5HN7A

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph-1158
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
360
structure length
347
Chain Sequence
FFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSIDVNNINVPQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIDNLIYKKIEDISMLMGEYFQIHDDYLDIFGDSTKTGKVSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyl pyrophosphate synthase, putative
publication title Dynamic Structure and Inhibition of a Malaria Drug Target: Geranylgeranyl Diphosphate Synthase.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 141
structure length 347
sequence length 360
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5hn7A00
4XQSF 1UBXA 3BNYA 1YQ7A 3P41A 3WCEA 5B03A 4NKEA 3Q2ZA 4Q23A 4QXSF 2QISA 3KROA 3WCCA 3OABB 4N1ZF 4P0WA 1HXCA 1V4EA 2Z50A 2E92A 4JZXA 4OKZA 1V4HA 3DYFA 3NPKA 1DI1A 3KBKA 4LA5A 2OA6A 5KSXF 4XQTF 3N0GA 3V1XA 1RQIA 3WSBA 5B00A 5B02A 3NRIA 4KVIA 1RTRA 5E8LA 5ILKA 5AFXA 5H9DA 3AQ0A 1N1ZA 2H8OA 3KRCA 3Q1OA 5EROA 3N5JF 2ZEVA 5ILYA 2PS6A 4RXCA 3N3LF 4KPDA 5IK0A 5JUZF 2AZLA 3PYAA 3SDTA 1N24A 4GP2A 3LDWA 3LLWA 2ONGA 1HXAA 3P8LA 3P5RA 1VG7A 5IN8A 1YHKA 2Z4VA 3ACXA 3LJIA 3QQVA 5DZ2A 3PKOA 2ZCSA 3WJOA 4OKMA 5B0KA 1YYSA 3V1VA 1N21A 4HD1A 1VG6A 3APZA 2Z4YA 1WL2A 1VG4A 2AZKA 5ER8A 3WEKA 3ADZA 1YV5A 2E90A 1HM4A 5EATA 4XQRF 3M00A 1YYRA 4LZ0A 4KKMA 4LUUA 2E8UA 4GAXA 2PS7A 3ASXA 4N9UA 4RXEA 2J1OA 3WCBA 3WCIA 1WY0A 2E8VA 2Q80A 3V66A 2AELA 3KRFA 3TS7A 4PVXF 1V4KA 3DYGA 3LSNA 2PS5A 3WEJA 5ERNA 3SDQA 3AE0A 2I19A 2ZCOA 1HX9A 1RQJA 4MC0A 4KVYA 3S9VA 3G4FA 2Z78A 2E95A 1EZFA 1V4IA 3SDVA 4JVJF 2DH4A 3KRCB 3WEIA 1FPSA 1WMWA 2O1OA 1N23A 4JYXA 1JFGA 4LFEA 5C05A 2AEKA 4GA3A 3NF2A 2AZJA 2FORA 4KFAA 1YHMA 5IK6A 3ICMA 4NFJF 3B7LA 3PH7A 3WCHA 2Z52A 3Q30A 5IL3A 4MC8A 3TFPA 3ICKA 5DGSF 1VG2A 4OGUA 5HN8A 5A0KA 3TFNA 1N22A 3TFVA 3AQBB 1ZW5A 3N3DA 2Q9ZA 4OMGA 1YHLA 5DIQF 3UCAA 5HNAA 5IKHA 3EZ3A 4F6XA 4DWGA 2OPMA 3ZCDA 3ICZA 3M0GA 3KRPA 4RXAA 4P0VA 2Z4WA 4NUAA 3ACWA 2Z7HA 2E93A 5ILDA 1N20A 3LEEA 1WKZA 2F92F 5B0MA 5JA0F 5CG6A 3KRAA 3VJ8A 3WJNA 4LPHF 5DGMF 4DZWA 4LZCA 3WSAA 4P0XA 1YJ4A 4H5DF 5IK9A 3WEGA 3QKCA 3N49F 3OABA 4FP4A 2F8CF 3VJ9A 1YYQA 5A0JA 3RMGA 4KQUA 1UBVA 3WCDA 3EFQA 3LOMA 3G4DA 2Q9YA 3KROB 1UBYA 2RAHA 5JV2F 4DXJA 3N6KF 5DGNF 2ONHA 3N0FA 3IPIA 5I1UA 4JXNA 3VJDA 3VJAA 5DW7A 2E4OA 2PS4A 5IM1A 4KPJA 1YYUA 4H5CF 4NG6A 2E91A 3M01A 3Q2QA 4LTVA 3KB9A 1KIYA 1N1BA 2F89F 5IVGA 3M02A 3M9UA 5HN9A 2E8WA 3OACA 3WEFA 2Q58A 2E94A 3WE9A 3N1VF 2P1CA 3LGZB 4LFGA 5EAUA 4DI5A 1VG3A 3BNXA 4LTZA 5ERMA 5IMNA 3KRAB 3NPRA 5IMIA 3RYWA 1V4JA 5ILIA 5A0IA 3VJEA 5CG5A 5DHIA 5ILHA 5AYPA 4H5EF 5DHKA 4NFIF 4K10A 5ILJA 4EA2A 4KQSA 3ZOUA 2PS8A 4E9UA 3N1WF 4QPFA 3WC9A 1DGPA 3WCGA 3ZMBA 4LLTA 3WCFA 4EA1A 2F9KF 3WCAA 3ZMCA 5HN7A 3WCMA 3PDEA 4WK5A 4E9ZA 3MAVA 3VJBA 2FTZA 1KIZA 4F62A 