5HN7A

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph-1158
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
360
structure length
347
Chain Sequence
FFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSIDVNNINVPQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIDNLIYKKIEDISMLMGEYFQIHDDYLDIFGDSTKTGKVSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl pyrophosphate synthase, putative
publication title Dynamic Structure and Inhibition of a Malaria Drug Target: Geranylgeranyl Diphosphate Synthase.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Transferase/transferase inhibitor
total genus 141
structure length 347
sequence length 360
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5hn7A00
2E90A 3WEIA 4LLSA 3VJEA 5C05A 3EGTA 3DYFA 5DW7A 2AZKA 5JA0F 5ILKA 5ILIA 3WSAA 3MZVA 4RXAA 5EROA 1V4IA 4LA5A 3WCLA 3CC9A 1V4EA 5A0KA 2F94F 1WL2A 3ICKA 4Q23A 3MAVA 3ZCDA 5EAUA 1UBVA 4RYPA 1V4KA 5IK6A 5ILJA 3NRIA 2E4OA 5DGNF 2AZJA 2ZEVA 3B7LA 4RXDA 3BNYA 1UBWA 3N6KF 1V4JA 3LMDA 2Q9ZA 3WEGA 3KROA 2OGDA 4XQRF 3ZMCA 4MC3A 2OPNA 3KB9A 3LVSA 1YHKA 2O1OA 5A0JA 2P1CA 1UBXA 5EATA 3OACB 3N45F 3M02A 4LA6A 3SDTA 3OABB 2ONHA 1KIYA 4JZXA 5AFXA 2Z50A 4DXJA 2I19A 3WEJA 5IMIA 3ICNA 3LDWA 2VF6A 1N23A 2Z4WA 3KRAA 2J1OA 3AQBB 4K10A 2E8TA 3DYGA 4KKMA 2Z4XA 3N1WF 5IL3A 3VJBA 3LJIA 3KRFB 2RAHA 2AELA 4RXCA 3P41A 1WMWA 4MC8A 1YYUA 2E8XA 5HNAA 4LFEA 3KRCB 3VJDA 3NF2A 3CP6A 4OKMA 5I1UA 1ZW5A 3QKCA 3WJNA 3LK5A 4P0XA 2Q9YA 2EWGA 4NUAA 1YYRA 4NFJF 3OACA 2Q58A 3G4DA 3WCIA 4QPFA 3WJKA 4NKFA 3OABA 1YV5A 2ZY1A 3WCDA 1HXGA 5AYPA 3P5PA 2F8CF 2J5CA 3LOMA 2E93A 5B0IA 1YQ7A 1N21A 3RYEA 3S4JA 5DJVF 3ICZA 4KQSA 1YHLA 4XQSF 2FTZA 3WCMA 4PVXF 1EZFA 3WCCA 3N1VF 5IM1A 2F7MF 2Q80A 3WCJA 1RQIA 3KBKA 1N22A 1WL0A 4LLTA 4LZ3A 1WKZA 3ICMA 1JFAA 3ACYA 4DEMF 1N1BA 2Z78A 3M01A 3WCFA 2E91A 2ZCSA 5B0MA 3RBMA 5H9DA 4KVDA 4DWBA 4GA3A 3ACWA 4F62A 3UCAA 3KRPA 3NPKA 1N20A 2OA6A 4KWDA 3M0GA 5B00A 1VG6A 4KQ5A 2E94A 4EA2A 1YHMA 3N49F 3P8LA 4WK5A 5IKHA 3WCEA 1PS1A 3WSBA 2Z4ZA 4LIXA 4KK2A 3PKOA 2J1PA 4QXSF 4F6XA 4KVWA 1UBYA 3V66A 3WC9A 5DHKA 2Z7HA 2Z7IA 4KVYA 5B0LA 3SDQA 3AQ0A 1KIZA 3ZMBA 4E1EA 4FJQA 3IPIA 3ZL6A 5JV1F 4RNQA 3M9UA 3Q1OA 4OGUA 1WL3A 2PS4A 3VJCA 4L2XF 4F6VA 1YYQA 3LZ9A 1RTRA 4UMJA 3ZOUA 4N1ZF 3ACXA 3LSNA 4JZBA 4N9UA 4JXNA 5DJRF 3LLWA 5A0IA 3V1VA 5IKAA 2PS7A 3LG5A 5DGMF 5IN8A 5JV2F 1HX9A 3ASXA 3WEFA 3TC1A 4H5CF 4LZ0A 4OMGA 3SAEA 3M00A 3P8RA 3G4FA 4DHDA 4PVYF 3BNXA 3N0GA 5ILYA 3WEKA 5ILHA 5ILDA 3WE9A 4LUUA 2ONGA 3VJ9A 5ERNA 3W7FA 3VJ8A 3SDRA 5IL8A 3WCGA 3LGKA 5EASA 3KRFA 4E9UA 2FORA 4H5EF 4JVJF 5CG6A 4MC0A 2ZCQA 3N46F 3KROB 2ZEUA 5AELA 3TS7A 1HM4A 3CKEA 3WEHA 3KRCA 5ER8A 3RYWA 4OKZA 4LTVA 5E8HA 4LXWA 5B02A 4EA0A 3LGZB 3EFQA 4KFAA 5IK9A 3AE0A 2H8OA 3KRAB 3EZ3A 4P0WA 1N1ZA 2PS5A 3AQCB 3DYHA 5JUZF 3TFNA 2AETA 3PDEA 1VG4A 2ZCRA 3N5JF 