3EZ3A

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase pvx_092040 with zoledronate and ipp bound
Total Genus 147
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
147
sequence length
363
structure length
358
Chain Sequence
LAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKNRINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSEIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIAVDNLIYKKIEDISMLMGEYFQIHDDYLDIFGDSTKTGKVGSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFTGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Farnesyl pyrophosphate synthase, putative
publication title Crystal Structure of Plasmodium vivax geranylgeranylpyrophosphate synthase PVX_092040 with zoledronate and IPP bound
rcsb
source organism Plasmodium vivax
total genus 147
structure length 358
sequence length 363
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3ez3A00
5IN8A 2E8VA 3VJAA 2AZJA 4NFIF 5IM1A 3WCAA 2O1OA 1EZFA 4H5DF 3OYRA 1VG4A 4LIXA 4LFVF 4KKMA 3N46F 4KK2A 2Z4ZA 4RYPA 2E8UA 3LSNA 3KRCA 2Z4XA 2Z4VA 3LJIA 3WCCA 4JZXA 4P0VA 3VJCA 3WJOA 3TFVA 5IKAA 5JV2F 4LLTA 3SDRA 4MC3A 3WEIA 4EA2A 5JA0F 3RMGA 3WCBA 5DZ2A 1UBVA 1RQJA 5HNAA 2E8XA 2PS7A 3KB9A 1KIZA 2DH4A 4NUAA 3P5PA 2F7MF 3ZMBA 3WE9A 3N5HF 3DYGA 4EA1A 1V4JA 4JVJF 5AFXA 1DI1A 3WCGA 5A0IA 5AHUB 3AE0A 1WL2A 3KBKA 3N49F 3WCJA 5AELA 4OMGA 4F6XA 1VG7A 4ZQ8A 4LZ3A 1WL3A 2H8OA 4KQSA 4MC0A 5DJPF 3KROB 2AETA 4L2XF 3KRPB 2Q9YA 3TC1A 3N45F 1YYSA 1WL1A 2E94A 3ASXA 5DGMF 1V4KA 3CC9A 4RXEA 5DHKA 5E8KA 2Z50A 5IK9A 2ZEVA 5AYPA 3WC9A 1YYQA 5IMIA 2E8TA 1RTRA 5KSXF 4OGUA 4NFKF 5ILHA 3NPRA 3SDVA 4H5CF 2Q9ZA 3PKOA 3CKEA 5EASA 1YJ4A 2Q58A 1HM4A 1N1BA 1UBWA 4P0XA 5ILKA 3LVSA 1HX9A 2ZCSA 3M0GA 2E95A 2Q80A 4FP4A 1JFAA 5JV0F 2FTZA 5EATA 4DEMF 5HN9A 4P0WA 5ERNA 3S9VA 3LDWA 3TFPA 1N23A 4LA5A 3M9UA 2ZY1A 4GA3A 2OPMA 3N0GA 5ILZA 5JUZF 2E91A 3N1VF 4FJQA 4H5EF 4NKFA 2P1CA 3SDUA 4KUXA 3TFNA 4KFAA 1YYTA 4OKZA 5H9DA 2E8WA 3ACYA 2ONGA 3W7FA 1WY0A 2Z4YA 4LLSA 2Z52A 2VF6A 1YHLA 3WCMA 2OGDA 3EGTA 5DGNF 3NF2A 4LPGF 3VJBA 4LOBA 5JV1F 4KVDA 3LMDA 5B02A 1YHKA 3ACWA 1WL0A 3ZL6A 3NPKA 3KRFB 4JYXA 3M02A 4RXDA 3LG5A 4LUUA 3ICZA 2E4OA 3DYHA 3VJ8A 4XQRF 2F8ZF 4HD1A 4E9ZA 1ZW5A 1YYUA 1UBYA 3IPIA 2Z4WA 3WCFA 4DWGA 3KROA 3M00A 4N9UA 5HN7A 1UBXA 3CP6A 3SDTA 3UCAA 1V4IA 3KRPA 5ER8A 4QPFA 2PS8A 5B0LA 2Z78A 3ID0A 2AELA 5ILDA 2PS4A 3LLWA 1N1ZA 4PVXF 1KIYA 3WCDA 2PS6A 4F62A 3ICKA 3WEHA 4PVYF 3N0FA 3WSBA 5B0KA 3P8RA 4LA6A 3KRAB 4GP1A 4WK5A 3M01A 3RYEA 1HXAA 5A0KA 3ACXA 3QKCA 4N1ZF 3WEJA 1WMWA 5ILJA 5ERMA 3ICMA 3AQ0A 3EZ3A 4F6VA 3AQBB 4JXYA 5DGSF 1V4EA 3WSAA 3V1XA 1HM7A 4GP2A 2QISA 1YV5A 4NFJF 3RBMA 3OACB 1YQ7A 1YHMA 5B03A 5I1UA 3WJKA 2E93A 3V1VA 4XQTF 1N20A 4EA0A 2F9KF 5CG5A 2AEKA 2PS5A 4LPHF 4KVWA 5IK0A 2FORA 4DWBA 1N21A 2I19A 4JZBA 3LOMA 1V4HA 3ADZA 3Q1OA 3VJEA 1DGPA 3WEKA 4MC8A 3OABB 5IVGA 5E8HA 