3ID0A 5DJVF 1WL0A 3LG5A 3CKEA 4KVDA 4RNQA 3KRFB 5IMPA 4KUXA 5ILZA 3DYHA 4KQ5A 5B01A 3SAEA 3RBMA 1WL1A 4E1EA 2Z4ZA 3N45F 3OYRA 5DJRF 4FJQA 4F6VA 3TC1A 5E8HA 5IKAA 4LPGF 1HXGA 3LVSA 3W7FA 4DEMF 1YYTA 4UMJA 5B0LA 5AHUB 5B0JA 2F7MF 2ZY1A 3OACB 2OPNA 4LZ3A 2ZEUA 2E8TA 3ACYA 3IBAA 3RYEA 4OMHA 5E8KA 4EA0A 1JFAA 3WCJA 3EGTA 3N5HF 5AELA 2J5CA 5JV1F 4LA6A 3LGKA 3LZ9A 4RXDA 3CP6A 4MC3A 2F8ZF 5DJPF 4NKFA 4NFKF 5IL8A 5EASA 3LK5A 4ZQ8A 3S4JA 5JV0F 1HM7A 3LMDA 4L2XF 1UBWA 5B0IA 2Z7IA 2E8XA 2ZCRA 3WCLA 3AQCB 4LIXA 2VF6A 3SDUA 3P5PA 3MZVA 3PYBA 4KVWA 4DHDA 2OGDA 3WJKA 3N46F 3KRPB 4LFVF 4LOBA 2ZCQA 4PVYF 4JXYA 1WL3A 2F94F 3CC9A 3ICNA 3WEHA 3ZL6A 2EWGA 2J1PA 4KK2A 4RYPA 1PS1A 4GP1A 4KWDA 2Z4XA 4LLSA 2AETA 3SDRA 4JZBA 3VJCA 4DWBA 3P8RA 4LXWA
chains in the Genus database with same CATH superfamily
4XQSF 1UBXA 3BNYA 1YQ7A 3P41A 3WCEA 5B03A 4NKEA 3Q2ZA 4Q23A 4QXSF 2QISA 3KROA 3WCCA 3OABB 4N1ZF 4P0WA 1HXCA 1V4EA 2Z50A 2E92A 4JZXA 4OKZA 1V4HA 3DYFA 3NPKA 1DI1A 3KBKA 4LA5A 2OA6A 5KSXF 4XQTF 3N0GA 3V1XA 1RQIA 3WSBA 5B00A 5B02A 3NRIA 4KVIA 1RTRA 5E8LA 5ILKA 5AFXA 5H9DA 3AQ0A 1N1ZA 2H8OA 3KRCA 3Q1OA 5EROA 3N5JF 2ZEVA 5ILYA 2PS6A 4RXCA 3N3LF 4KPDA 5IK0A 5JUZF 2AZLA 3PYAA 3SDTA 1N24A 4GP2A 3LDWA 3LLWA 2ONGA 1HXAA 3P8LA 3P5RA 1VG7A 5IN8A 1YHKA 2Z4VA 3ACXA 3LJIA 3QQVA 5DZ2A 3PKOA 2ZCSA 3WJOA 4OKMA 5B0KA 1YYSA 3V1VA 1N21A 4HD1A 1VG6A 3APZA 2Z4YA 1WL2A 1VG4A 2AZKA 5ER8A 3WEKA 3ADZA 1YV5A 2E90A 1HM4A 5EATA 4XQRF 3M00A 1YYRA 4LZ0A 4KKMA 4LUUA 2E8UA 4GAXA 2PS7A 3ASXA 4N9UA 4RXEA 2J1OA 3WCBA 3WCIA 1WY0A 2E8VA 2Q80A 3V66A 2AELA 3KRFA 3TS7A 4PVXF 1V4KA 3DYGA 3LSNA 2PS5A 3WEJA 5ERNA 3SDQA 3AE0A 2I19A 2ZCOA 1HX9A 1RQJA 4MC0A 4KVYA 3S9VA 3G4FA 2Z78A 2E95A 1EZFA 1V4IA 3SDVA 4JVJF 2DH4A 3KRCB 3WEIA 1FPSA 1WMWA 2O1OA 1N23A 4JYXA 1JFGA 4LFEA 5C05A 2AEKA 4GA3A 3NF2A 2AZJA 2FORA 4KFAA 1YHMA 5IK6A 3ICMA 4NFJF 3B7LA 3PH7A 3WCHA 2Z52A 3Q30A 5IL3A 4MC8A 3TFPA 3ICKA 5DGSF 1VG2A 4OGUA 5HN8A 5A0KA 3TFNA 1N22A 3TFVA 3AQBB 1ZW5A 3N3DA 2Q9ZA 4OMGA 1YHLA 5DIQF 3UCAA 5HNAA 5IKHA 3EZ3A 4F6XA 4DWGA 2OPMA 3ZCDA 3ICZA 3M0GA 3KRPA 4RXAA 4P0VA 2Z4WA 4NUAA 3ACWA 2Z7HA 2E93A 5ILDA 1N20A 3LEEA 1WKZA 2F92F 5B0MA 5JA0F 5CG6A 3KRAA 3VJ8A 3WJNA 4LPHF 5DGMF 4DZWA 4LZCA 3WSAA 4P0XA 1YJ4A 4H5DF 5IK9A 3WEGA 3QKCA 3N49F 3OABA 4FP4A 2F8CF 3VJ9A 1YYQA 5A0JA 3RMGA 4KQUA 1UBVA 3WCDA 3EFQA 3LOMA 3G4DA 2Q9YA 3KROB 1UBYA 2RAHA 5JV2F 4DXJA 3N6KF 5DGNF 2ONHA 3N0FA 3IPIA 5I1UA 4JXNA 3VJDA 3VJAA 5DW7A 2E4OA 2PS4A 5IM1A 4KPJA 1YYUA 4H5CF 4NG6A 2E91A 3M01A 3Q2QA 4LTVA 3KB9A 1KIYA 1N1BA 2F89F 5IVGA 3M02A 3M9UA 5HN9A 2E8WA 3OACA 3WEFA 2Q58A 2E94A 3WE9A 3N1VF 2P1CA 3LGZB 4LFGA 5EAUA 4DI5A 1VG3A 3BNXA 4LTZA 5ERMA 5IMNA 3KRAB 3NPRA 5IMIA 3RYWA 1V4JA 5ILIA 5A0IA 3VJEA 5CG5A 5DHIA 5ILHA 5AYPA 4H5EF 5DHKA 4NFIF 4K10A 5ILJA 4EA2A 4KQSA 3ZOUA 2PS8A 4E9UA 3N1WF 4QPFA 3WC9A 1DGPA 3WCGA 