4KKMA

Crystal structure of a fpp/gfpp synthase (target efi-501952) from zymomonas mobilis, apo structure
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
295
structure length
278
Chain Sequence
MAVNLKTMMEQVAQDIDRLFAEQLPVPEDPRRRLVEAMRYAAIGGGKRLRPLLVVATCALFNVDREAALRVGMAIECIHVYSLIHDDMPCMDNDDLRRGKPTVHKAFDDASAVLSGDALQALAFEILSEEKIHTDPHVRLELIQALAIASGKDGMVGGQAIDLAAETSTVPFDLPTITRLQQLKTGALFGFCLEAGAIMGRQNKDIRDRLKAYARDIGLAFQIADDLIDAGKATFLSLLGLEKARSQAQALVDQAIAHLSVFGSEADYLRSIARYIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprenyl synthetase
publication title Crystal structure of a FPP/GFPP synthase (Target EFI-501952) from Zymomonas mobilis, apo structure
rcsb
source organism Zymomonas mobilis subsp. mobilis
molecule tags Transferase
total genus 109
structure length 278
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4kkmA00
4UMJA 1V4IA 3UCAA 2OGDA 5JV1F 2Q58A 3WEGA 4LZ3A 3P8RA 4KPDA 5B03A 4JYXA 5DW7A 1JFGA 4DWGA 3DYFA 4FJQA 5JUZF 3TFNA 3P5PA 3Q30A 4LA5A 4LZ0A 1WL1A 5KSXF 1HXCA 2OA6A 4LLSA 5E8HA 5IN8A 4E1EA 3G4DA 4LUUA 3Q2QA 5A0JA 4KUXA 4PVYF 2EWGA 4P0VA 4FP4A 2RAHA 3NRIA 5AYPA 4KQUA 4XQSF 1WY0A 3IBAA 4LPHF 3ICZA 2Z4YA 5C05A 3VJCA 3KRPB 3SDVA 1KIYA 1WL2A 2F8ZF 3NPRA 4JVJF 1KIZA 2J5CA 3RYWA 2E94A 2E8XA 3KRCB 2Z7HA 3OACB 2Z4XA 3N45F 3P41A 3VJEA 3KB9A 3S4JA 3KRPA 4RNQA 5ILIA 2O1OA 1RQIA 5EAUA 2E90A 3WCGA 3CP6A 3APZA 4GA3A 2VF6A 5B0IA 2Q9ZA 4KQSA 5B0LA 3TC1A 3ACYA 3KRCA 2OPNA 3M9UA 1VG6A 2ZEUA 2F8CF 4NFKF 2Z4VA 3LG5A 3AQCB 3WCAA 2H8OA 3PYBA 5JA0F 4GAXA 2AZLA 2F9KF 1YYSA 3DYHA 4KVIA 5B02A 1N21A 4LTVA 4NKFA 3N5JF 3BNYA 3WCLA 3WJKA 2Z4WA 4RXDA 3SDTA 4KQ5A 3N1VF 4QPFA 4E9ZA 4DWBA 2Q80A 2ONGA 3VJ8A 5JV2F 5B0KA 2FTZA 4DZWA 2QISA 4LOBA 3V66A 1DI1A 3WCBA 4LFVF 3LSNA 2FORA 1WMWA 3N0FA 5ILYA 1HM7A 3WEIA 4H5EF 5DGMF 3N46F 5JV0F 3KROB 1DGPA 2DH4A 3LGKA 1ZW5A 3SDQA 5ILKA 4NG6A 3N49F 3PDEA 5DHIA 3N1WF 3SDUA 4N9UA 3ZCDA 3LZ9A 4MC0A 4LFGA 1YHMA 5DGNF 2AEKA 5H9DA 3ACXA 