5IL8A 4OKMA 3G4FA 3QQVA 3G4DA 2EWGA 3P8LA 5B0JA 1N22A 4KPJA 2E90A 3KRFA 5IMPA 2OA6A 4LZCA 3LGKA 4K10A 4E1EA 3EFQA 1HXCA 5DJVF 2J5CA 5C05A 5CG6A 5IK6A 3V66A 5EROA 3PYAA 1JFGA 5B00A 3KRCB 2F94F 3N1WF 4LXWA 4RXCA 3N3LF 4KPDA 4KQ5A 3N3DA 4KQUA 5B0MA 3Q30A 3SDQA 2RAHA 2E92A 4LTVA 5IL3A 2ZCOA 3TS7A 3PH7A 4JXNA 4NG6A 4DI5A 3WCHA 4QXSF 2AZLA 3APZA 4RNQA 1HXGA 5ILYA 3P5RA 3N6KF 4DHDA 2ONHA 3ZOUA 3SAEA 3Q2ZA 5B01A 3IBAA 2J1PA 3LGZB 1VG3A 3DYFA 5IKHA 3WJNA 1WKZA 3KRAA 4LZ0A 4KVYA 5DW7A 4DXJA 4RXAA 2OPNA 3ZMCA 4XQSF 3LZ9A 1VG2A 3LK5A 1VG6A 4DZWA 4KVIA 3WEFA 4UMJA 3VJDA 3WEGA 3VJ9A 5HN8A 4LTZA 3N5JF 2F89F 3WCLA 3RYWA 4KWDA 4LFGA 2ZEUA 3PDEA 2Z7IA 3NRIA 3AQCB 3BNYA 5E8LA 5IMNA 3OACA 1N24A 4E9UA 1RQIA 2F92F 4GAXA 4Q23A 3WCEA 2F8CF 3ZCDA 5B0IA 1FPSA 2ZCRA 3PYBA 5DJRF 3Q2QA 2AZKA 3LEEA 3B7LA 5A0JA 4NKEA 1PS1A 1YYRA 2J1OA 5EAUA 3ICNA 2Z7HA 2ZCQA 3MAVA 5DHIA 3WCIA 3MZVA 3P41A 3OABA 3BNXA 5DIQF 4OMHA 4LFEA 3S4JA 5ILIA
chains in the Genus database with same CATH superfamily
5IN8A 2E8VA 3VJAA 2AZJA 4NFIF 5IM1A 3WCAA 2O1OA 1EZFA 4H5DF 3OYRA 1VG4A 4LIXA 4LFVF 4KKMA 3N46F 4KK2A 2Z4ZA 4RYPA 2E8UA 3LSNA 3KRCA 2Z4XA 2Z4VA 3LJIA 3WCCA 4JZXA 4P0VA 3VJCA 3WJOA 3TFVA 5IKAA 5JV2F 4LLTA 3SDRA 4MC3A 3WEIA 4EA2A 5JA0F 3RMGA 3WCBA 5DZ2A 1UBVA 1RQJA 5HNAA 2E8XA 2PS7A 3KB9A 1KIZA 2DH4A 4NUAA 3P5PA 2F7MF 3ZMBA 3WE9A 3N5HF 3DYGA 4EA1A 1V4JA 4JVJF 5AFXA 1DI1A 3WCGA 5A0IA 5AHUB 3AE0A 1WL2A 3KBKA 3N49F 3WCJA 5AELA 4OMGA 4F6XA 1VG7A 4ZQ8A 4LZ3A 1WL3A 2H8OA 4KQSA 4MC0A 5DJPF 3KROB 2AETA 4L2XF 3KRPB 2Q9YA 3TC1A 3N45F 1YYSA 1WL1A 2E94A 3ASXA 5DGMF 1V4KA 3CC9A 4RXEA 5DHKA 5E8KA 2Z50A 5IK9A 2ZEVA 5AYPA 3WC9A 1YYQA 5IMIA 2E8TA 1RTRA 5KSXF 4OGUA 4NFKF 5ILHA 3NPRA 3SDVA 4H5CF 2Q9ZA 3PKOA 3CKEA 5EASA 1YJ4A 2Q58A 1HM4A 1N1BA 1UBWA 4P0XA 5ILKA 3LVSA 1HX9A 2ZCSA 3M0GA 2E95A 2Q80A 4FP4A 1JFAA 5JV0F 2FTZA 5EATA 4DEMF 5HN9A 4P0WA 5ERNA 3S9VA 3LDWA 3TFPA 1N23A 4LA5A 3M9UA 2ZY1A 4GA3A 2OPMA 3N0GA 5ILZA 5JUZF 2E91A 3N1VF 4FJQA 4H5EF 4NKFA 2P1CA 3SDUA 4KUXA 3TFNA 4KFAA 1YYTA 4OKZA 5H9DA 2E8WA 3ACYA 2ONGA 3W7FA 1WY0A 2Z4YA 4LLSA 2Z52A 2VF6A 1YHLA 3WCMA 2OGDA 3EGTA 5DGNF 3NF2A 4LPGF 3VJBA 4LOBA 5JV1F 4KVDA 3LMDA 5B02A 1YHKA 3ACWA 1WL0A 3ZL6A 3NPKA 3KRFB 4JYXA 3M02A 4RXDA 3LG5A 4LUUA 3ICZA 2E4OA 3DYHA 3VJ8A 4XQRF 2F8ZF 4HD1A 4E9ZA 1ZW5A 1YYUA 1UBYA 3IPIA 2Z4WA 3WCFA 4DWGA 3KROA 3M00A 4N9UA 5HN7A 1UBXA 3CP6A 3SDTA 3UCAA 1V4IA 3KRPA 5ER8A 4QPFA 2PS8A 5B0LA 2Z78A 3ID0A 2AELA 5ILDA 2PS4A 3LLWA 1N1ZA 4PVXF 1KIYA 3WCDA 2PS6A 4F62A 3ICKA 3WEHA 4PVYF 3N0FA 3WSBA 5B0KA 3P8RA 4LA6A 3KRAB 4GP1A 4WK5A 3M01A 3RYEA 1HXAA 5A0KA 3ACXA 3QKCA 4N1ZF 3WEJA 1WMWA 5ILJA 5ERMA 3ICMA 3AQ0A 3EZ3A 4F6VA 3AQBB 4JXYA 5DGSF 1V4EA 3WSAA 3V1XA 1HM7A 4GP2A 2QISA 1YV5A 4NFJF 3RBMA 3OACB 1YQ7A 1YHMA 5B03A 5I1UA 3WJKA 2E93A 3V1VA 4XQTF 1N20A 4EA0A 2F9KF 5CG5A 2AEKA 2PS5A 4LPHF 4KVWA 5IK0A 2FORA 4DWBA 1N21A 