG7 A;  4NUA A;  4DI5 A;  4PVY F;  4LOB A;  3N3D A;  3KRF A;  5EAS A;  5DGN F;  5CG6 A;  4LA5 A;  3OAC A;  4F6X A;  2DH4 A;  3SDR A;  1HXG A;  3DYF A;  5H9D A;  2E4O A;  3LEE A;  5JV1 F;  3WEG A;  3KRP B;  3SDV A;  2J5C A;  2AET A;  2E92 A;  4H5C F;  3N1W F;  3OAB A;  3N0F A;  4LTZ A;  5AFX A;  2E8X A;  3M9U A;  1VG3 A;  3WCG A;  4FJQ A;  2F94 F;  4LXW A;  1N1Z A;  2Z4Y A;  5C05 A;  3LZ9 A;  4RXE A;  2VF6 A;  4H5D F;  4H5E F;  5DZ2 A;  3PYB A;  1V4K A;  3DYH A;  3ADZ A;  3WCF A;  4LLS A;  1FPS A;  3V1V A;  4KQS A;  3WCM A;  4NKF A;  3VJB A;  5B0M A;  1RQJ A;  4RXD A;  4K10 A;  5DJR F;  3SDQ A;  2J1O A;  3WJN A;  4EA1 A;  4MC0 A;  3RBM A;  3VJC A;  1YYQ A;  4KFA A;  4KK2 A;  2E8U A;  3KRA B;  5IM1 A;  2Z4Z A;  3MAV A;  4LIX A;  1YYS A;  2F8C F;  1ZW5 A;  1HXC A;  1HX9 A;  4LA6 A;  3PDE A;  4E1E A;  2E90 A;  2F9K F;  5HNA A;  1UBX A;  3M01 A;  3LK5 A;  4UMJ A;  2Q58 A;  5IKA A;  4OKZ A;  4LLT A;  2F89 F;  5HN9 A;  2Q9Z A;  3NPK A;  3CC9 A;  3WE9 A;  2E94 A;  3Q1O A;  2AEL A;  3BNX A;  4P0V A;  3PH7 A;  4LTV A;  2ZCQ A;  2E93 A;  4LZ3 A;  4NFJ F;  3OYR A;  3ZL6 A;  4KQ5 A;  3CP6 A;  5ERO A;  4E9Z A;  5A0I A;  3DYG A;  5AHU B;  4GA3 A;  3KRC A;  4RYP A;  1EZF A;  3ID0 A;  5ERN A;  3BNY A;  4QPF A;  3UCA A;  3EFQ A;  3MZV A;  3APZ A;  4KPD A;  1DGP A;  3ICM A;  3ZOU A;  2OGD A;  2ONH A;  3SDT A;  5DIQ F;  3WCL A;  5JV2 F;  2H8O A;  2PS5 A;  4MC3 A;  4RXA A;  3ACW A;  1UBW A;  3TFP A;  4KVW A;  2E91 A;  3IBA A;  3KRF B;  3M00 A;  1YYU A;  3KRO A;  3OAC B;  2AZJ A;  2Q80 A;  3V1X A;  4KPJ A;  4DWG A;  4KVY A;  3WJO A;  2F8Z F;  4LPG F;  2QIS A;  4HD1 A;  2F7M F;  1JFA A;  2ZCS A;  3KB9 A;  2ZCO A;  3PKO A;  4OMH A;  3LJI A;  1DI1 A;  3VJ8 A;  3P8L A;  2O1O A;  3N1V F;  2EWG A;  3P8R A;  3WC9 A;  3WEK A;  2Z78 A;  3ACX A;  1WL3 A;  3QKC A;  5B03 A;  3N5J F;  3B7L A;  5IMI A;  3SAE A;  3OAB B;  3VJ9 A;  3WEI A;  3N5H F;  4EA2 A;  4GAX A;  2AZL A;  3N46 F;  3N0G A;  1YHK A;  5E8H A;  5DHK A;  4LFG A;  2Z7H A;  4JXN A;  4KUX A;  4LFE A;  3WEJ A;  5HN7 A;  4NKE A;  5B0L A;  3AQ0 A;  4P0X A;  3S4J A;  5B0K A;  2OPN A;  5ILZ A;  1N20 A;  2Q9Y A;  1HM4 A;  3WCD A;  1KIY A;  4JZB A;  3Q2Z A;  1RQI A;  3N49 F;  1WL1 A;  5DGM F;  4DWB A;  3V66 A;  2OPM A;  1RTR A;  3TFV A;  1N22 A;  3WCA A;  3NRI A;  4JXY A;  4JYX A;  3KRA A;  1N24 A;  4ZQ8 A;  5EAT A;  4KWD A;  3WJK A;  2E8W A;  3TC1 A;  3LGK A;  2AZK A;  2Z50 A;  4XQR F;  4EA0 A;  3WEF A;  3LGZ B;  1KIZ A;  2ZEV A;  1WY0 A;  2Z4V A;  4LZ0 A;  2F92 F;  5IK6 A;  3SDU A;  1WL2 A;  4DEM F;  5E8K A;  2OA6 A;  5IL8 A;  4GP2 A;  4XQS F;  3WCB A;  5DHI A;  2RAH A;  1N23 A;  1UBY A;  2Z7I A;  1VG6 A;  3LLW A;  3ICZ A;  5E8L A;  2J1P A;  4NFI F;  5IL3 A;  1WMW A;  3WCE A;  2FOR A;  5IK0 A;  2I19 A;  2Z4W A;  5AEL A;  1YHM A;  1YV5 A;  1YYT A;  3WCJ A;  2AEK A;  3PYA A;  4JVJ F;  5ERM A;  1N1B A;  3QQV A;  2PS6 A;  5IMN A;  5IN8 A;  4FP4 A;  3KRC B;  5ILH A;  4KVD A; 
#chains in the Genus database with same CATH homology
 3P41 A;  3VJE A;  2E8V A;  2PS8 A;  5B02 A;  1YJ4 A;  4F6V A;  3RYE A;  3ICK A;  4N1Z F;  5IK9 A;  4KKM A;  5B0J A;  3LMD A;  2E95 A;  3WEH A;  5DW7 A;  4OKM A;  3ZCD A;  3KBK A;  3AE0 A;  4LUU A;  1V4I A;  3KRO B;  5EAU A;  3M0G A;  2PS7 A;  4RXC A;  3KRP A;  4DXJ A;  4QXS F;  4MC8 A;  3M02 A;  4WK5 A;  3TS7 A;  5A0J A;  5I1U A;  5DJV F;  3N3L F;  5B00 A;  1VG2 A;  2Z4X A;  4RNQ A;  5B01 A;  5ILI A;  5ILK A;  5A0K A;  3G4F A;  2ZY1 A;  3TFN A;  3WCH A;  3ACY A;  4N9U A;  3LOM A;  4L2X F;  3VJD A;  3CKE A;  1YQ7 A;  3WCC A;  1V4E A;  3N45 F;  3VJA A;  3WSB A;  3LDW A;  5DJP F;  4NG6 A;  5JUZ F;  3RMG A;  3WCI A;  1JFG A;  3P5R A;  4LFV F;  4OGU A;  3NF2 A;  4KVI A;  1HXA A;  1YYR A;  4E9U A;  3AQC B;  2PS4 A;  5ILJ A;  3EZ3 A;  2E8T A;  4GP1 A;  1V4H A;  3LG5 A;  5JA0 F;  3Q30 A;  3LVS A;  3Q2Q A;  5CG5 A;  3IPI A;  3N6K F;  1HM7 A;  4F62 A;  3NPR A;  5IMP A;  3WSA A;  1UBV A;  1PS1 A;  4NFK F;  3P5P A;  3ZMB A;  5ER8 A;  4PVX F;  5KSX F;  3EGT A;  4DHD A;  4OMG A;  4LZC A;  4KQU A;  3S9V A;  3ASX A;  5B0I A;  2P1C A;  3LSN A;  1WL0 A;  1WKZ A;  2ONG A;  3AQB B;  5ILY A;  3RYW A;  5JV0 F;  1V4J A;  4P0W A;  5IKH A;  3W7F A;  2ZCR A;  5IVG A;  1N21 A;  3ZMC A;  4LPH F;  5ILD A;  1YHL A;  2Z52 A;  3ICN A;  4Q23 A;  5HN8 A;  1VG4 A;  5AYP A;  4JZX A;  2FTZ A;  4DZW A;  3G4D A;  2ZEU A;  4XQT F;  5DGS F;  1VG7 A;  4NUA A;  4DI5 A;  4PVY F;  4LOB A;  3N3D A;  3KRF A;  5EAS A;  5DGN F;  5CG6 A;  4LA5 A;  3OAC A;  4F6X A;  2DH4 A;  3SDR A;  1HXG A;  3DYF A;  5H9D A;  2E4O A;  3LEE A;  5JV1 F;  3WEG A;  3KRP B;  3SDV A;  2J5C A;  2AET A;  2E92 A;  4H5C F;  3N1W F;  3OAB A;  3N0F A;  4LTZ A;  5AFX A;  2E8X A;  3M9U A;  1VG3 A;  3WCG A;  4FJQ A;  2F94 F;  4LXW A;  1N1Z A;  2Z4Y A;  5C05 A;  3LZ9 A;  4RXE A;  2VF6 A;  4H5D F;  4H5E F;  5DZ2 A;  3PYB A;  1V4K A;  3DYH A;  3ADZ A;  3WCF A;  4LLS A;  1FPS A;  3V1V A;  4KQS A;  