3ZMBA 4LLTA 3WCFA 4EA1A 2F9KF 3WCAA 3ZMCA 5HN7A 3WCMA 3PDEA 4WK5A 4E9ZA 3MAVA 3VJBA 2FTZA 1KIZA 4F62A 3ID0A 5DJVF 1WL0A 3LG5A 3CKEA 4KVDA 4RNQA 3KRFB 5IMPA 4KUXA 5ILZA 3DYHA 4KQ5A 5B01A 3SAEA 3RBMA 1WL1A 4E1EA 2Z4ZA 3N45F 3OYRA 5DJRF 4FJQA 4F6VA 3TC1A 5E8HA 5IKAA 4LPGF 1HXGA 3LVSA 3W7FA 4DEMF 1YYTA 4UMJA 5B0LA 5AHUB 5B0JA 2F7MF 2ZY1A 3OACB 2OPNA 4LZ3A 2ZEUA 2E8TA 3ACYA 3IBAA 3RYEA 4OMHA 5E8KA 4EA0A 1JFAA 3WCJA 3EGTA 3N5HF 5AELA 2J5CA 5JV1F 4LA6A 3LGKA 3LZ9A 4RXDA 3CP6A 4MC3A 2F8ZF 5DJPF 4NKFA 4NFKF 5IL8A 5EASA 3LK5A 4ZQ8A 3S4JA 5JV0F 1HM7A 3LMDA 4L2XF 1UBWA 5B0IA 2Z7IA 2E8XA 2ZCRA 3WCLA 3AQCB 4LIXA 2VF6A 3SDUA 3P5PA 3MZVA 3PYBA 4KVWA 4DHDA 2OGDA 3WJKA 3N46F 3KRPB 4LFVF 4LOBA 2ZCQA 4PVYF 4JXYA 1WL3A 2F94F 3CC9A 3ICNA 3WEHA 3ZL6A 2EWGA 2J1PA 4KK2A 4RYPA 1PS1A 4GP1A 4KWDA 2Z4XA 4LLSA 2AETA 3SDRA 4JZBA 3VJCA 4DWBA 3P8RA 4LXWA
chains in the Genus database with same CATH topology
4XQSF 1UBXA 3BNYA 1YQ7A 3P41A 3WCEA 5B03A 4NKEA 3Q2ZA 4Q23A 4QXSF 2QISA 3KROA 3WCCA 3OABB 4N1ZF 4P0WA 1HXCA 1V4EA 2Z50A 2E92A 4JZXA 4OKZA 1V4HA 3DYFA 3NPKA 1DI1A 3KBKA 4LA5A 2OA6A 5KSXF 4XQTF 3N0GA 3V1XA 1RQIA 3WSBA 5B00A 5B02A 3NRIA 4KVIA 1RTRA 5E8LA 5ILKA 5AFXA 5H9DA 3AQ0A 1N1ZA 2H8OA 3KRCA 3Q1OA 5EROA 3N5JF 2ZEVA 5ILYA 2PS6A 4RXCA 3N3LF 4KPDA 5IK0A 5JUZF 2AZLA 3PYAA 3SDTA 1N24A 4GP2A 3LDWA 3LLWA 2ONGA 1HXAA 3P8LA 3P5RA 1VG7A 5IN8A 1YHKA 2Z4VA 3ACXA 3LJIA 3QQVA 5DZ2A 3PKOA 2ZCSA 3WJOA 4OKMA 5B0KA 1YYSA 3V1VA 1N21A 4HD1A 1VG6A 3APZA 2Z4YA 1WL2A 1VG4A 2AZKA 5ER8A 3WEKA 3ADZA 1YV5A 2E90A 1HM4A 5EATA 4XQRF 3M00A 1YYRA 4LZ0A 4KKMA 4LUUA 2E8UA 4GAXA 2PS7A 3ASXA 4N9UA 4RXEA 2J1OA 3WCBA 3WCIA 1WY0A 2E8VA 2Q80A 3V66A 2AELA 3KRFA 3TS7A 4PVXF 1V4KA 3DYGA 3LSNA 2PS5A 3WEJA 5ERNA 3SDQA 3AE0A 2I19A 2ZCOA 1HX9A 1RQJA 4MC0A 4KVYA 3S9VA 3G4FA 2Z78A 2E95A 1EZFA 1V4IA 3SDVA 4JVJF 2DH4A 3KRCB 3WEIA 1FPSA 1WMWA 2O1OA 1N23A 4JYXA 1JFGA 4LFEA 5C05A 2AEKA 4GA3A 3NF2A 2AZJA 2FORA 4KFAA 1YHMA 5IK6A 3ICMA 4NFJF 3B7LA 3PH7A 3WCHA 2Z52A 3Q30A 5IL3A 4MC8A 3TFPA 3ICKA 5DGSF 1VG2A 4OGUA 5HN8A 5A0KA 3TFNA 1N22A 3TFVA 3AQBB 1ZW5A 3N3DA 2Q9ZA 4OMGA 1YHLA 5DIQF 3UCAA 5HNAA 5IKHA 3EZ3A 4F6XA 4DWGA 2OPMA 3ZCDA 3ICZA 3M0GA 3KRPA 4RXAA 4P0VA 2Z4WA 4NUAA 3ACWA 2Z7HA 2E93A 5ILDA 1N20A 3LEEA 1WKZA 2F92F 5B0MA 5JA0F 5CG6A 3KRAA 3VJ8A 3WJNA 4LPHF 5DGMF 4DZWA 4LZCA 3WSAA 4P0XA 1YJ4A 4H5DF 5IK9A 3WEGA 3QKCA 3N49F 3OABA 4FP4A 2F8CF 3VJ9A 1YYQA 5A0JA 3RMGA 4KQUA 1UBVA 3WCDA 3EFQA 3LOMA 3G4DA 2Q9YA 3KROB 1UBYA 2RAHA 5JV2F 4DXJA 3N6KF 5DGNF 2ONHA 3N0FA 3IPIA 5I1UA 4JXNA 3VJDA 3VJAA 5DW7A 2E4OA 2PS4A 5IM1A 4KPJA 1YYUA 4H5CF 4NG6A 2E91A 3M01A 3Q2QA 4LTVA 3KB9A 1KIYA 1N1BA 2F89F 5IVGA 3M02A 3M9UA 5HN9A 2E8WA 3OACA 3WEFA 2Q58A 2E94A 3WE9A 3N1VF 2P1CA 3LGZB 4LFGA 5EAUA 4DI5A 1VG3A 3BNXA 4LTZA 5ERMA 5IMNA 3KRAB 3NPRA 5IMIA 3RYWA 1V4JA 5ILIA 5A0IA 3VJEA 5CG5A 5DHIA 