2I19A 4JZBA 3LOMA 1V4HA 3ADZA 3Q1OA 3VJEA 1DGPA 3WEKA 4MC8A 3OABB 5IVGA 5E8HA 5IL8A 4OKMA 3G4FA 3QQVA 3G4DA 2EWGA 3P8LA 5B0JA 1N22A 4KPJA 2E90A 3KRFA 5IMPA 2OA6A 4LZCA 3LGKA 4K10A 4E1EA 3EFQA 1HXCA 5DJVF 2J5CA 5C05A 5CG6A 5IK6A 3V66A 5EROA 3PYAA 1JFGA 5B00A 3KRCB 2F94F 3N1WF 4LXWA 4RXCA 3N3LF 4KPDA 4KQ5A 3N3DA 4KQUA 5B0MA 3Q30A 3SDQA 2RAHA 2E92A 4LTVA 5IL3A 2ZCOA 3TS7A 3PH7A 4JXNA 4NG6A 4DI5A 3WCHA 4QXSF 2AZLA 3APZA 4RNQA 1HXGA 5ILYA 3P5RA 3N6KF 4DHDA 2ONHA 3ZOUA 3SAEA 3Q2ZA 5B01A 3IBAA 2J1PA 3LGZB 1VG3A 3DYFA 5IKHA 3WJNA 1WKZA 3KRAA 4LZ0A 4KVYA 5DW7A 4DXJA 4RXAA 2OPNA 3ZMCA 4XQSF 3LZ9A 1VG2A 3LK5A 1VG6A 4DZWA 4KVIA 3WEFA 4UMJA 3VJDA 3WEGA 3VJ9A 5HN8A 4LTZA 3N5JF 2F89F 3WCLA 3RYWA 4KWDA 4LFGA 2ZEUA 3PDEA 2Z7IA 3NRIA 3AQCB 3BNYA 5E8LA 5IMNA 3OACA 1N24A 4E9UA 1RQIA 2F92F 4GAXA 4Q23A 3WCEA 2F8CF 3ZCDA 5B0IA 1FPSA 2ZCRA 3PYBA 5DJRF 3Q2QA 2AZKA 3LEEA 3B7LA 5A0JA 4NKEA 1PS1A 1YYRA 2J1OA 5EAUA 3ICNA 2Z7HA 2ZCQA 3MAVA 5DHIA 3WCIA 3MZVA 3P41A 3OABA 3BNXA 5DIQF 4OMHA 4LFEA 3S4JA 5ILIA
chains in the Genus database with same CATH topology
5IN8A 2E8VA 3VJAA 2AZJA 4NFIF 5IM1A 3WCAA 2O1OA 1EZFA 4H5DF 3OYRA 1VG4A 4LIXA 4LFVF 4KKMA 3N46F 4KK2A 2Z4ZA 4RYPA 2E8UA 3LSNA 3KRCA 2Z4XA 2Z4VA 3LJIA 3WCCA 4JZXA 4P0VA 3VJCA 3WJOA 3TFVA 5IKAA 5JV2F 4LLTA 3SDRA 4MC3A 3WEIA 4EA2A 5JA0F 3RMGA 3WCBA 5DZ2A 1UBVA 1RQJA 5HNAA 2E8XA 2PS7A 3KB9A 1KIZA 2DH4A 4NUAA 3P5PA 2F7MF 3ZMBA 3WE9A 3N5HF 3DYGA 4EA1A 1V4JA 4JVJF 5AFXA 1DI1A 3WCGA 5A0IA 5AHUB 3AE0A 1WL2A 3KBKA 3N49F 3WCJA 5AELA 4OMGA 4F6XA 1VG7A 4ZQ8A 4LZ3A 1WL3A 2H8OA 4KQSA 4MC0A 5DJPF 3KROB 2AETA 4L2XF 3KRPB 2Q9YA 3TC1A 3N45F 1YYSA 1WL1A 2E94A 3ASXA 5DGMF 1V4KA 3CC9A 4RXEA 5DHKA 5E8KA 2Z50A 5IK9A 2ZEVA 5AYPA 3WC9A 1YYQA 5IMIA 2E8TA 1RTRA 5KSXF 4OGUA 4NFKF 5ILHA 3NPRA 3SDVA 4H5CF 2Q9ZA 3PKOA 3CKEA 5EASA 1YJ4A 2Q58A 1HM4A 1N1BA 1UBWA 4P0XA 5ILKA 3LVSA 1HX9A 2ZCSA 3M0GA 2E95A 2Q80A 4FP4A 1JFAA 5JV0F 2FTZA 5EATA 4DEMF 5HN9A 4P0WA 5ERNA 3S9VA 3LDWA 3TFPA 1N23A 4LA5A 3M9UA 2ZY1A 4GA3A 2OPMA 3N0GA 5ILZA 5JUZF 2E91A 3N1VF 4FJQA 4H5EF 4NKFA 2P1CA 3SDUA 4KUXA 3TFNA 4KFAA 1YYTA 4OKZA 5H9DA 2E8WA 3ACYA 2ONGA 3W7FA 1WY0A 2Z4YA 4LLSA 2Z52A 2VF6A 1YHLA 3WCMA 2OGDA 3EGTA 5DGNF 3NF2A 4LPGF 3VJBA 4LOBA 5JV1F 4KVDA 3LMDA 5B02A 1YHKA 3ACWA 1WL0A 3ZL6A 3NPKA 3KRFB 4JYXA 3M02A 4RXDA 3LG5A 4LUUA 3ICZA 2E4OA 3DYHA 3VJ8A 4XQRF 2F8ZF 4HD1A 4E9ZA 1ZW5A 1YYUA 1UBYA 3IPIA 2Z4WA 3WCFA 4DWGA 3KROA 3M00A 4N9UA 5HN7A 1UBXA 3CP6A 3SDTA 3UCAA 1V4IA 3KRPA 5ER8A 4QPFA 2PS8A 5B0LA 2Z78A 3ID0A 2AELA 5ILDA 2PS4A 3LLWA 1N1ZA 4PVXF 1KIYA 3WCDA 2PS6A 4F62A 3ICKA 3WEHA 4PVYF 3N0FA 3WSBA 5B0KA 3P8RA 4LA6A 3KRAB 4GP1A 4WK5A 3M01A 3RYEA 1HXAA 5A0KA 3ACXA 3QKCA 4N1ZF 3WEJA 1WMWA 5ILJA 5ERMA 3ICMA 3AQ0A 3EZ3A 4F6VA 3AQBB 4JXYA 5DGSF 1V4EA 3WSAA 3V1XA 1HM7A 4GP2A 2QISA 1YV5A 4NFJF 3RBMA 3OACB 1YQ7A 1YHMA 5B03A 5I1UA 3WJKA 2E93A 3V1VA 