3KROA 4OKMA 3LMDA 1YYQA 2AZKA 2E91A 3PH7A 3Q1OA 3PKOA 3W7FA 3AQ0A 3SDRA 3AE0A 3WCJA 4QXSF 4RXAA 2Z78A 2E95A 4K10A 5ERNA 5B0MA 4ZQ8A 5IK6A 3QKCA 4H5CF 3P5RA 3WEKA 5AFXA 2PS4A 3OYRA 3LDWA 1V4EA 3P8LA 4DI5A 4F62A 3LEEA 4LPGF 1UBXA 4LA6A 2AZJA 3OABB 4OMGA 3VJ9A 1V4KA 1UBVA 1RTRA 3M01A 3LK5A 2Z52A 3KRAB 4KPJA 5HN9A 3ICKA 2E8TA 2ZCSA 3ACWA 3EGTA 2F94F 5EATA 3RMGA 1YJ4A 2E4OA 3VJBA 3Q2ZA 3M00A 3N5HF 4KVYA 1WL3A 3M0GA 1HXAA 3OABA 5IMPA 5B00A 3PYAA 3KRAA 4P0WA 4NKEA 5HN8A 2J1PA 2I19A 3ADZA 4NFJF 1VG2A 3WE9A 3CKEA 1UBWA 4H5DF 5ILJA 1N1BA 3RBMA 3KRFB 1PS1A 3N6KF 4LFEA 1V4HA 2ZCOA 1YQ7A 4DEMF 1VG3A 1FPSA 5HNAA 1WL0A 3IPIA 3KRFA 3VJDA 5B01A 2Z50A 4NUAA 5HN7A 3EFQA 4JZXA 5A0IA 5DGSF 1YHLA 4XQTF 5E8LA 4P0XA 3LLWA 5IKAA 3N3LF 3N0GA 3MZVA 2J1OA 5DIQF 5DJVF 2Q9YA 5E8KA 4DHDA 4KWDA 3S9VA 3G4FA 4F6VA 1N23A 5ILZA 5I1UA 5IVGA 3CC9A 3NF2A 3KBKA 2AETA 3ICNA 3WEJA 1VG7A 3WSAA 5IK9A 3WCFA 4GP2A 3V1VA 1JFAA 4OMHA 3B7LA 3RYEA 5IL8A 3WCIA 5DJPF 3LGZB 4RXEA 4JXYA 3WCMA 2E8WA 3TFPA 3WJOA 5ILDA 3WEFA 1RQJA 4KVDA 4MC3A 5IM1A 4LZCA 5DZ2A 4RXCA 1YV5A 3DYGA 3VJAA 3ZL6A 4NFIF 3WJNA 1V4JA 3WCEA 3EZ3A 4GP1A 4F6XA 3AQBB 1N22A 3WCHA 2E8VA 3SAEA 2Z4ZA 2Z7IA 5AELA 3ZMBA 4KKMA 3LJIA 1VG4A 5CG5A 5DJRF 1N24A 3V1XA 5IMNA 4KVWA 5ERMA 3MAVA 2AELA 5IL3A 5ER8A 1HXGA 4LIXA 4DXJA 2E92A 4Q23A 3WCCA 1N20A 4RYPA 1YYRA 4L2XF 5A0KA 1WKZA 2P1CA 4EA1A 2F92F 5IK0A 2PS5A 3M02A 3N3DA 3ZMCA 1YYUA 4WK5A 3NPKA 3ID0A 3TS7A 5EASA 4EA0A 3ICMA 3BNXA 3WEHA 2ONHA 2E8UA 3OACA 3WCDA 3WSBA 4JXNA 4OGUA 2ZCQA 3WC9A 3ZOUA 4OKZA 5IMIA 2PS6A 3QQVA 2E93A 2ZY1A 1HM4A 5IKHA 1HX9A 4XQRF 1N1ZA 5B0JA 4LTZA 4LXWA 4MC8A 2F7MF 4PVXF 1EZFA 4LLTA 1UBYA 4KK2A 4HD1A 5CG6A 4KFAA 4EA2A 4E9UA 2F89F 4JZBA 5ILHA 2OPMA 5AHUB 2PS8A 2PS7A 3LOMA 1YHKA 5EROA 1YYTA 3TFVA 5DHKA 4N1ZF 2ZCRA 3ASXA 2ZEVA 3LVSA
chains in the Genus database with same CATH superfamily