4OMHA 4KPDA 1JFGA 4LFGA 5DHIA 5IMNA 1HXCA 1YYTA 2Z4VA 3APZA 3PYAA 4DZWA 4GP1A 1VG7A 4NFIF 3RMGA 5IMPA 5KSXF 4ZQ8A 4NG6A 3P5RA 1HXAA 5DGSF 3OYRA 1N24A 2ZCOA 5B0KA 3ADZA 4LTZA 3WCBA 2E92A 4KQUA 2AZLA 3QQVA 3WCHA 2PS8A 1RQJA 1HM7A 2E8WA 3NPRA 4DI5A 4H5DF 4LFVF 5E8LA 4FP4A 3V1XA 4LOBA 5B01A 3VJAA 5ERMA 3TFPA 3PYBA 3LEEA 3N0FA 1VG2A 5B0JA 3SDUA 3ID0A 5ILZA 5B03A 3PH7A 5HN8A 5CG5A 2DH4A 2E8UA 1WL1A 2F9KF 5DIQF 2F8ZF 4DWGA 4NFKF 3TFVA 4KPJA 5HN7A 3N3DA 5IVGA 1FPSA 4GP2A 4KVIA 5E8KA 3WCAA 4JYXA 4E9ZA 3Q2ZA 2E8VA 4LPGF 2AEKA 4XQTF 2QISA 3KRPB 4LZCA 3WJOA 2OPMA 3Q30A 4NKEA 2E95A 5AHUB 2Z4YA 4LPHF 2PS6A 3SDVA 3IBAA 2Z52A 5HN9A 4P0VA 5IK0A 1DGPA 5DZ2A 3N3LF 1YYSA 5DJPF 4HD1A 1YJ4A 3Q2QA 1WY0A 2F92F 2F89F 1VG3A 4EA1A 4JXYA 5JV0F 3S9VA 1V4HA 4GAXA 1DI1A 4KUXA 4RXEA 3N5HF
chains in the Genus database with same CATH superfamily
2E90A 3WEIA 4LLSA 3VJEA 5C05A 3EGTA 3DYFA 5DW7A 2AZKA 5JA0F 5ILKA 5ILIA 3WSAA 3MZVA 4RXAA 5EROA 1V4IA 4LA5A 3WCLA 3CC9A 1V4EA 5A0KA 2F94F 1WL2A 3ICKA 4Q23A 3MAVA 3ZCDA 5EAUA 1UBVA 4RYPA 1V4KA 5IK6A 5ILJA 3NRIA 2E4OA 5DGNF 2AZJA 2ZEVA 3B7LA 4RXDA 3BNYA 1UBWA 3N6KF 1V4JA 3LMDA 2Q9ZA 3WEGA 3KROA 2OGDA 4XQRF 3ZMCA 4MC3A 2OPNA 3KB9A 3LVSA 1YHKA 2O1OA 5A0JA 2P1CA 1UBXA 5EATA 3OACB 3N45F 3M02A 4LA6A 3SDTA 3OABB 2ONHA 1KIYA 4JZXA 5AFXA 2Z50A 4DXJA 2I19A 3WEJA 5IMIA 3ICNA 3LDWA 2VF6A 1N23A 2Z4WA 3KRAA 2J1OA 3AQBB 4K10A 2E8TA 3DYGA 4KKMA 2Z4XA 3N1WF 5IL3A 3VJBA 3LJIA 3KRFB 2RAHA 2AELA 4RXCA 3P41A 1WMWA 4MC8A 1YYUA 2E8XA 5HNAA 4LFEA 3KRCB 3VJDA 3NF2A 3CP6A 4OKMA 5I1UA 1ZW5A 3QKCA 3WJNA 3LK5A 4P0XA 2Q9YA 2EWGA 4NUAA 1YYRA 4NFJF 3OACA 2Q58A 3G4DA 3WCIA 4QPFA 3WJKA 4NKFA 3OABA 1YV5A 2ZY1A 3WCDA 1HXGA 5AYPA 3P5PA 2F8CF 2J5CA 3LOMA 2E93A 5B0IA 1YQ7A 1N21A 3RYEA 3S4JA 5DJVF 3ICZA 4KQSA 1YHLA 4XQSF 2FTZA 3WCMA 4PVXF 1EZFA 3WCCA 3N1VF 5IM1A 2F7MF 2Q80A 3WCJA 1RQIA 3KBKA 1N22A 1WL0A 4LLTA 4LZ3A 1WKZA 3ICMA 1JFAA 3ACYA 4DEMF 1N1BA 2Z78A 3M01A 3WCFA 2E91A 2ZCSA 5B0MA 3RBMA 5H9DA 4KVDA 4DWBA 4GA3A 3ACWA 4F62A 3UCAA 3KRPA 3NPKA 1N20A 2OA6A 4KWDA 3M0GA 5B00A 1VG6A 4KQ5A 2E94A 4EA2A 1YHMA 3N49F 3P8LA 4WK5A 5IKHA 3WCEA 1PS1A 3WSBA 2Z4ZA 4LIXA 4KK2A 3PKOA 2J1PA 4QXSF 4F6XA 4KVWA 1UBYA 3V66A 3WC9A 5DHKA 2Z7HA 2Z7IA 4KVYA 5B0LA 3SDQA 3AQ0A 1KIZA 3ZMBA 4E1EA 4FJQA 3IPIA 3ZL6A 5JV1F 4RNQA 3M9UA 3Q1OA 4OGUA 1WL3A 2PS4A 3VJCA 4L2XF 4F6VA 1YYQA 3LZ9A 1RTRA 4UMJA 3ZOUA 4N1ZF 3ACXA 3LSNA 4JZBA 4N9UA 4JXNA 5DJRF 3LLWA 5A0IA 3V1VA 5IKAA 2PS7A 3LG5A 5DGMF 5IN8A 5JV2F 1HX9A 3ASXA 3WEFA 3TC1A 4H5CF 4LZ0A 4OMGA 3SAEA 3M00A 3P8RA 3G4FA 4DHDA 4PVYF 3BNXA 3N0GA 5ILYA 3WEKA 5ILHA 5ILDA 3WE9A 4LUUA 2ONGA 3VJ9A 5ERNA 3W7FA 3VJ8A 3SDRA 5IL8A 3WCGA 3LGKA 5EASA 3KRFA 4E9UA 2FORA 4H5EF 4JVJF 5CG6A 4MC0A 2ZCQA 3N46F 3KROB 2ZEUA 5AELA 3TS7A 1HM4A 3CKEA 3WEHA 3KRCA 5ER8A 3RYWA 4OKZA 4LTVA 5E8HA 4LXWA 5B02A 4EA0A 3LGZB 3EFQA 4KFAA 