4XQTF 1N20A 4EA0A 2F9KF 5CG5A 2AEKA 2PS5A 4LPHF 4KVWA 5IK0A 2FORA 4DWBA 1N21A 2I19A 4JZBA 3LOMA 1V4HA 3ADZA 3Q1OA 3VJEA 1DGPA 3WEKA 4MC8A 3OABB 5IVGA 5E8HA 5IL8A 4OKMA 3G4FA 3QQVA 3G4DA 2EWGA 3P8LA 5B0JA 1N22A 4KPJA 2E90A 3KRFA 5IMPA 2OA6A 4LZCA 3LGKA 4K10A 4E1EA 3EFQA 1HXCA 5DJVF 2J5CA 5C05A 5CG6A 5IK6A 3V66A 5EROA 3PYAA 1JFGA 5B00A 3KRCB 2F94F 3N1WF 4LXWA 4RXCA 3N3LF 4KPDA 4KQ5A 3N3DA 4KQUA 5B0MA 3Q30A 3SDQA 2RAHA 2E92A 4LTVA 5IL3A 2ZCOA 3TS7A 3PH7A 4JXNA 4NG6A 4DI5A 3WCHA 4QXSF 2AZLA 3APZA 4RNQA 1HXGA 5ILYA 3P5RA 3N6KF 4DHDA 2ONHA 3ZOUA 3SAEA 3Q2ZA 5B01A 3IBAA 2J1PA 3LGZB 1VG3A 3DYFA 5IKHA 3WJNA 1WKZA 3KRAA 4LZ0A 4KVYA 5DW7A 4DXJA 4RXAA 2OPNA 3ZMCA 4XQSF 3LZ9A 1VG2A 3LK5A 1VG6A 4DZWA 4KVIA 3WEFA 4UMJA 3VJDA 3WEGA 3VJ9A 5HN8A 4LTZA 3N5JF 2F89F 3WCLA 3RYWA 4KWDA 4LFGA 2ZEUA 3PDEA 2Z7IA 3NRIA 3AQCB 3BNYA 5E8LA 5IMNA 3OACA 1N24A 4E9UA 1RQIA 2F92F 4GAXA 4Q23A 3WCEA 2F8CF 3ZCDA 5B0IA 1FPSA 2ZCRA 3PYBA 5DJRF 3Q2QA 2AZKA 3LEEA 3B7LA 5A0JA 4NKEA 1PS1A 1YYRA 2J1OA 5EAUA 3ICNA 2Z7HA 2ZCQA 3MAVA 5DHIA 3WCIA 3MZVA 3P41A 3OABA 3BNXA 5DIQF 4OMHA 4LFEA 3S4JA 5ILIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IN8 A;  2E8V A;  3VJA A;  2AZJ A;  4NFI F;  5IM1 A;  3WCA A;  2O1O A;  1EZF A;  4H5D F;  3OYR A;  1VG4 A;  4LIX A;  4LFV F;  4KKM A;  3N46 F;  4KK2 A;  2Z4Z A;  4RYP A;  2E8U A;  3LSN A;  3KRC A;  2Z4X A;  2Z4V A;  3LJI A;  3WCC A;  4JZX A;  4P0V A;  3VJC A;  3WJO A;  3TFV A;  5IKA A;  5JV2 F;  4LLT A;  3SDR A;  4MC3 A;  3WEI A;  4EA2 A;  5JA0 F;  3RMG A;  3WCB A;  5DZ2 A;  1UBV A;  1RQJ A;  5HNA A;  2E8X A;  2PS7 A;  3KB9 A;  1KIZ A;  2DH4 A;  4NUA A;  3P5P A;  2F7M F;  3ZMB A;  3WE9 A;  3N5H F;  3DYG A;  4EA1 A;  1V4J A;  4JVJ F;  5AFX A;  1DI1 A;  3WCG A;  5A0I A;  5AHU B;  3AE0 A;  1WL2 A;  3KBK A;  3N49 F;  3WCJ A;  5AEL A;  4OMG A;  4F6X A;  1VG7 A;  4ZQ8 A;  4LZ3 A;  1WL3 A;  2H8O A;  4KQS A;  4MC0 A;  5DJP F;  3KRO B;  2AET A;  4L2X F;  3KRP B;  2Q9Y A;  3TC1 A;  3N45 F;  1YYS A;  1WL1 A;  2E94 A;  3ASX A;  5DGM F;  1V4K A;  3CC9 A;  4RXE A;  5DHK A;  5E8K A;  2Z50 A;  5IK9 A;  2ZEV A;  5AYP A;  3WC9 A;  1YYQ A;  5IMI A;  2E8T A;  1RTR A;  5KSX F;  4OGU A;  4NFK F;  5ILH A;  3NPR A;  3SDV A;  4H5C F;  2Q9Z A;  3PKO A;  3CKE A;  5EAS A;  1YJ4 A;  2Q58 A;  1HM4 A;  1N1B A;  1UBW A;  4P0X A;  5ILK A;  3LVS A;  1HX9 A;  2ZCS A;  3M0G A;  2E95 A;  2Q80 A;  4FP4 A;  1JFA A;  5JV0 F;  2FTZ A;  5EAT A;  4DEM F;  5HN9 A;  4P0W A;  5ERN A;  3S9V A;  3LDW A;  3TFP A;  1N23 A;  4LA5 A;  3M9U A;  2ZY1 A;  4GA3 A;  2OPM A;  3N0G A;  5ILZ A;  5JUZ F;  2E91 A;  3N1V F;  4FJQ A;  4H5E F;  4NKF A;  2P1C A;  3SDU A;  4KUX A;  3TFN A;  4KFA A;  1YYT A;  4OKZ A;  5H9D A;  2E8W A;  3ACY A;  2ONG A;  3W7F A;  1WY0 A;  2Z4Y A;  4LLS A;  2Z52 A;  2VF6 A;  1YHL A;  3WCM A;  2OGD A;  3EGT A;  5DGN F;  3NF2 A;  4LPG F;  3VJB A;  