5ILHA 5AYPA 4H5EF 5DHKA 4NFIF 4K10A 5ILJA 4EA2A 4KQSA 3ZOUA 2PS8A 4E9UA 3N1WF 4QPFA 3WC9A 1DGPA 3WCGA 3ZMBA 4LLTA 3WCFA 4EA1A 2F9KF 3WCAA 3ZMCA 5HN7A 3WCMA 3PDEA 4WK5A 4E9ZA 3MAVA 3VJBA 2FTZA 1KIZA 4F62A 3ID0A 5DJVF 1WL0A 3LG5A 3CKEA 4KVDA 4RNQA 3KRFB 5IMPA 4KUXA 5ILZA 3DYHA 4KQ5A 5B01A 3SAEA 3RBMA 1WL1A 4E1EA 2Z4ZA 3N45F 3OYRA 5DJRF 4FJQA 4F6VA 3TC1A 5E8HA 5IKAA 4LPGF 1HXGA 3LVSA 3W7FA 4DEMF 1YYTA 4UMJA 5B0LA 5AHUB 5B0JA 2F7MF 2ZY1A 3OACB 2OPNA 4LZ3A 2ZEUA 2E8TA 3ACYA 3IBAA 3RYEA 4OMHA 5E8KA 4EA0A 1JFAA 3WCJA 3EGTA 3N5HF 5AELA 2J5CA 5JV1F 4LA6A 3LGKA 3LZ9A 4RXDA 3CP6A 4MC3A 2F8ZF 5DJPF 4NKFA 4NFKF 5IL8A 5EASA 3LK5A 4ZQ8A 3S4JA 5JV0F 1HM7A 3LMDA 4L2XF 1UBWA 5B0IA 2Z7IA 2E8XA 2ZCRA 3WCLA 3AQCB 4LIXA 2VF6A 3SDUA 3P5PA 3MZVA 3PYBA 4KVWA 4DHDA 2OGDA 3WJKA 3N46F 3KRPB 4LFVF 4LOBA 2ZCQA 4PVYF 4JXYA 1WL3A 2F94F 3CC9A 3ICNA 3WEHA 3ZL6A 2EWGA 2J1PA 4KK2A 4RYPA 1PS1A 4GP1A 4KWDA 2Z4XA 4LLSA 2AETA 3SDRA 4JZBA 3VJCA 4DWBA 3P8RA 4LXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQS F;  1UBX A;  3BNY A;  1YQ7 A;  3P41 A;  3WCE A;  5B03 A;  4NKE A;  3Q2Z A;  4Q23 A;  4QXS F;  2QIS A;  3KRO A;  3WCC A;  3OAB B;  4N1Z F;  4P0W A;  1HXC A;  1V4E A;  2Z50 A;  2E92 A;  4JZX A;  4OKZ A;  1V4H A;  3DYF A;  3NPK A;  1DI1 A;  3KBK A;  4LA5 A;  2OA6 A;  5KSX F;  4XQT F;  3N0G A;  3V1X A;  1RQI A;  3WSB A;  5B00 A;  5B02 A;  3NRI A;  4KVI A;  1RTR A;  5E8L A;  5ILK A;  5AFX A;  5H9D A;  3AQ0 A;  1N1Z A;  2H8O A;  3KRC A;  3Q1O A;  5ERO A;  3N5J F;  2ZEV A;  5ILY A;  2PS6 A;  4RXC A;  3N3L F;  4KPD A;  5IK0 A;  5JUZ F;  2AZL A;  3PYA A;  3SDT A;  1N24 A;  4GP2 A;  3LDW A;  3LLW A;  2ONG A;  1HXA A;  3P8L A;  3P5R A;  1VG7 A;  5IN8 A;  1YHK A;  2Z4V A;  3ACX A;  3LJI A;  3QQV A;  5DZ2 A;  3PKO A;  2ZCS A;  3WJO A;  4OKM A;  5B0K A;  1YYS A;  3V1V A;  1N21 A;  4HD1 A;  1VG6 A;  3APZ A;  2Z4Y A;  1WL2 A;  1VG4 A;  2AZK A;  5ER8 A;  3WEK A;  3ADZ A;  1YV5 A;  2E90 A;  1HM4 A;  5EAT A;  4XQR F;  3M00 A;  1YYR A;  4LZ0 A;  4KKM A;  4LUU A;  2E8U A;  4GAX A;  2PS7 A;  3ASX A;  4N9U A;  4RXE A;  2J1O A;  3WCB A;  3WCI A;  1WY0 A;  2E8V A;  2Q80 A;  3V66 A;  2AEL A;  3KRF A;  3TS7 A;  4PVX F;  1V4K A;  3DYG A;  3LSN A;  2PS5 A;  3WEJ A;  5ERN A;  3SDQ A;  3AE0 A;  2I19 A;  2ZCO A;  1HX9 A;  1RQJ A;  4MC0 A;  4KVY A;  3S9V A;  3G4F A;  2Z78 A;  2E95 A;  1EZF A;  1V4I A;  3SDV A;  4JVJ F;  2DH4 A;  3KRC B;  3WEI A;  1FPS A;  1WMW A;  2O1O A;  1N23 A;  4JYX A;  1JFG A;  4LFE A;  5C05 A;  2AEK A;  4GA3 A;  3NF2 A;  2AZJ A;  2FOR A;  4KFA A;  1YHM A;  5IK6 A;  3ICM A;  4NFJ F;  3B7L A;  3PH7 A;  3WCH A;  2Z52 A;  3Q30 A;  5IL3 A;  4MC8 A;  3TFP A;  3ICK A;  5DGS F;  1VG2 A;  4OGU A;  5HN8 A;  5A0K A;  3TFN A;  1N22 A;  3TFV A;  3AQB B;  1ZW5 A;  3N3D A;  2Q9Z A;  4OMG A;  1YHL A;  5DIQ F;  3UCA A;  5HNA A;  5IKH