5IK9A 3AE0A 2H8OA 3KRAB 3EZ3A 4P0WA 1N1ZA 2PS5A 3AQCB 3DYHA 5JUZF 3TFNA 2AETA 3PDEA 1VG4A 2ZCRA 3N5JF 4OMHA 4KPDA 1JFGA 4LFGA 5DHIA 5IMNA 1HXCA 1YYTA 2Z4VA 3APZA 3PYAA 4DZWA 4GP1A 1VG7A 4NFIF 3RMGA 5IMPA 5KSXF 4ZQ8A 4NG6A 3P5RA 1HXAA 5DGSF 3OYRA 1N24A 2ZCOA 5B0KA 3ADZA 4LTZA 3WCBA 2E92A 4KQUA 2AZLA 3QQVA 3WCHA 2PS8A 1RQJA 1HM7A 2E8WA 3NPRA 4DI5A 4H5DF 4LFVF 5E8LA 4FP4A 3V1XA 4LOBA 5B01A 3VJAA 5ERMA 3TFPA 3PYBA 3LEEA 3N0FA 1VG2A 5B0JA 3SDUA 3ID0A 5ILZA 5B03A 3PH7A 5HN8A 5CG5A 2DH4A 2E8UA 1WL1A 2F9KF 5DIQF 2F8ZF 4DWGA 4NFKF 3TFVA 4KPJA 5HN7A 3N3DA 5IVGA 1FPSA 4GP2A 4KVIA 5E8KA 3WCAA 4JYXA 4E9ZA 3Q2ZA 2E8VA 4LPGF 2AEKA 4XQTF 2QISA 3KRPB 4LZCA 3WJOA 2OPMA 3Q30A 4NKEA 2E95A 5AHUB 2Z4YA 4LPHF 2PS6A 3SDVA 3IBAA 2Z52A 5HN9A 4P0VA 5IK0A 1DGPA 5DZ2A 3N3LF 1YYSA 5DJPF 4HD1A 1YJ4A 3Q2QA 1WY0A 2F92F 2F89F 1VG3A 4EA1A 4JXYA 5JV0F 3S9VA 1V4HA 4GAXA 1DI1A 4KUXA 4RXEA 3N5HF
chains in the Genus database with same CATH topology
2E90A 3WEIA 4LLSA 3VJEA 5C05A 3EGTA 3DYFA 5DW7A 2AZKA 5JA0F 5ILKA 5ILIA 3WSAA 3MZVA 4RXAA 5EROA 1V4IA 4LA5A 3WCLA 3CC9A 1V4EA 5A0KA 2F94F 1WL2A 3ICKA 4Q23A 3MAVA 3ZCDA 5EAUA 1UBVA 4RYPA 1V4KA 5IK6A 5ILJA 3NRIA 2E4OA 5DGNF 2AZJA 2ZEVA 3B7LA 4RXDA 3BNYA 1UBWA 3N6KF 1V4JA 3LMDA 2Q9ZA 3WEGA 3KROA 2OGDA 4XQRF 3ZMCA 4MC3A 2OPNA 3KB9A 3LVSA 1YHKA 2O1OA 5A0JA 2P1CA 1UBXA 5EATA 3OACB 3N45F 3M02A 4LA6A 3SDTA 3OABB 2ONHA 1KIYA 4JZXA 5AFXA 2Z50A 4DXJA 2I19A 3WEJA 5IMIA 3ICNA 3LDWA 2VF6A 1N23A 2Z4WA 3KRAA 2J1OA 3AQBB 4K10A 2E8TA 3DYGA 4KKMA 2Z4XA 3N1WF 5IL3A 3VJBA 3LJIA 3KRFB 2RAHA 2AELA 4RXCA 3P41A 1WMWA 4MC8A 1YYUA 2E8XA 5HNAA 4LFEA 3KRCB 3VJDA 3NF2A 3CP6A 4OKMA 5I1UA 1ZW5A 3QKCA 3WJNA 3LK5A 4P0XA 2Q9YA 2EWGA 4NUAA 1YYRA 4NFJF 3OACA 2Q58A 3G4DA 3WCIA 4QPFA 3WJKA 4NKFA 3OABA 1YV5A 2ZY1A 3WCDA 1HXGA 5AYPA 3P5PA 2F8CF 2J5CA 3LOMA 2E93A 5B0IA 1YQ7A 1N21A 3RYEA 3S4JA 5DJVF 3ICZA 4KQSA 1YHLA 4XQSF 2FTZA 3WCMA 4PVXF 1EZFA 3WCCA 3N1VF 5IM1A 2F7MF 2Q80A 3WCJA 1RQIA 3KBKA 1N22A 1WL0A 4LLTA 4LZ3A 1WKZA 3ICMA 1JFAA 3ACYA 4DEMF 1N1BA 2Z78A 3M01A 3WCFA 2E91A 2ZCSA 5B0MA 3RBMA 5H9DA 4KVDA 4DWBA 4GA3A 3ACWA 4F62A 3UCAA 3KRPA 3NPKA 1N20A 2OA6A 4KWDA 3M0GA 5B00A 1VG6A 4KQ5A 2E94A 4EA2A 1YHMA 3N49F 3P8LA 4WK5A 5IKHA 3WCEA 1PS1A 3WSBA 2Z4ZA 4LIXA 4KK2A 3PKOA 2J1PA 4QXSF 4F6XA 4KVWA 1UBYA 3V66A 3WC9A 5DHKA 2Z7HA 2Z7IA 4KVYA 5B0LA 3SDQA 3AQ0A 1KIZA 3ZMBA 4E1EA 4FJQA 3IPIA 3ZL6A 5JV1F 4RNQA 3M9UA 3Q1OA 4OGUA 1WL3A 2PS4A 3VJCA 4L2XF 4F6VA 1YYQA 3LZ9A 1RTRA 4UMJA 3ZOUA 4N1ZF 3ACXA 3LSNA 4JZBA 4N9UA 4JXNA 5DJRF 3LLWA 5A0IA 3V1VA 5IKAA 2PS7A 3LG5A 5DGMF 5IN8A 5JV2F 1HX9A 3ASXA 3WEFA 3TC1A 4H5CF 4LZ0A 4OMGA 3SAEA 3M00A 3P8RA 3G4FA 4DHDA 4PVYF 3BNXA 3N0GA 5ILYA 3WEKA 5ILHA 5ILDA 3WE9A 4LUUA 2ONGA 3VJ9A 5ERNA 3W7FA 3VJ8A 3SDRA 5IL8A 3WCGA 3LGKA 5EASA 3KRFA 4E9UA 2FORA 4H5EF 4JVJF 5CG6A 4MC0A 2ZCQA 3N46F 3KROB 2ZEUA 5AELA 