4LOB A;  5JV1 F;  4KVD A;  3LMD A;  5B02 A;  1YHK A;  3ACW A;  1WL0 A;  3ZL6 A;  3NPK A;  3KRF B;  4JYX A;  3M02 A;  4RXD A;  3LG5 A;  4LUU A;  3ICZ A;  2E4O A;  3DYH A;  3VJ8 A;  4XQR F;  2F8Z F;  4HD1 A;  4E9Z A;  1ZW5 A;  1YYU A;  1UBY A;  3IPI A;  2Z4W A;  3WCF A;  4DWG A;  3KRO A;  3M00 A;  4N9U A;  5HN7 A;  1UBX A;  3CP6 A;  3SDT A;  3UCA A;  1V4I A;  3KRP A;  5ER8 A;  4QPF A;  2PS8 A;  5B0L A;  2Z78 A;  3ID0 A;  2AEL A;  5ILD A;  2PS4 A;  3LLW A;  1N1Z A;  4PVX F;  1KIY A;  3WCD A;  2PS6 A;  4F62 A;  3ICK A;  3WEH A;  4PVY F;  3N0F A;  3WSB A;  5B0K A;  3P8R A;  4LA6 A;  3KRA B;  4GP1 A;  4WK5 A;  3M01 A;  3RYE A;  1HXA A;  5A0K A;  3ACX A;  3QKC A;  4N1Z F;  3WEJ A;  1WMW A;  5ILJ A;  5ERM A;  3ICM A;  3AQ0 A;  3EZ3 A;  4F6V A;  3AQB B;  4JXY A;  5DGS F;  1V4E A;  3WSA A;  3V1X A;  1HM7 A;  4GP2 A;  2QIS A;  1YV5 A;  4NFJ F;  3RBM A;  3OAC B;  1YQ7 A;  1YHM A;  5B03 A;  5I1U A;  3WJK A;  2E93 A;  3V1V A;  4XQT F;  1N20 A;  4EA0 A;  2F9K F;  5CG5 A;  2AEK A;  2PS5 A;  4LPH F;  4KVW A;  5IK0 A;  2FOR A;  4DWB A;  1N21 A;  2I19 A;  4JZB A;  3LOM A;  1V4H A;  3ADZ A;  3Q1O A;  3VJE A;  1DGP A;  3WEK A;  4MC8 A;  3OAB B;  5IVG A;  5E8H A;  5IL8 A;  4OKM A;  3G4F A;  3QQV A;  3G4D A;  2EWG A;  3P8L A;  5B0J A;  1N22 A;  4KPJ A;  2E90 A;  3KRF A;  5IMP A;  2OA6 A;  4LZC A;  3LGK A;  4K10 A;  4E1E A;  3EFQ A;  1HXC A;  5DJV F;  2J5C A;  5C05 A;  5CG6 A;  5IK6 A;  3V66 A;  5ERO A;  3PYA A;  1JFG A;  5B00 A;  3KRC B;  2F94 F;  3N1W F;  4LXW A;  4RXC A;  3N3L F;  4KPD A;  4KQ5 A;  3N3D A;  4KQU A;  5B0M A;  3Q30 A;  3SDQ A;  2RAH A;  2E92 A;  4LTV A;  5IL3 A;  2ZCO A;  3TS7 A;  3PH7 A;  4JXN A;  4NG6 A;  4DI5 A;  3WCH A;  4QXS F;  2AZL A;  3APZ A;  4RNQ A;  1HXG A;  5ILY A;  3P5R A;  3N6K F;  4DHD A;  2ONH A;  3ZOU A;  3SAE A;  3Q2Z A;  5B01 A;  3IBA A;  2J1P A;  3LGZ B;  1VG3 A;  3DYF A;  5IKH A;  3WJN A;  1WKZ A;  3KRA A;  4LZ0 A;  4KVY A;  5DW7 A;  4DXJ A;  4RXA A;  2OPN A;  3ZMC A;  4XQS F;  3LZ9 A;  1VG2 A;  3LK5 A;  1VG6 A;  4DZW A;  4KVI A;  3WEF A;  4UMJ A;  3VJD A;  3WEG A;  3VJ9 A;  5HN8 A;  4LTZ A;  3N5J F;  2F89 F;  3WCL A;  3RYW A;  4KWD A;  4LFG A;  2ZEU A;  3PDE A;  2Z7I A;  3NRI A;  3AQC B;  3BNY A;  5E8L A;  5IMN A;  3OAC A;  1N24 A;  4E9U A;  1RQI A;  2F92 F;  4GAX A;  4Q23 A;  3WCE A;  2F8C F;  3ZCD A;  5B0I A;  1FPS A;  2ZCR A;  3PYB A;  5DJR F;  3Q2Q A;  2AZK A;  3LEE A;  3B7L A;  5A0J A;  4NKE A;  1PS1 A;  1YYR A;  2J1O A;  5EAU A;  3ICN A;  2Z7H A;  2ZCQ A;  3MAV A;  5DHI A;  3WCI A;  3MZV A;  3P41 A;  3OAB A;  3BNX A;  5DIQ F;  4OMH A;  4LFE A;  3S4J A;  5ILI A; 
#chains in the Genus database with same CATH topology