A;  3EZ3 A;  4F6X A;  4DWG A;  2OPM A;  3ZCD A;  3ICZ A;  3M0G A;  3KRP A;  4RXA A;  4P0V A;  2Z4W A;  4NUA A;  3ACW A;  2Z7H A;  2E93 A;  5ILD A;  1N20 A;  3LEE A;  1WKZ A;  2F92 F;  5B0M A;  5JA0 F;  5CG6 A;  3KRA A;  3VJ8 A;  3WJN A;  4LPH F;  5DGM F;  4DZW A;  4LZC A;  3WSA A;  4P0X A;  1YJ4 A;  4H5D F;  5IK9 A;  3WEG A;  3QKC A;  3N49 F;  3OAB A;  4FP4 A;  2F8C F;  3VJ9 A;  1YYQ A;  5A0J A;  3RMG A;  4KQU A;  1UBV A;  3WCD A;  3EFQ A;  3LOM A;  3G4D A;  2Q9Y A;  3KRO B;  1UBY A;  2RAH A;  5JV2 F;  4DXJ A;  3N6K F;  5DGN F;  2ONH A;  3N0F A;  3IPI A;  5I1U A;  4JXN A;  3VJD A;  3VJA A;  5DW7 A;  2E4O A;  2PS4 A;  5IM1 A;  4KPJ A;  1YYU A;  4H5C F;  4NG6 A;  2E91 A;  3M01 A;  3Q2Q A;  4LTV A;  3KB9 A;  1KIY A;  1N1B A;  2F89 F;  5IVG A;  3M02 A;  3M9U A;  5HN9 A;  2E8W A;  3OAC A;  3WEF A;  2Q58 A;  2E94 A;  3WE9 A;  3N1V F;  2P1C A;  3LGZ B;  4LFG A;  5EAU A;  4DI5 A;  1VG3 A;  3BNX A;  4LTZ A;  5ERM A;  5IMN A;  3KRA B;  3NPR A;  5IMI A;  3RYW A;  1V4J A;  5ILI A;  5A0I A;  3VJE A;  5CG5 A;  5DHI A;  5ILH A;  5AYP A;  4H5E F;  5DHK A;  4NFI F;  4K10 A;  5ILJ A;  4EA2 A;  4KQS A;  3ZOU A;  2PS8 A;  4E9U A;  3N1W F;  4QPF A;  3WC9 A;  1DGP A;  3WCG A;  3ZMB A;  4LLT A;  3WCF A;  4EA1 A;  2F9K F;  3WCA A;  3ZMC A;  5HN7 A;  3WCM A;  3PDE A;  4WK5 A;  4E9Z A;  3MAV A;  3VJB A;  2FTZ A;  1KIZ A;  4F62 A;  3ID0 A;  5DJV F;  1WL0 A;  3LG5 A;  3CKE A;  4KVD A;  4RNQ A;  3KRF B;  5IMP A;  4KUX A;  5ILZ A;  3DYH A;  4KQ5 A;  5B01 A;  3SAE A;  3RBM A;  1WL1 A;  4E1E A;  2Z4Z A;  3N45 F;  3OYR A;  5DJR F;  4FJQ A;  4F6V A;  3TC1 A;  5E8H A;  5IKA A;  4LPG F;  1HXG A;  3LVS A;  3W7F A;  4DEM F;  1YYT A;  4UMJ A;  5B0L A;  5AHU B;  5B0J A;  2F7M F;  2ZY1 A;  3OAC B;  2OPN A;  4LZ3 A;  2ZEU A;  2E8T A;  3ACY A;  3IBA A;  3RYE A;  4OMH A;  5E8K A;  4EA0 A;  1JFA A;  3WCJ A;  3EGT A;  3N5H F;  5AEL A;  2J5C A;  5JV1 F;  4LA6 A;  3LGK A;  3LZ9 A;  4RXD A;  3CP6 A;  4MC3 A;  2F8Z F;  5DJP F;  4NKF A;  4NFK F;  5IL8 A;  5EAS A;  3LK5 A;  4ZQ8 A;  3S4J A;  5JV0 F;  1HM7 A;  3LMD A;  4L2X F;  1UBW A;  5B0I A;  2Z7I A;  2E8X A;  2ZCR A;  3WCL A;  3AQC B;  4LIX A;  2VF6 A;  3SDU A;  3P5P A;  3MZV A;  3PYB A;  4KVW A;  4DHD A;  2OGD A;  3WJK A;  3N46 F;  3KRP B;  4LFV F;  4LOB A;  2ZCQ A;  4PVY F;  4JXY A;  1WL3 A;  2F94 F;  3CC9 A;  3ICN A;  3WEH A;  3ZL6 A;  2EWG A;  2J1P A;  4KK2 A;  4RYP A;  1PS1 A;  4GP1 A;  4KWD A;  2Z4X A;  4LLS A;  2AET A;  3SDR A;  4JZB A;  3VJC A;  4DWB A;  3P8R A;  4LXW A; 
#chains in the Genus database with same CATH topology