3TS7A 1HM4A 3CKEA 3WEHA 3KRCA 5ER8A 3RYWA 4OKZA 4LTVA 5E8HA 4LXWA 5B02A 4EA0A 3LGZB 3EFQA 4KFAA 5IK9A 3AE0A 2H8OA 3KRAB 3EZ3A 4P0WA 1N1ZA 2PS5A 3AQCB 3DYHA 5JUZF 3TFNA 2AETA 3PDEA 1VG4A 2ZCRA 3N5JF 4OMHA 4KPDA 1JFGA 4LFGA 5DHIA 5IMNA 1HXCA 1YYTA 2Z4VA 3APZA 3PYAA 4DZWA 4GP1A 1VG7A 4NFIF 3RMGA 5IMPA 5KSXF 4ZQ8A 4NG6A 3P5RA 1HXAA 5DGSF 3OYRA 1N24A 2ZCOA 5B0KA 3ADZA 4LTZA 3WCBA 2E92A 4KQUA 2AZLA 3QQVA 3WCHA 2PS8A 1RQJA 1HM7A 2E8WA 3NPRA 4DI5A 4H5DF 4LFVF 5E8LA 4FP4A 3V1XA 4LOBA 5B01A 3VJAA 5ERMA 3TFPA 3PYBA 3LEEA 3N0FA 1VG2A 5B0JA 3SDUA 3ID0A 5ILZA 5B03A 3PH7A 5HN8A 5CG5A 2DH4A 2E8UA 1WL1A 2F9KF 5DIQF 2F8ZF 4DWGA 4NFKF 3TFVA 4KPJA 5HN7A 3N3DA 5IVGA 1FPSA 4GP2A 4KVIA 5E8KA 3WCAA 4JYXA 4E9ZA 3Q2ZA 2E8VA 4LPGF 2AEKA 4XQTF 2QISA 3KRPB 4LZCA 3WJOA 2OPMA 3Q30A 4NKEA 2E95A 5AHUB 2Z4YA 4LPHF 2PS6A 3SDVA 3IBAA 2Z52A 5HN9A 4P0VA 5IK0A 1DGPA 5DZ2A 3N3LF 1YYSA 5DJPF 4HD1A 1YJ4A 3Q2QA 1WY0A 2F92F 2F89F 1VG3A 4EA1A 4JXYA 5JV0F 3S9VA 1V4HA 4GAXA 1DI1A 4KUXA 4RXEA 3N5HF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E90 A;  3WEI A;  4LLS A;  3VJE A;  5C05 A;  3EGT A;  3DYF A;  5DW7 A;  2AZK A;  5JA0 F;  5ILK A;  5ILI A;  3WSA A;  3MZV A;  4RXA A;  5ERO A;  1V4I A;  4LA5 A;  3WCL A;  3CC9 A;  1V4E A;  5A0K A;  2F94 F;  1WL2 A;  3ICK A;  4Q23 A;  3MAV A;  3ZCD A;  5EAU A;  1UBV A;  4RYP A;  1V4K A;  5IK6 A;  5ILJ A;  3NRI A;  2E4O A;  5DGN F;  2AZJ A;  2ZEV A;  3B7L A;  4RXD A;  3BNY A;  1UBW A;  3N6K F;  1V4J A;  3LMD A;  2Q9Z A;  3WEG A;  3KRO A;  2OGD A;  4XQR F;  3ZMC A;  4MC3 A;  2OPN A;  3KB9 A;  3LVS A;  1YHK A;  2O1O A;  5A0J A;  2P1C A;  1UBX A;  5EAT A;  3OAC B;  3N45 F;  3M02 A;  4LA6 A;  3SDT A;  3OAB B;  2ONH A;  1KIY A;  4JZX A;  5AFX A;  2Z50 A;  4DXJ A;  2I19 A;  3WEJ A;  5IMI A;  3ICN A;  3LDW A;  2VF6 A;  1N23 A;  2Z4W A;  3KRA A;  2J1O A;  3AQB B;  4K10 A;  2E8T A;  3DYG A;  4KKM A;  2Z4X A;  3N1W F;  5IL3 A;  3VJB A;  3LJI A;  3KRF B;  2RAH A;  2AEL A;  4RXC A;  3P41 A;  1WMW A;  4MC8 A;  1YYU A;  2E8X A;  5HNA A;  4LFE A;  3KRC B;  3VJD A;  3NF2 A;  3CP6 A;  4OKM A;  5I1U A;  1ZW5 A;  3QKC A;  3WJN A;  3LK5 A;  4P0X A;  2Q9Y A;  2EWG A;  4NUA A;  1YYR A;  4NFJ F;  3OAC A;  2Q58 A;  3G4D A;  3WCI A;  4QPF A;  3WJK A;  4NKF A;  3OAB A;  1YV5 A;  2ZY1 A;  3WCD A;  1HXG A;  5AYP A;  3P5P A;  2F8C F;  2J5C A;  3LOM A;  2E93 A;  5B0I A;  1YQ7 A;  1N21 A;  3RYE A;  3S4J A;  5DJV F;  3ICZ A;  4KQS A;  1YHL A;  4XQS F;  2FTZ A;  3WCM A;  4PVX F;  1EZF A;  3WCC A;  3N1V F;  5IM1 A;  2F7M F;  2Q80 A;  3WCJ A;  1RQI A;  3KBK A;  1N22 A;  1WL0 A;  4LLT A;  4LZ3 A;  1WKZ A;  3ICM A;  1JFA A;  3ACY A;  4DEM F;  1N1B A;  2Z78 A;  3M01 A;  3WCF A;  2E91 A;  2ZCS A;  5B0M A;  3RBM A;  5H9D A;  4KVD A;  4DWB A;  4GA3 A;  3ACW A;  4F62 A;  3UCA A;  3KRP A;  3NPK A;  1N20 A;  2OA6 A;  4KWD A;  3M0G A;  