3WCM A;  4NKF A;  3VJB A;  5B0M A;  1RQJ A;  4RXD A;  4K10 A;  5DJR F;  3SDQ A;  2J1O A;  3WJN A;  4EA1 A;  4MC0 A;  3RBM A;  3VJC A;  1YYQ A;  4KFA A;  4KK2 A;  2E8U A;  3KRA B;  5IM1 A;  2Z4Z A;  3MAV A;  4LIX A;  1YYS A;  2F8C F;  1ZW5 A;  1HXC A;  1HX9 A;  4LA6 A;  3PDE A;  4E1E A;  2E90 A;  2F9K F;  5HNA A;  1UBX A;  3M01 A;  3LK5 A;  4UMJ A;  2Q58 A;  5IKA A;  4OKZ A;  4LLT A;  2F89 F;  5HN9 A;  2Q9Z A;  3NPK A;  3CC9 A;  3WE9 A;  2E94 A;  3Q1O A;  2AEL A;  3BNX A;  4P0V A;  3PH7 A;  4LTV A;  2ZCQ A;  2E93 A;  4LZ3 A;  4NFJ F;  3OYR A;  3ZL6 A;  4KQ5 A;  3CP6 A;  5ERO A;  4E9Z A;  5A0I A;  3DYG A;  5AHU B;  4GA3 A;  3KRC A;  4RYP A;  1EZF A;  3ID0 A;  5ERN A;  3BNY A;  4QPF A;  3UCA A;  3EFQ A;  3MZV A;  3APZ A;  4KPD A;  1DGP A;  3ICM A;  3ZOU A;  2OGD A;  2ONH A;  3SDT A;  5DIQ F;  3WCL A;  5JV2 F;  2H8O A;  2PS5 A;  4MC3 A;  4RXA A;  3ACW A;  1UBW A;  3TFP A;  4KVW A;  2E91 A;  3IBA A;  3KRF B;  3M00 A;  1YYU A;  3KRO A;  3OAC B;  2AZJ A;  2Q80 A;  3V1X A;  4KPJ A;  4DWG A;  4KVY A;  3WJO A;  2F8Z F;  4LPG F;  2QIS A;  4HD1 A;  2F7M F;  1JFA A;  2ZCS A;  3KB9 A;  2ZCO A;  3PKO A;  4OMH A;  3LJI A;  1DI1 A;  3VJ8 A;  3P8L A;  2O1O A;  3N1V F;  2EWG A;  3P8R A;  3WC9 A;  3WEK A;  2Z78 A;  3ACX A;  1WL3 A;  3QKC A;  5B03 A;  3N5J F;  3B7L A;  5IMI A;  3SAE A;  3OAB B;  3VJ9 A;  3WEI A;  3N5H F;  4EA2 A;  4GAX A;  2AZL A;  3N46 F;  3N0G A;  1YHK A;  5E8H A;  5DHK A;  4LFG A;  2Z7H A;  4JXN A;  4KUX A;  4LFE A;  3WEJ A;  5HN7 A;  4NKE A;  5B0L A;  3AQ0 A;  4P0X A;  3S4J A;  5B0K A;  2OPN A;  5ILZ A;  1N20 A;  2Q9Y A;  1HM4 A;  3WCD A;  1KIY A;  4JZB A;  3Q2Z A;  1RQI A;  3N49 F;  1WL1 A;  5DGM F;  4DWB A;  3V66 A;  2OPM A;  1RTR A;  3TFV A;  1N22 A;  3WCA A;  3NRI A;  4JXY A;  4JYX A;  3KRA A;  1N24 A;  4ZQ8 A;  5EAT A;  4KWD A;  3WJK A;  2E8W A;  3TC1 A;  3LGK A;  2AZK A;  2Z50 A;  4XQR F;  4EA0 A;  3WEF A;  3LGZ B;  1KIZ A;  2ZEV A;  1WY0 A;  2Z4V A;  4LZ0 A;  2F92 F;  5IK6 A;  3SDU A;  1WL2 A;  4DEM F;  5E8K A;  2OA6 A;  5IL8 A;  4GP2 A;  4XQS F;  3WCB A;  5DHI A;  2RAH A;  1N23 A;  1UBY A;  2Z7I A;  1VG6 A;  3LLW A;  3ICZ A;  5E8L A;  2J1P A;  4NFI F;  5IL3 A;  1WMW A;  3WCE A;  2FOR A;  5IK0 A;  2I19 A;  2Z4W A;  5AEL A;  1YHM A;  1YV5 A;  1YYT A;  3WCJ A;  2AEK A;  3PYA A;  4JVJ F;  5ERM A;  1N1B A;  3QQV A;  2PS6 A;  5IMN A;  5IN8 A;  4FP4 A;  3KRC B;  5ILH A;  4KVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...