4UMJA 1V4IA 3UCAA 2OGDA 5JV1F 2Q58A 3WEGA 4LZ3A 3P8RA 4KPDA 5B03A 4JYXA 5DW7A 1JFGA 4DWGA 3DYFA 4FJQA 5JUZF 3TFNA 3P5PA 3Q30A 4LA5A 4LZ0A 1WL1A 5KSXF 1HXCA 2OA6A 4LLSA 5E8HA 5IN8A 4E1EA 3G4DA 4LUUA 3Q2QA 5A0JA 4KUXA 4PVYF 2EWGA 4P0VA 4FP4A 2RAHA 3NRIA 5AYPA 4KQUA 4XQSF 1WY0A 3IBAA 4LPHF 3ICZA 2Z4YA 5C05A 3VJCA 3KRPB 3SDVA 1KIYA 1WL2A 2F8ZF 3NPRA 4JVJF 1KIZA 2J5CA 3RYWA 2E94A 2E8XA 3KRCB 2Z7HA 3OACB 2Z4XA 3N45F 3P41A 3VJEA 3KB9A 3S4JA 3KRPA 4RNQA 5ILIA 2O1OA 1RQIA 5EAUA 2E90A 3WCGA 3CP6A 3APZA 4GA3A 2VF6A 5B0IA 2Q9ZA 4KQSA 5B0LA 3TC1A 3ACYA 3KRCA 2OPNA 3M9UA 1VG6A 2ZEUA 2F8CF 4NFKF 2Z4VA 3LG5A 3AQCB 3WCAA 2H8OA 3PYBA 5JA0F 4GAXA 2AZLA 2F9KF 1YYSA 3DYHA 4KVIA 5B02A 1N21A 4LTVA 4NKFA 3N5JF 3BNYA 3WCLA 3WJKA 2Z4WA 4RXDA 3SDTA 4KQ5A 3N1VF 4QPFA 4E9ZA 4DWBA 2Q80A 2ONGA 3VJ8A 5JV2F 5B0KA 2FTZA 4DZWA 2QISA 4LOBA 3V66A 1DI1A 3WCBA 4LFVF 3LSNA 2FORA 1WMWA 3N0FA 5ILYA 1HM7A 3WEIA 4H5EF 5DGMF 3N46F 5JV0F 3KROB 1DGPA 2DH4A 3LGKA 1ZW5A 3SDQA 5ILKA 4NG6A 3N49F 3PDEA 5DHIA 3N1WF 3SDUA 4N9UA 3ZCDA 3LZ9A 4MC0A 4LFGA 1YHMA 5DGNF 2AEKA 5H9DA 3ACXA 3KROA 4OKMA 3LMDA 1YYQA 2AZKA 2E91A 3PH7A 3Q1OA 3PKOA 3W7FA 3AQ0A 3SDRA 3AE0A 3WCJA 4QXSF 4RXAA 2Z78A 2E95A 4K10A 5ERNA 5B0MA 4ZQ8A 5IK6A 3QKCA 4H5CF 3P5RA 3WEKA 5AFXA 2PS4A 3OYRA 3LDWA 1V4EA 3P8LA 4DI5A 4F62A 3LEEA 4LPGF 1UBXA 4LA6A 2AZJA 3OABB 4OMGA 3VJ9A 1V4KA 1UBVA 1RTRA 3M01A 3LK5A 2Z52A 3KRAB 4KPJA 5HN9A 3ICKA 2E8TA 2ZCSA 3ACWA 3EGTA 2F94F 5EATA 3RMGA 1YJ4A 2E4OA 3VJBA 3Q2ZA 3M00A 3N5HF 4KVYA 1WL3A 3M0GA 1HXAA 3OABA 5IMPA 5B00A 3PYAA 3KRAA 4P0WA 4NKEA 5HN8A 2J1PA 2I19A 3ADZA 4NFJF 1VG2A 3WE9A 3CKEA 1UBWA 4H5DF 5ILJA 1N1BA 3RBMA 3KRFB 1PS1A 3N6KF 4LFEA 1V4HA 2ZCOA 1YQ7A 4DEMF 1VG3A 1FPSA 5HNAA 1WL0A 3IPIA 3KRFA 3VJDA 5B01A 2Z50A 4NUAA 5HN7A 3EFQA 4JZXA 5A0IA 5DGSF 1YHLA 4XQTF 5E8LA 4P0XA 3LLWA 5IKAA 3N3LF 3N0GA 3MZVA 2J1OA 5DIQF 5DJVF 2Q9YA 5E8KA 4DHDA 4KWDA 3S9VA 3G4FA 4F6VA 1N23A 5ILZA 5I1UA 5IVGA 3CC9A 3NF2A 3KBKA 2AETA 3ICNA 3WEJA 1VG7A 3WSAA 5IK9A 3WCFA 4GP2A 3V1VA 1JFAA 4OMHA 3B7LA 3RYEA 5IL8A 3WCIA 5DJPF 3LGZB 4RXEA 