 5IN8 A;  2E8V A;  3VJA A;  2AZJ A;  4NFI F;  5IM1 A;  3WCA A;  2O1O A;  1EZF A;  4H5D F;  3OYR A;  1VG4 A;  4LIX A;  4LFV F;  4KKM A;  3N46 F;  4KK2 A;  2Z4Z A;  4RYP A;  2E8U A;  3LSN A;  3KRC A;  2Z4X A;  2Z4V A;  3LJI A;  3WCC A;  4JZX A;  4P0V A;  3VJC A;  3WJO A;  3TFV A;  5IKA A;  5JV2 F;  4LLT A;  3SDR A;  4MC3 A;  3WEI A;  4EA2 A;  5JA0 F;  3RMG A;  3WCB A;  5DZ2 A;  1UBV A;  1RQJ A;  5HNA A;  2E8X A;  2PS7 A;  3KB9 A;  1KIZ A;  2DH4 A;  4NUA A;  3P5P A;  2F7M F;  3ZMB A;  3WE9 A;  3N5H F;  3DYG A;  4EA1 A;  1V4J A;  4JVJ F;  5AFX A;  1DI1 A;  3WCG A;  5A0I A;  5AHU B;  3AE0 A;  1WL2 A;  3KBK A;  3N49 F;  3WCJ A;  5AEL A;  4OMG A;  4F6X A;  1VG7 A;  4ZQ8 A;  4LZ3 A;  1WL3 A;  2H8O A;  4KQS A;  4MC0 A;  5DJP F;  3KRO B;  2AET A;  4L2X F;  3KRP B;  2Q9Y A;  3TC1 A;  3N45 F;  1YYS A;  1WL1 A;  2E94 A;  3ASX A;  5DGM F;  1V4K A;  3CC9 A;  4RXE A;  5DHK A;  5E8K A;  2Z50 A;  5IK9 A;  2ZEV A;  5AYP A;  3WC9 A;  1YYQ A;  5IMI A;  2E8T A;  1RTR A;  5KSX F;  4OGU A;  4NFK F;  5ILH A;  3NPR A;  3SDV A;  4H5C F;  2Q9Z A;  3PKO A;  3CKE A;  5EAS A;  1YJ4 A;  2Q58 A;  1HM4 A;  1N1B A;  1UBW A;  4P0X A;  5ILK A;  3LVS A;  1HX9 A;  2ZCS A;  3M0G A;  2E95 A;  2Q80 A;  4FP4 A;  1JFA A;  5JV0 F;  2FTZ A;  5EAT A;  4DEM F;  5HN9 A;  4P0W A;  5ERN A;  3S9V A;  3LDW A;  3TFP A;  1N23 A;  4LA5 A;  3M9U A;  2ZY1 A;  4GA3 A;  2OPM A;  3N0G A;  5ILZ A;  5JUZ F;  2E91 A;  3N1V F;  4FJQ A;  4H5E F;  4NKF A;  2P1C A;  3SDU A;  4KUX A;  3TFN A;  4KFA A;  1YYT A;  4OKZ A;  5H9D A;  2E8W A;  3ACY A;  2ONG A;  3W7F A;  1WY0 A;  2Z4Y A;  4LLS A;  2Z52 A;  2VF6 A;  1YHL A;  3WCM A;  2OGD A;  3EGT A;  5DGN F;  3NF2 A;  4LPG F;  3VJB A;  4LOB A;  5JV1 F;  4KVD A;  3LMD A;  5B02 A;  1YHK A;  3ACW A;  1WL0 A;  3ZL6 A;  3NPK A;  3KRF B;  4JYX A;  3M02 A;  4RXD A;  3LG5 A;  4LUU A;  3ICZ A;  2E4O A;  3DYH A;  3VJ8 A;  4XQR F;  2F8Z F;  4HD1 A;  4E9Z A;  1ZW5 A;  1YYU A;  1UBY A;  3IPI A;  2Z4W A;  3WCF A;  4DWG A;  3KRO A;  3M00 A;  4N9U A;  5HN7 A;  1UBX A;  3CP6 A;  3SDT A;  3UCA A;  1V4I A;  3KRP A;  5ER8 A;  4QPF A;  2PS8 A;  5B0L A;  2Z78 A;  3ID0 A;  2AEL A;  5ILD A;  2PS4 A;  3LLW A;  1N1Z A;  4PVX F;  1KIY A;  3WCD A;  2PS6 A;  4F62 A;  3ICK A;  3WEH A;  4PVY F;  3N0F A;  3WSB A;  5B0K A;  3P8R A;  4LA6 A;  3KRA B;  4GP1 A;  4WK5 A;  3M01 A;  3RYE A;  1HXA A;  5A0K A;  3ACX A;  3QKC A;  4N1Z F;  3WEJ A;  1WMW A;  5ILJ A;  5ERM A;  3ICM A;  3AQ0 A;  3EZ3 A;  4F6V A;  3AQB B;  4JXY A;  5DGS F;  1V4E A;  3WSA A;  3V1X A;  1HM7 A;  4GP2 A;  2QIS A;  1YV5 A;  4NFJ F;  3RBM A;  3OAC B;  1YQ7 A;  1YHM A;  5B03 A;  5I1U A;  3WJK A;  2E93 A;  3V1V A;  4XQT F;  1N20 A;  4EA0 A;  2F9K F;  5CG5 A;  2AEK A;  2PS5 A;  4LPH F;  4KVW A;  5IK0 A;  2FOR A;  4DWB A;  1N21 A;  2I19 A;  4JZB A;  3LOM A;  1V4H A;  3ADZ A;  3Q1O A;  3VJE A;  1DGP A;  3WEK A;  4MC8 A;  3OAB B;  5IVG A;  5E8H A;  5IL8 A;  4OKM A;  3G4F A;  3QQV A;  3G4D A;  2EWG A;  3P8L A;  5B0J A;  1N22 A;  4KPJ A;  2E90 A;  3KRF A;  5IMP A;  2OA6 A;  4LZC