5B00 A;  1VG6 A;  4KQ5 A;  2E94 A;  4EA2 A;  1YHM A;  3N49 F;  3P8L A;  4WK5 A;  5IKH A;  3WCE A;  1PS1 A;  3WSB A;  2Z4Z A;  4LIX A;  4KK2 A;  3PKO A;  2J1P A;  4QXS F;  4F6X A;  4KVW A;  1UBY A;  3V66 A;  3WC9 A;  5DHK A;  2Z7H A;  2Z7I A;  4KVY A;  5B0L A;  3SDQ A;  3AQ0 A;  1KIZ A;  3ZMB A;  4E1E A;  4FJQ A;  3IPI A;  3ZL6 A;  5JV1 F;  4RNQ A;  3M9U A;  3Q1O A;  4OGU A;  1WL3 A;  2PS4 A;  3VJC A;  4L2X F;  4F6V A;  1YYQ A;  3LZ9 A;  1RTR A;  4UMJ A;  3ZOU A;  4N1Z F;  3ACX A;  3LSN A;  4JZB A;  4N9U A;  4JXN A;  5DJR F;  3LLW A;  5A0I A;  3V1V A;  5IKA A;  2PS7 A;  3LG5 A;  5DGM F;  5IN8 A;  5JV2 F;  1HX9 A;  3ASX A;  3WEF A;  3TC1 A;  4H5C F;  4LZ0 A;  4OMG A;  3SAE A;  3M00 A;  3P8R A;  3G4F A;  4DHD A;  4PVY F;  3BNX A;  3N0G A;  5ILY A;  3WEK A;  5ILH A;  5ILD A;  3WE9 A;  4LUU A;  2ONG A;  3VJ9 A;  5ERN A;  3W7F A;  3VJ8 A;  3SDR A;  5IL8 A;  3WCG A;  3LGK A;  5EAS A;  3KRF A;  4E9U A;  2FOR A;  4H5E F;  4JVJ F;  5CG6 A;  4MC0 A;  2ZCQ A;  3N46 F;  3KRO B;  2ZEU A;  5AEL A;  3TS7 A;  1HM4 A;  3CKE A;  3WEH A;  3KRC A;  5ER8 A;  3RYW A;  4OKZ A;  4LTV A;  5E8H A;  4LXW A;  5B02 A;  4EA0 A;  3LGZ B;  3EFQ A;  4KFA A;  5IK9 A;  3AE0 A;  2H8O A;  3KRA B;  3EZ3 A;  4P0W A;  1N1Z A;  2PS5 A;  3AQC B;  3DYH A;  5JUZ F;  3TFN A;  2AET A;  3PDE A;  1VG4 A;  2ZCR A;  3N5J F;  4OMH A;  4KPD A;  1JFG A;  4LFG A;  5DHI A;  5IMN A;  1HXC A;  1YYT A;  2Z4V A;  3APZ A;  3PYA A;  4DZW A;  4GP1 A;  1VG7 A;  4NFI F;  3RMG A;  5IMP A;  5KSX F;  4ZQ8 A;  4NG6 A;  3P5R A;  1HXA A;  5DGS F;  3OYR A;  1N24 A;  2ZCO A;  5B0K A;  3ADZ A;  4LTZ A;  3WCB A;  2E92 A;  4KQU A;  2AZL A;  3QQV A;  3WCH A;  2PS8 A;  1RQJ A;  1HM7 A;  2E8W A;  3NPR A;  4DI5 A;  4H5D F;  4LFV F;  5E8L A;  4FP4 A;  3V1X A;  4LOB A;  5B01 A;  3VJA A;  5ERM A;  3TFP A;  3PYB A;  3LEE A;  3N0F A;  1VG2 A;  5B0J A;  3SDU A;  3ID0 A;  5ILZ A;  5B03 A;  3PH7 A;  5HN8 A;  5CG5 A;  2DH4 A;  2E8U A;  1WL1 A;  2F9K F;  5DIQ F;  2F8Z F;  4DWG A;  4NFK F;  3TFV A;  4KPJ A;  5HN7 A;  3N3D A;  5IVG A;  1FPS A;  4GP2 A;  4KVI A;  5E8K A;  3WCA A;  4JYX A;  4E9Z A;  3Q2Z A;  2E8V A;  4LPG F;  2AEK A;  4XQT F;  2QIS A;  3KRP B;  4LZC A;  3WJO A;  2OPM A;  3Q30 A;  4NKE A;  2E95 A;  5AHU B;  2Z4Y A;  4LPH F;  2PS6 A;  3SDV A;  3IBA A;  2Z52 A;  5HN9 A;  4P0V A;  5IK0 A;  1DGP A;  5DZ2 A;  3N3L F;  1YYS A;  5DJP F;  4HD1 A;  1YJ4 A;  3Q2Q A;  1WY0 A;  2F92 F;  2F89 F;  1VG3 A;  4EA1 A;  4JXY A;  5JV0 F;  3S9V A;  1V4H A;  4GAX A;  1DI1 A;  4KUX A;  4RXE A;  3N5H F; 
#chains in the Genus database with same CATH topology