 4XQS F;  1UBX A;  3BNY A;  1YQ7 A;  3P41 A;  3WCE A;  5B03 A;  4NKE A;  3Q2Z A;  4Q23 A;  4QXS F;  2QIS A;  3KRO A;  3WCC A;  3OAB B;  4N1Z F;  4P0W A;  1HXC A;  1V4E A;  2Z50 A;  2E92 A;  4JZX A;  4OKZ A;  1V4H A;  3DYF A;  3NPK A;  1DI1 A;  3KBK A;  4LA5 A;  2OA6 A;  5KSX F;  4XQT F;  3N0G A;  3V1X A;  1RQI A;  3WSB A;  5B00 A;  5B02 A;  3NRI A;  4KVI A;  1RTR A;  5E8L A;  5ILK A;  5AFX A;  5H9D A;  3AQ0 A;  1N1Z A;  2H8O A;  3KRC A;  3Q1O A;  5ERO A;  3N5J F;  2ZEV A;  5ILY A;  2PS6 A;  4RXC A;  3N3L F;  4KPD A;  5IK0 A;  5JUZ F;  2AZL A;  3PYA A;  3SDT A;  1N24 A;  4GP2 A;  3LDW A;  3LLW A;  2ONG A;  1HXA A;  3P8L A;  3P5R A;  1VG7 A;  5IN8 A;  1YHK A;  2Z4V A;  3ACX A;  3LJI A;  3QQV A;  5DZ2 A;  3PKO A;  2ZCS A;  3WJO A;  4OKM A;  5B0K A;  1YYS A;  3V1V A;  1N21 A;  4HD1 A;  1VG6 A;  3APZ A;  2Z4Y A;  1WL2 A;  1VG4 A;  2AZK A;  5ER8 A;  3WEK A;  3ADZ A;  1YV5 A;  2E90 A;  1HM4 A;  5EAT A;  4XQR F;  3M00 A;  1YYR A;  4LZ0 A;  4KKM A;  4LUU A;  2E8U A;  4GAX A;  2PS7 A;  3ASX A;  4N9U A;  4RXE A;  2J1O A;  3WCB A;  3WCI A;  1WY0 A;  2E8V A;  2Q80 A;  3V66 A;  2AEL A;  3KRF A;  3TS7 A;  4PVX F;  1V4K A;  3DYG A;  3LSN A;  2PS5 A;  3WEJ A;  5ERN A;  3SDQ A;  3AE0 A;  2I19 A;  2ZCO A;  1HX9 A;  1RQJ A;  4MC0 A;  4KVY A;  3S9V A;  3G4F A;  2Z78 A;  2E95 A;  1EZF A;  1V4I A;  3SDV A;  4JVJ F;  2DH4 A;  3KRC B;  3WEI A;  1FPS A;  1WMW A;  2O1O A;  1N23 A;  4JYX A;  1JFG A;  4LFE A;  5C05 A;  2AEK A;  4GA3 A;  3NF2 A;  2AZJ A;  2FOR A;  4KFA A;  1YHM A;  5IK6 A;  3ICM A;  4NFJ F;  3B7L A;  3PH7 A;  3WCH A;  2Z52 A;  3Q30 A;  5IL3 A;  4MC8 A;  3TFP A;  3ICK A;  5DGS F;  1VG2 A;  4OGU A;  5HN8 A;  5A0K A;  3TFN A;  1N22 A;  3TFV A;  3AQB B;  1ZW5 A;  3N3D A;  2Q9Z A;  4OMG A;  1YHL A;  5DIQ F;  3UCA A;  5HNA A;  5IKH A;  3EZ3 A;  4F6X A;  4DWG A;  2OPM A;  3ZCD A;  3ICZ A;  3M0G A;  3KRP A;  4RXA A;  4P0V A;  2Z4W A;  4NUA A;  3ACW A;  2Z7H A;  2E93 A;  5ILD A;  1N20 A;  3LEE A;  1WKZ A;  2F92 F;  5B0M A;  5JA0 F;  5CG6 A;  3KRA A;  3VJ8 A;  3WJN A;  4LPH F;  5DGM F;  4DZW A;  4LZC A;  3WSA A;  4P0X A;  1YJ4 A;  4H5D F;  5IK9 A;  3WEG A;  3QKC A;  3N49 F;  3OAB A;  4FP4 A;  2F8C F;  3VJ9 A;  1YYQ A;  5A0J A;  3RMG A;  4KQU A;  1UBV A;  3WCD A;  3EFQ A;  3LOM A;  3G4D A;  2Q9Y A;  3KRO B;  1UBY A;  2RAH A;  5JV2 F;  4DXJ A;  3N6K F;  5DGN F;  2ONH A;  3N0F A;  3IPI A;  5I1U A;  4JXN A;  3VJD A;  3VJA A;  5DW7 A;  2E4O A;  2PS4 A;  5IM1 A;  4KPJ A;  1YYU A;  4H5C F;  4NG6 A;  2E91 A;  3M01 A;  3Q2Q A;  4LTV A;  3KB9 A;  1KIY A;  1N1B A;  2F89 F;  5IVG A;  3M02 A;  3M9U A;  5HN9 A;  2E8W A;  3OAC A;  3WEF A;  2Q58 A;  2E94 A;  3WE9 A;  3N1V F;  2P1C A;  3LGZ B;  4LFG A;  5EAU A;  4DI5 A;  1VG3 A;  3BNX A;  4LTZ A;  5ERM A;  5IMN A;  3KRA B;  3NPR A;  5IMI A;  3RYW A;  1V4J A;  5ILI A;  5A0I A;  3VJE A;  5CG5 A;  5DHI A;  5ILH A;  5AYP A;  4H5E F;  5DHK A;  4NFI F;  4K10 A;  5ILJ A;  4EA2 A;  4KQS A;  3ZOU A;  2PS8 A;  4E9U A;  3N1W F;  4QPF A;  3WC9 A;  1DGP A;  3WCG A;  3ZMB A;  4LLT A;  3WCF A;  4EA1 A;  2F9K F;  3WCA A;  3ZMC A;  