A;  3LGK A;  4K10 A;  4E1E A;  3EFQ A;  1HXC A;  5DJV F;  2J5C A;  5C05 A;  5CG6 A;  5IK6 A;  3V66 A;  5ERO A;  3PYA A;  1JFG A;  5B00 A;  3KRC B;  2F94 F;  3N1W F;  4LXW A;  4RXC A;  3N3L F;  4KPD A;  4KQ5 A;  3N3D A;  4KQU A;  5B0M A;  3Q30 A;  3SDQ A;  2RAH A;  2E92 A;  4LTV A;  5IL3 A;  2ZCO A;  3TS7 A;  3PH7 A;  4JXN A;  4NG6 A;  4DI5 A;  3WCH A;  4QXS F;  2AZL A;  3APZ A;  4RNQ A;  1HXG A;  5ILY A;  3P5R A;  3N6K F;  4DHD A;  2ONH A;  3ZOU A;  3SAE A;  3Q2Z A;  5B01 A;  3IBA A;  2J1P A;  3LGZ B;  1VG3 A;  3DYF A;  5IKH A;  3WJN A;  1WKZ A;  3KRA A;  4LZ0 A;  4KVY A;  5DW7 A;  4DXJ A;  4RXA A;  2OPN A;  3ZMC A;  4XQS F;  3LZ9 A;  1VG2 A;  3LK5 A;  1VG6 A;  4DZW A;  4KVI A;  3WEF A;  4UMJ A;  3VJD A;  3WEG A;  3VJ9 A;  5HN8 A;  4LTZ A;  3N5J F;  2F89 F;  3WCL A;  3RYW A;  4KWD A;  4LFG A;  2ZEU A;  3PDE A;  2Z7I A;  3NRI A;  3AQC B;  3BNY A;  5E8L A;  5IMN A;  3OAC A;  1N24 A;  4E9U A;  1RQI A;  2F92 F;  4GAX A;  4Q23 A;  3WCE A;  2F8C F;  3ZCD A;  5B0I A;  1FPS A;  2ZCR A;  3PYB A;  5DJR F;  3Q2Q A;  2AZK A;  3LEE A;  3B7L A;  5A0J A;  4NKE A;  1PS1 A;  1YYR A;  2J1O A;  5EAU A;  3ICN A;  2Z7H A;  2ZCQ A;  3MAV A;  5DHI A;  3WCI A;  3MZV A;  3P41 A;  3OAB A;  3BNX A;  5DIQ F;  4OMH A;  4LFE A;  3S4J A;  5ILI A; 
#chains in the Genus database with same CATH homology
 5IN8 A;  2E8V A;  3VJA A;  2AZJ A;  4NFI F;  5IM1 A;  3WCA A;  2O1O A;  1EZF A;  4H5D F;  3OYR A;  1VG4 A;  4LIX A;  4LFV F;  4KKM A;  3N46 F;  4KK2 A;  2Z4Z A;  4RYP A;  2E8U A;  3LSN A;  3KRC A;  2Z4X A;  2Z4V A;  3LJI A;  3WCC A;  4JZX A;  4P0V A;  3VJC A;  3WJO A;  3TFV A;  5IKA A;  5JV2 F;  4LLT A;  3SDR A;  4MC3 A;  3WEI A;  4EA2 A;  5JA0 F;  3RMG A;  3WCB A;  5DZ2 A;  1UBV A;  1RQJ A;  5HNA A;  2E8X A;  2PS7 A;  3KB9 A;  1KIZ A;  2DH4 A;  4NUA A;  3P5P A;  2F7M F;  3ZMB A;  3WE9 A;  3N5H F;  3DYG A;  4EA1 A;  1V4J A;  4JVJ F;  5AFX A;  1DI1 A;  3WCG A;  5A0I A;  5AHU B;  3AE0 A;  1WL2 A;  3KBK A;  3N49 F;  3WCJ A;  5AEL A;  4OMG A;  4F6X A;  1VG7 A;  4ZQ8 A;  4LZ3 A;  1WL3 A;  2H8O A;  4KQS A;  4MC0 A;  5DJP F;  3KRO B;  2AET A;  4L2X F;  3KRP B;  2Q9Y A;  3TC1 A;  3N45 F;  1YYS A;  1WL1 A;  2E94 A;  3ASX A;  5DGM F;  1V4K A;  3CC9 A;  4RXE A;  5DHK A;  5E8K A;  2Z50 A;  5IK9 A;  2ZEV A;  5AYP A;  3WC9 A;  1YYQ A;  5IMI A;  2E8T A;  1RTR A;  5KSX F;  4OGU A;  4NFK F;  5ILH A;  3NPR A;  3SDV A;  4H5C F;  2Q9Z A;  3PKO A;  3CKE A;  5EAS A;  1YJ4 A;  2Q58 A;  1HM4 A;  1N1B A;  1UBW A;  4P0X A;  5ILK A;  3LVS A;  1HX9 A;  2ZCS A;  3M0G A;  2E95 A;  2Q80 A;  4FP4 A;  1JFA A;  5JV0 F;  2FTZ A;  5EAT A;  4DEM F;  5HN9 A;  4P0W A;  5ERN A;  3S9V A;  3LDW A;  3TFP A;  1N23 A;  4LA5 A;  3M9U A;  2ZY1 A;  4GA3 A;  2OPM A;  3N0G A;  5ILZ A;  5JUZ F;  2E91 A;  3N1V F;  4FJQ A;  4H5E F;  4NKF A;  2P1C A;  3SDU A;  4KUX A;  3TFN A;  4KFA A;  1YYT