 2E90 A;  3WEI A;  4LLS A;  3VJE A;  5C05 A;  3EGT A;  3DYF A;  5DW7 A;  2AZK A;  5JA0 F;  5ILK A;  5ILI A;  3WSA A;  3MZV A;  4RXA A;  5ERO A;  1V4I A;  4LA5 A;  3WCL A;  3CC9 A;  1V4E A;  5A0K A;  2F94 F;  1WL2 A;  3ICK A;  4Q23 A;  3MAV A;  3ZCD A;  5EAU A;  1UBV A;  4RYP A;  1V4K A;  5IK6 A;  5ILJ A;  3NRI A;  2E4O A;  5DGN F;  2AZJ A;  2ZEV A;  3B7L A;  4RXD A;  3BNY A;  1UBW A;  3N6K F;  1V4J A;  3LMD A;  2Q9Z A;  3WEG A;  3KRO A;  2OGD A;  4XQR F;  3ZMC A;  4MC3 A;  2OPN A;  3KB9 A;  3LVS A;  1YHK A;  2O1O A;  5A0J A;  2P1C A;  1UBX A;  5EAT A;  3OAC B;  3N45 F;  3M02 A;  4LA6 A;  3SDT A;  3OAB B;  2ONH A;  1KIY A;  4JZX A;  5AFX A;  2Z50 A;  4DXJ A;  2I19 A;  3WEJ A;  5IMI A;  3ICN A;  3LDW A;  2VF6 A;  1N23 A;  2Z4W A;  3KRA A;  2J1O A;  3AQB B;  4K10 A;  2E8T A;  3DYG A;  4KKM A;  2Z4X A;  3N1W F;  5IL3 A;  3VJB A;  3LJI A;  3KRF B;  2RAH A;  2AEL A;  4RXC A;  3P41 A;  1WMW A;  4MC8 A;  1YYU A;  2E8X A;  5HNA A;  4LFE A;  3KRC B;  3VJD A;  3NF2 A;  3CP6 A;  4OKM A;  5I1U A;  1ZW5 A;  3QKC A;  3WJN A;  3LK5 A;  4P0X A;  2Q9Y A;  2EWG A;  4NUA A;  1YYR A;  4NFJ F;  3OAC A;  2Q58 A;  3G4D A;  3WCI A;  4QPF A;  3WJK A;  4NKF A;  3OAB A;  1YV5 A;  2ZY1 A;  3WCD A;  1HXG A;  5AYP A;  3P5P A;  2F8C F;  2J5C A;  3LOM A;  2E93 A;  5B0I A;  1YQ7 A;  1N21 A;  3RYE A;  3S4J A;  5DJV F;  3ICZ A;  4KQS A;  1YHL A;  4XQS F;  2FTZ A;  3WCM A;  4PVX F;  1EZF A;  3WCC A;  3N1V F;  5IM1 A;  2F7M F;  2Q80 A;  3WCJ A;  1RQI A;  3KBK A;  1N22 A;  1WL0 A;  4LLT A;  4LZ3 A;  1WKZ A;  3ICM A;  1JFA A;  3ACY A;  4DEM F;  1N1B A;  2Z78 A;  3M01 A;  3WCF A;  2E91 A;  2ZCS A;  5B0M A;  3RBM A;  5H9D A;  4KVD A;  4DWB A;  4GA3 A;  3ACW A;  4F62 A;  3UCA A;  3KRP A;  3NPK A;  1N20 A;  2OA6 A;  4KWD A;  3M0G A;  5B00 A;  1VG6 A;  4KQ5 A;  2E94 A;  4EA2 A;  1YHM A;  3N49 F;  3P8L A;  4WK5 A;  5IKH A;  3WCE A;  1PS1 A;  3WSB A;  2Z4Z A;  4LIX A;  4KK2 A;  3PKO A;  2J1P A;  4QXS F;  4F6X A;  4KVW A;  1UBY A;  3V66 A;  3WC9 A;  5DHK A;  2Z7H A;  2Z7I A;  4KVY A;  5B0L A;  3SDQ A;  3AQ0 A;  1KIZ A;  3ZMB A;  4E1E A;  4FJQ A;  3IPI A;  3ZL6 A;  5JV1 F;  4RNQ A;  3M9U A;  3Q1O A;  4OGU A;  1WL3 A;  2PS4 A;  3VJC A;  4L2X F;  4F6V A;  1YYQ A;  3LZ9 A;  1RTR A;  4UMJ A;  3ZOU A;  4N1Z F;  3ACX A;  3LSN A;  4JZB A;  4N9U A;  4JXN A;  5DJR F;  3LLW A;  5A0I A;  3V1V A;  5IKA A;  2PS7 A;  3LG5 A;  5DGM F;  5IN8 A;  5JV2 F;  1HX9 A;  3ASX A;  3WEF A;  3TC1 A;  4H5C F;  4LZ0 A;  4OMG A;  3SAE A;  3M00 A;  3P8R A;  3G4F A;  4DHD A;  4PVY F;  3BNX A;  3N0G A;  5ILY A;  3WEK A;  5ILH A;  5ILD A;  3WE9 A;  4LUU A;  2ONG A;  3VJ9 A;  5ERN A;  3W7F A;  3VJ8 A;  3SDR A;  5IL8 A;  3WCG A;  3LGK A;  5EAS A;  3KRF A;  4E9U A;  2FOR A;  4H5E F;  4JVJ F;  5CG6 A;  4MC0 A;  2ZCQ A;  3N46 F;  3KRO B;  2ZEU A;  5AEL A;  3TS7 A;  1HM4 A;  3CKE A;  3WEH A;  3KRC A;  5ER8 A;  3RYW A;  4OKZ A;  4LTV A;  5E8H A;  4LXW A;  5B02 A;  4EA0 A;  3LGZ B;  3EFQ A;  4KFA A;  5IK9 A;  3AE0 A;  2H8O A;  3KRA B;  3EZ3 A;  4P0W A;  1N1Z A;  2PS5 A;  3AQC B;  3DYH A;  5JUZ F;  3TFN A;  