5HN7 A;  3WCM A;  3PDE A;  4WK5 A;  4E9Z A;  3MAV A;  3VJB A;  2FTZ A;  1KIZ A;  4F62 A;  3ID0 A;  5DJV F;  1WL0 A;  3LG5 A;  3CKE A;  4KVD A;  4RNQ A;  3KRF B;  5IMP A;  4KUX A;  5ILZ A;  3DYH A;  4KQ5 A;  5B01 A;  3SAE A;  3RBM A;  1WL1 A;  4E1E A;  2Z4Z A;  3N45 F;  3OYR A;  5DJR F;  4FJQ A;  4F6V A;  3TC1 A;  5E8H A;  5IKA A;  4LPG F;  1HXG A;  3LVS A;  3W7F A;  4DEM F;  1YYT A;  4UMJ A;  5B0L A;  5AHU B;  5B0J A;  2F7M F;  2ZY1 A;  3OAC B;  2OPN A;  4LZ3 A;  2ZEU A;  2E8T A;  3ACY A;  3IBA A;  3RYE A;  4OMH A;  5E8K A;  4EA0 A;  1JFA A;  3WCJ A;  3EGT A;  3N5H F;  5AEL A;  2J5C A;  5JV1 F;  4LA6 A;  3LGK A;  3LZ9 A;  4RXD A;  3CP6 A;  4MC3 A;  2F8Z F;  5DJP F;  4NKF A;  4NFK F;  5IL8 A;  5EAS A;  3LK5 A;  4ZQ8 A;  3S4J A;  5JV0 F;  1HM7 A;  3LMD A;  4L2X F;  1UBW A;  5B0I A;  2Z7I A;  2E8X A;  2ZCR A;  3WCL A;  3AQC B;  4LIX A;  2VF6 A;  3SDU A;  3P5P A;  3MZV A;  3PYB A;  4KVW A;  4DHD A;  2OGD A;  3WJK A;  3N46 F;  3KRP B;  4LFV F;  4LOB A;  2ZCQ A;  4PVY F;  4JXY A;  1WL3 A;  2F94 F;  3CC9 A;  3ICN A;  3WEH A;  3ZL6 A;  2EWG A;  2J1P A;  4KK2 A;  4RYP A;  1PS1 A;  4GP1 A;  4KWD A;  2Z4X A;  4LLS A;  2AET A;  3SDR A;  4JZB A;  3VJC A;  4DWB A;  3P8R A;  4LXW A; 
#chains in the Genus database with same CATH homology
 4XQS F;  1UBX A;  3BNY A;  1YQ7 A;  3P41 A;  3WCE A;  5B03 A;  4NKE A;  3Q2Z A;  4Q23 A;  4QXS F;  2QIS A;  3KRO A;  3WCC A;  3OAB B;  4N1Z F;  4P0W A;  1HXC A;  1V4E A;  2Z50 A;  2E92 A;  4JZX A;  4OKZ A;  1V4H A;  3DYF A;  3NPK A;  1DI1 A;  3KBK A;  4LA5 A;  2OA6 A;  5KSX F;  4XQT F;  3N0G A;  3V1X A;  1RQI A;  3WSB A;  5B00 A;  5B02 A;  3NRI A;  4KVI A;  1RTR A;  5E8L A;  5ILK A;  5AFX A;  5H9D A;  3AQ0 A;  1N1Z A;  2H8O A;  3KRC A;  3Q1O A;  5ERO A;  3N5J F;  2ZEV A;  5ILY A;  2PS6 A;  4RXC A;  3N3L F;  4KPD A;  5IK0 A;  5JUZ F;  2AZL A;  3PYA A;  3SDT A;  1N24 A;  4GP2 A;  3LDW A;  3LLW A;  2ONG A;  1HXA A;  3P8L A;  3P5R A;  1VG7 A;  5IN8 A;  1YHK A;  2Z4V A;  3ACX A;  3LJI A;  3QQV A;  5DZ2 A;  3PKO A;  2ZCS A;  3WJO A;  4OKM A;  5B0K A;  1YYS A;  3V1V A;  1N21 A;  4HD1 A;  1VG6 A;  3APZ A;  2Z4Y A;  1WL2 A;  1VG4 A;  2AZK A;  5ER8 A;  3WEK A;  3ADZ A;  1YV5 A;  2E90 A;  1HM4 A;  5EAT A;  4XQR F;  3M00 A;  1YYR A;  4LZ0 A;  4KKM A;  4LUU A;  2E8U A;  4GAX A;  2PS7 A;  3ASX A;  4N9U A;  4RXE A;  2J1O A;  3WCB A;  3WCI A;  1WY0 A;  2E8V A;  2Q80 A;  3V66 A;  2AEL A;  3KRF A;  3TS7 A;  4PVX F;  1V4K A;  3DYG A;  3LSN A;  2PS5 A;  3WEJ A;  5ERN A;  3SDQ A;  3AE0 A;  2I19 A;  2ZCO A;  1HX9 A;  1RQJ A;  4MC0 A;  4KVY A;  3S9V A;  3G4F A;  2Z78 A;  2E95 A;  1EZF A;  1V4I A;  3SDV A;  4JVJ F;  2DH4 A;  3KRC B;  3WEI A;  1FPS A;  1WMW A;  2O1O A;  1N23 A;  4JYX A;  1JFG A;  4LFE A;  5C05 A;  2AEK A;  4GA3 A;  3NF2 A;  2AZJ A;  2FOR A;  4KFA A;  1YHM A;  5IK6 A;  3ICM