A;  4OKZ A;  5H9D A;  2E8W A;  3ACY A;  2ONG A;  3W7F A;  1WY0 A;  2Z4Y A;  4LLS A;  2Z52 A;  2VF6 A;  1YHL A;  3WCM A;  2OGD A;  3EGT A;  5DGN F;  3NF2 A;  4LPG F;  3VJB A;  4LOB A;  5JV1 F;  4KVD A;  3LMD A;  5B02 A;  1YHK A;  3ACW A;  1WL0 A;  3ZL6 A;  3NPK A;  3KRF B;  4JYX A;  3M02 A;  4RXD A;  3LG5 A;  4LUU A;  3ICZ A;  2E4O A;  3DYH A;  3VJ8 A;  4XQR F;  2F8Z F;  4HD1 A;  4E9Z A;  1ZW5 A;  1YYU A;  1UBY A;  3IPI A;  2Z4W A;  3WCF A;  4DWG A;  3KRO A;  3M00 A;  4N9U A;  5HN7 A;  1UBX A;  3CP6 A;  3SDT A;  3UCA A;  1V4I A;  3KRP A;  5ER8 A;  4QPF A;  2PS8 A;  5B0L A;  2Z78 A;  3ID0 A;  2AEL A;  5ILD A;  2PS4 A;  3LLW A;  1N1Z A;  4PVX F;  1KIY A;  3WCD A;  2PS6 A;  4F62 A;  3ICK A;  3WEH A;  4PVY F;  3N0F A;  3WSB A;  5B0K A;  3P8R A;  4LA6 A;  3KRA B;  4GP1 A;  4WK5 A;  3M01 A;  3RYE A;  1HXA A;  5A0K A;  3ACX A;  3QKC A;  4N1Z F;  3WEJ A;  1WMW A;  5ILJ A;  5ERM A;  3ICM A;  3AQ0 A;  3EZ3 A;  4F6V A;  3AQB B;  4JXY A;  5DGS F;  1V4E A;  3WSA A;  3V1X A;  1HM7 A;  4GP2 A;  2QIS A;  1YV5 A;  4NFJ F;  3RBM A;  3OAC B;  1YQ7 A;  1YHM A;  5B03 A;  5I1U A;  3WJK A;  2E93 A;  3V1V A;  4XQT F;  1N20 A;  4EA0 A;  2F9K F;  5CG5 A;  2AEK A;  2PS5 A;  4LPH F;  4KVW A;  5IK0 A;  2FOR A;  4DWB A;  1N21 A;  2I19 A;  4JZB A;  3LOM A;  1V4H A;  3ADZ A;  3Q1O A;  3VJE A;  1DGP A;  3WEK A;  4MC8 A;  3OAB B;  5IVG A;  5E8H A;  5IL8 A;  4OKM A;  3G4F A;  3QQV A;  3G4D A;  2EWG A;  3P8L A;  5B0J A;  1N22 A;  4KPJ A;  2E90 A;  3KRF A;  5IMP A;  2OA6 A;  4LZC A;  3LGK A;  4K10 A;  4E1E A;  3EFQ A;  1HXC A;  5DJV F;  2J5C A;  5C05 A;  5CG6 A;  5IK6 A;  3V66 A;  5ERO A;  3PYA A;  1JFG A;  5B00 A;  3KRC B;  2F94 F;  3N1W F;  4LXW A;  4RXC A;  3N3L F;  4KPD A;  4KQ5 A;  3N3D A;  4KQU A;  5B0M A;  3Q30 A;  3SDQ A;  2RAH A;  2E92 A;  4LTV A;  5IL3 A;  2ZCO A;  3TS7 A;  3PH7 A;  4JXN A;  4NG6 A;  4DI5 A;  3WCH A;  4QXS F;  2AZL A;  3APZ A;  4RNQ A;  1HXG A;  5ILY A;  3P5R A;  3N6K F;  4DHD A;  2ONH A;  3ZOU A;  3SAE A;  3Q2Z A;  5B01 A;  3IBA A;  2J1P A;  3LGZ B;  1VG3 A;  3DYF A;  5IKH A;  3WJN A;  1WKZ A;  3KRA A;  4LZ0 A;  4KVY A;  5DW7 A;  4DXJ A;  4RXA A;  2OPN A;  3ZMC A;  4XQS F;  3LZ9 A;  1VG2 A;  3LK5 A;  1VG6 A;  4DZW A;  4KVI A;  3WEF A;  4UMJ A;  3VJD A;  3WEG A;  3VJ9 A;  5HN8 A;  4LTZ A;  3N5J F;  2F89 F;  3WCL A;  3RYW A;  4KWD A;  4LFG A;  2ZEU A;  3PDE A;  2Z7I A;  3NRI A;  3AQC B;  3BNY A;  5E8L A;  5IMN A;  3OAC A;  1N24 A;  4E9U A;  1RQI A;  2F92 F;  4GAX A;  4Q23 A;  3WCE A;  2F8C F;  3ZCD A;  5B0I A;  1FPS A;  2ZCR A;  3PYB A;  5DJR F;  3Q2Q A;  2AZK A;  3LEE A;  3B7L A;  5A0J A;  4NKE A;  1PS1 A;  1YYR A;  2J1O A;  5EAU A;  3ICN A;  2Z7H A;  2ZCQ A;  3MAV A;  5DHI A;  3WCI A;  3MZV A;  3P41 A;  3OAB A;  3BNX A;  5DIQ F;  4OMH A;  4LFE A;  3S4J A;  5ILI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...