2AET A;  3PDE A;  1VG4 A;  2ZCR A;  3N5J F;  4OMH A;  4KPD A;  1JFG A;  4LFG A;  5DHI A;  5IMN A;  1HXC A;  1YYT A;  2Z4V A;  3APZ A;  3PYA A;  4DZW A;  4GP1 A;  1VG7 A;  4NFI F;  3RMG A;  5IMP A;  5KSX F;  4ZQ8 A;  4NG6 A;  3P5R A;  1HXA A;  5DGS F;  3OYR A;  1N24 A;  2ZCO A;  5B0K A;  3ADZ A;  4LTZ A;  3WCB A;  2E92 A;  4KQU A;  2AZL A;  3QQV A;  3WCH A;  2PS8 A;  1RQJ A;  1HM7 A;  2E8W A;  3NPR A;  4DI5 A;  4H5D F;  4LFV F;  5E8L A;  4FP4 A;  3V1X A;  4LOB A;  5B01 A;  3VJA A;  5ERM A;  3TFP A;  3PYB A;  3LEE A;  3N0F A;  1VG2 A;  5B0J A;  3SDU A;  3ID0 A;  5ILZ A;  5B03 A;  3PH7 A;  5HN8 A;  5CG5 A;  2DH4 A;  2E8U A;  1WL1 A;  2F9K F;  5DIQ F;  2F8Z F;  4DWG A;  4NFK F;  3TFV A;  4KPJ A;  5HN7 A;  3N3D A;  5IVG A;  1FPS A;  4GP2 A;  4KVI A;  5E8K A;  3WCA A;  4JYX A;  4E9Z A;  3Q2Z A;  2E8V A;  4LPG F;  2AEK A;  4XQT F;  2QIS A;  3KRP B;  4LZC A;  3WJO A;  2OPM A;  3Q30 A;  4NKE A;  2E95 A;  5AHU B;  2Z4Y A;  4LPH F;  2PS6 A;  3SDV A;  3IBA A;  2Z52 A;  5HN9 A;  4P0V A;  5IK0 A;  1DGP A;  5DZ2 A;  3N3L F;  1YYS A;  5DJP F;  4HD1 A;  1YJ4 A;  3Q2Q A;  1WY0 A;  2F92 F;  2F89 F;  1VG3 A;  4EA1 A;  4JXY A;  5JV0 F;  3S9V A;  1V4H A;  4GAX A;  1DI1 A;  4KUX A;  4RXE A;  3N5H F; 
#chains in the Genus database with same CATH homology
 2E90 A;  3WEI A;  4LLS A;  3VJE A;  5C05 A;  3EGT A;  3DYF A;  5DW7 A;  2AZK A;  5JA0 F;  5ILK A;  5ILI A;  3WSA A;  3MZV A;  4RXA A;  5ERO A;  1V4I A;  4LA5 A;  3WCL A;  3CC9 A;  1V4E A;  5A0K A;  2F94 F;  1WL2 A;  3ICK A;  4Q23 A;  3MAV A;  3ZCD A;  5EAU A;  1UBV A;  4RYP A;  1V4K A;  5IK6 A;  5ILJ A;  3NRI A;  2E4O A;  5DGN F;  2AZJ A;  2ZEV A;  3B7L A;  4RXD A;  3BNY A;  1UBW A;  3N6K F;  1V4J A;  3LMD A;  2Q9Z A;  3WEG A;  3KRO A;  2OGD A;  4XQR F;  3ZMC A;  4MC3 A;  2OPN A;  3KB9 A;  3LVS A;  1YHK A;  2O1O A;  5A0J A;  2P1C A;  1UBX A;  5EAT A;  3OAC B;  3N45 F;  3M02 A;  4LA6 A;  3SDT A;  3OAB B;  2ONH A;  1KIY A;  4JZX A;  5AFX A;  2Z50 A;  4DXJ A;  2I19 A;  3WEJ A;  5IMI A;  3ICN A;  3LDW A;  2VF6 A;  1N23 A;  2Z4W A;  3KRA A;  2J1O A;  3AQB B;  4K10 A;  2E8T A;  3DYG A;  4KKM A;  2Z4X A;  3N1W F;  5IL3 A;  3VJB A;  3LJI A;  3KRF B;  2RAH A;  2AEL A;  4RXC A;  3P41 A;  1WMW A;  4MC8 A;  1YYU A;  2E8X A;  5HNA A;  4LFE A;  3KRC B;  3VJD A;  3NF2 A;  3CP6 A;  4OKM A;  5I1U A;  1ZW5 A;  3QKC A;  3WJN A;  3LK5 A;  4P0X A;  2Q9Y A;  2EWG A;  4NUA A;  1YYR A;  4NFJ F;  3OAC A;  2Q58 A;  3G4D A;  3WCI A;  4QPF A;  3WJK A;  4NKF A;  3OAB A;  1YV5 A;  2ZY1 A;  3WCD A;  1HXG A;  5AYP A;  3P5P A;  2F8C F;  2J5C A;  3LOM A;  2E93 A;  5B0I A;  1YQ7 A;  1N21 A;  3RYE A;  3S4J A;  5DJV F;  3ICZ A;  4KQS A;  1YHL A;  4XQS F;  2FTZ A;  3WCM A;  4PVX F;  1EZF A;  3WCC A;  3N1V F;  5IM1 A;  2F7M F;  2Q80 A;  3WCJ A;  1RQI A;  3KBK A;  1N22 A;  1WL0 A;  4LLT A;  4LZ3 A;  