A;  4NFJ F;  3B7L A;  3PH7 A;  3WCH A;  2Z52 A;  3Q30 A;  5IL3 A;  4MC8 A;  3TFP A;  3ICK A;  5DGS F;  1VG2 A;  4OGU A;  5HN8 A;  5A0K A;  3TFN A;  1N22 A;  3TFV A;  3AQB B;  1ZW5 A;  3N3D A;  2Q9Z A;  4OMG A;  1YHL A;  5DIQ F;  3UCA A;  5HNA A;  5IKH A;  3EZ3 A;  4F6X A;  4DWG A;  2OPM A;  3ZCD A;  3ICZ A;  3M0G A;  3KRP A;  4RXA A;  4P0V A;  2Z4W A;  4NUA A;  3ACW A;  2Z7H A;  2E93 A;  5ILD A;  1N20 A;  3LEE A;  1WKZ A;  2F92 F;  5B0M A;  5JA0 F;  5CG6 A;  3KRA A;  3VJ8 A;  3WJN A;  4LPH F;  5DGM F;  4DZW A;  4LZC A;  3WSA A;  4P0X A;  1YJ4 A;  4H5D F;  5IK9 A;  3WEG A;  3QKC A;  3N49 F;  3OAB A;  4FP4 A;  2F8C F;  3VJ9 A;  1YYQ A;  5A0J A;  3RMG A;  4KQU A;  1UBV A;  3WCD A;  3EFQ A;  3LOM A;  3G4D A;  2Q9Y A;  3KRO B;  1UBY A;  2RAH A;  5JV2 F;  4DXJ A;  3N6K F;  5DGN F;  2ONH A;  3N0F A;  3IPI A;  5I1U A;  4JXN A;  3VJD A;  3VJA A;  5DW7 A;  2E4O A;  2PS4 A;  5IM1 A;  4KPJ A;  1YYU A;  4H5C F;  4NG6 A;  2E91 A;  3M01 A;  3Q2Q A;  4LTV A;  3KB9 A;  1KIY A;  1N1B A;  2F89 F;  5IVG A;  3M02 A;  3M9U A;  5HN9 A;  2E8W A;  3OAC A;  3WEF A;  2Q58 A;  2E94 A;  3WE9 A;  3N1V F;  2P1C A;  3LGZ B;  4LFG A;  5EAU A;  4DI5 A;  1VG3 A;  3BNX A;  4LTZ A;  5ERM A;  5IMN A;  3KRA B;  3NPR A;  5IMI A;  3RYW A;  1V4J A;  5ILI A;  5A0I A;  3VJE A;  5CG5 A;  5DHI A;  5ILH A;  5AYP A;  4H5E F;  5DHK A;  4NFI F;  4K10 A;  5ILJ A;  4EA2 A;  4KQS A;  3ZOU A;  2PS8 A;  4E9U A;  3N1W F;  4QPF A;  3WC9 A;  1DGP A;  3WCG A;  3ZMB A;  4LLT A;  3WCF A;  4EA1 A;  2F9K F;  3WCA A;  3ZMC A;  5HN7 A;  3WCM A;  3PDE A;  4WK5 A;  4E9Z A;  3MAV A;  3VJB A;  2FTZ A;  1KIZ A;  4F62 A;  3ID0 A;  5DJV F;  1WL0 A;  3LG5 A;  3CKE A;  4KVD A;  4RNQ A;  3KRF B;  5IMP A;  4KUX A;  5ILZ A;  3DYH A;  4KQ5 A;  5B01 A;  3SAE A;  3RBM A;  1WL1 A;  4E1E A;  2Z4Z A;  3N45 F;  3OYR A;  5DJR F;  4FJQ A;  4F6V A;  3TC1 A;  5E8H A;  5IKA A;  4LPG F;  1HXG A;  3LVS A;  3W7F A;  4DEM F;  1YYT A;  4UMJ A;  5B0L A;  5AHU B;  5B0J A;  2F7M F;  2ZY1 A;  3OAC B;  2OPN A;  4LZ3 A;  2ZEU A;  2E8T A;  3ACY A;  3IBA A;  3RYE A;  4OMH A;  5E8K A;  4EA0 A;  1JFA A;  3WCJ A;  3EGT A;  3N5H F;  5AEL A;  2J5C A;  5JV1 F;  4LA6 A;  3LGK A;  3LZ9 A;  4RXD A;  3CP6 A;  4MC3 A;  2F8Z F;  5DJP F;  4NKF A;  4NFK F;  5IL8 A;  5EAS A;  3LK5 A;  4ZQ8 A;  3S4J A;  5JV0 F;  1HM7 A;  3LMD A;  4L2X F;  1UBW A;  5B0I A;  2Z7I A;  2E8X A;  2ZCR A;  3WCL A;  3AQC B;  4LIX A;  2VF6 A;  3SDU A;  3P5P A;  3MZV A;  3PYB A;  4KVW A;  4DHD A;  2OGD A;  3WJK A;  3N46 F;  3KRP B;  4LFV F;  4LOB A;  2ZCQ A;  4PVY F;  4JXY A;  1WL3 A;  2F94 F;  3CC9 A;  3ICN A;  3WEH A;  3ZL6 A;  2EWG A;  2J1P A;  4KK2 A;  4RYP A;  1PS1 A;  4GP1 A;  4KWD A;  2Z4X A;  4LLS A;  2AET A;  3SDR A;  4JZB A;  3VJC A;  4DWB A;  3P8R A;  4LXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...