1WKZ A;  3ICM A;  1JFA A;  3ACY A;  4DEM F;  1N1B A;  2Z78 A;  3M01 A;  3WCF A;  2E91 A;  2ZCS A;  5B0M A;  3RBM A;  5H9D A;  4KVD A;  4DWB A;  4GA3 A;  3ACW A;  4F62 A;  3UCA A;  3KRP A;  3NPK A;  1N20 A;  2OA6 A;  4KWD A;  3M0G A;  5B00 A;  1VG6 A;  4KQ5 A;  2E94 A;  4EA2 A;  1YHM A;  3N49 F;  3P8L A;  4WK5 A;  5IKH A;  3WCE A;  1PS1 A;  3WSB A;  2Z4Z A;  4LIX A;  4KK2 A;  3PKO A;  2J1P A;  4QXS F;  4F6X A;  4KVW A;  1UBY A;  3V66 A;  3WC9 A;  5DHK A;  2Z7H A;  2Z7I A;  4KVY A;  5B0L A;  3SDQ A;  3AQ0 A;  1KIZ A;  3ZMB A;  4E1E A;  4FJQ A;  3IPI A;  3ZL6 A;  5JV1 F;  4RNQ A;  3M9U A;  3Q1O A;  4OGU A;  1WL3 A;  2PS4 A;  3VJC A;  4L2X F;  4F6V A;  1YYQ A;  3LZ9 A;  1RTR A;  4UMJ A;  3ZOU A;  4N1Z F;  3ACX A;  3LSN A;  4JZB A;  4N9U A;  4JXN A;  5DJR F;  3LLW A;  5A0I A;  3V1V A;  5IKA A;  2PS7 A;  3LG5 A;  5DGM F;  5IN8 A;  5JV2 F;  1HX9 A;  3ASX A;  3WEF A;  3TC1 A;  4H5C F;  4LZ0 A;  4OMG A;  3SAE A;  3M00 A;  3P8R A;  3G4F A;  4DHD A;  4PVY F;  3BNX A;  3N0G A;  5ILY A;  3WEK A;  5ILH A;  5ILD A;  3WE9 A;  4LUU A;  2ONG A;  3VJ9 A;  5ERN A;  3W7F A;  3VJ8 A;  3SDR A;  5IL8 A;  3WCG A;  3LGK A;  5EAS A;  3KRF A;  4E9U A;  2FOR A;  4H5E F;  4JVJ F;  5CG6 A;  4MC0 A;  2ZCQ A;  3N46 F;  3KRO B;  2ZEU A;  5AEL A;  3TS7 A;  1HM4 A;  3CKE A;  3WEH A;  3KRC A;  5ER8 A;  3RYW A;  4OKZ A;  4LTV A;  5E8H A;  4LXW A;  5B02 A;  4EA0 A;  3LGZ B;  3EFQ A;  4KFA A;  5IK9 A;  3AE0 A;  2H8O A;  3KRA B;  3EZ3 A;  4P0W A;  1N1Z A;  2PS5 A;  3AQC B;  3DYH A;  5JUZ F;  3TFN A;  2AET A;  3PDE A;  1VG4 A;  2ZCR A;  3N5J F;  4OMH A;  4KPD A;  1JFG A;  4LFG A;  5DHI A;  5IMN A;  1HXC A;  1YYT A;  2Z4V A;  3APZ A;  3PYA A;  4DZW A;  4GP1 A;  1VG7 A;  4NFI F;  3RMG A;  5IMP A;  5KSX F;  4ZQ8 A;  4NG6 A;  3P5R A;  1HXA A;  5DGS F;  3OYR A;  1N24 A;  2ZCO A;  5B0K A;  3ADZ A;  4LTZ A;  3WCB A;  2E92 A;  4KQU A;  2AZL A;  3QQV A;  3WCH A;  2PS8 A;  1RQJ A;  1HM7 A;  2E8W A;  3NPR A;  4DI5 A;  4H5D F;  4LFV F;  5E8L A;  4FP4 A;  3V1X A;  4LOB A;  5B01 A;  3VJA A;  5ERM A;  3TFP A;  3PYB A;  3LEE A;  3N0F A;  1VG2 A;  5B0J A;  3SDU A;  3ID0 A;  5ILZ A;  5B03 A;  3PH7 A;  5HN8 A;  5CG5 A;  2DH4 A;  2E8U A;  1WL1 A;  2F9K F;  5DIQ F;  2F8Z F;  4DWG A;  4NFK F;  3TFV A;  4KPJ A;  5HN7 A;  3N3D A;  5IVG A;  1FPS A;  4GP2 A;  4KVI A;  5E8K A;  3WCA A;  4JYX A;  4E9Z A;  3Q2Z A;  2E8V A;  4LPG F;  2AEK A;  4XQT F;  2QIS A;  3KRP B;  4LZC A;  3WJO A;  2OPM A;  3Q30 A;  4NKE A;  2E95 A;  5AHU B;  2Z4Y A;  4LPH F;  2PS6 A;  3SDV A;  3IBA A;  2Z52 A;  5HN9 A;  4P0V A;  5IK0 A;  1DGP A;  5DZ2 A;  3N3L F;  1YYS A;  5DJP F;  4HD1 A;  1YJ4 A;  3Q2Q A;  1WY0 A;  2F92 F;  2F89 F;  1VG3 A;  4EA1 A;  4JXY A;  5JV0 F;  3S9V A;  1V4H A;  4GAX A;  1DI1 A;  4KUX A;  4RXE A;  3N5H F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...