4JXYA 3WCMA 2E8WA 3TFPA 3WJOA 5ILDA 3WEFA 1RQJA 4KVDA 4MC3A 5IM1A 4LZCA 5DZ2A 4RXCA 1YV5A 3DYGA 3VJAA 3ZL6A 4NFIF 3WJNA 1V4JA 3WCEA 3EZ3A 4GP1A 4F6XA 3AQBB 1N22A 3WCHA 2E8VA 3SAEA 2Z4ZA 2Z7IA 5AELA 3ZMBA 4KKMA 3LJIA 1VG4A 5CG5A 5DJRF 1N24A 3V1XA 5IMNA 4KVWA 5ERMA 3MAVA 2AELA 5IL3A 5ER8A 1HXGA 4LIXA 4DXJA 2E92A 4Q23A 3WCCA 1N20A 4RYPA 1YYRA 4L2XF 5A0KA 1WKZA 2P1CA 4EA1A 2F92F 5IK0A 2PS5A 3M02A 3N3DA 3ZMCA 1YYUA 4WK5A 3NPKA 3ID0A 3TS7A 5EASA 4EA0A 3ICMA 3BNXA 3WEHA 2ONHA 2E8UA 3OACA 3WCDA 3WSBA 4JXNA 4OGUA 2ZCQA 3WC9A 3ZOUA 4OKZA 5IMIA 2PS6A 3QQVA 2E93A 2ZY1A 1HM4A 5IKHA 1HX9A 4XQRF 1N1ZA 5B0JA 4LTZA 4LXWA 4MC8A 2F7MF 4PVXF 1EZFA 4LLTA 1UBYA 4KK2A 4HD1A 5CG6A 4KFAA 4EA2A 4E9UA 2F89F 4JZBA 5ILHA 2OPMA 5AHUB 2PS8A 2PS7A 3LOMA 1YHKA 5EROA 1YYTA 3TFVA 5DHKA 4N1ZF 2ZCRA 3ASXA 2ZEVA 3LVSA
chains in the Genus database with same CATH topology
4UMJA 1V4IA 3UCAA 2OGDA 5JV1F 2Q58A 3WEGA 4LZ3A 3P8RA 4KPDA 5B03A 4JYXA 5DW7A 1JFGA 4DWGA 3DYFA 4FJQA 5JUZF 3TFNA 3P5PA 3Q30A 4LA5A 4LZ0A 1WL1A 5KSXF 1HXCA 2OA6A 4LLSA 5E8HA 5IN8A 4E1EA 3G4DA 4LUUA 3Q2QA 5A0JA 4KUXA 4PVYF 2EWGA 4P0VA 4FP4A 2RAHA 3NRIA 5AYPA 4KQUA 4XQSF 1WY0A 3IBAA 4LPHF 3ICZA 2Z4YA 5C05A 3VJCA 3KRPB 3SDVA 1KIYA 1WL2A 2F8ZF 3NPRA 4JVJF 1KIZA 2J5CA 3RYWA 2E94A 2E8XA 3KRCB 2Z7HA 3OACB 2Z4XA 3N45F 3P41A 3VJEA 3KB9A 3S4JA 3KRPA 4RNQA 5ILIA 2O1OA 1RQIA 5EAUA 2E90A 3WCGA 3CP6A 3APZA 4GA3A 2VF6A 5B0IA 2Q9ZA 4KQSA 5B0LA 3TC1A 3ACYA 3KRCA 2OPNA 3M9UA 1VG6A 2ZEUA 2F8CF 4NFKF 2Z4VA 3LG5A 3AQCB 3WCAA 2H8OA 3PYBA 5JA0F 4GAXA 2AZLA 2F9KF 1YYSA 3DYHA 4KVIA 5B02A 1N21A 4LTVA 4NKFA 3N5JF 3BNYA 3WCLA 3WJKA 2Z4WA 4RXDA 3SDTA 4KQ5A 3N1VF 4QPFA 4E9ZA 4DWBA 2Q80A 2ONGA 3VJ8A 5JV2F 5B0KA 2FTZA 4DZWA 2QISA 4LOBA 3V66A 1DI1A 3WCBA 4LFVF 3LSNA 2FORA 1WMWA 3N0FA 5ILYA 1HM7A 3WEIA 4H5EF 5DGMF 3N46F 5JV0F 3KROB 1DGPA 2DH4A 3LGKA 1ZW5A 3SDQA 5ILKA 4NG6A 3N49F 3PDEA 5DHIA 3N1WF 3SDUA 4N9UA 3ZCDA 3LZ9A 4MC0A 4LFGA 1YHMA 5DGNF 2AEKA 5H9DA 3ACXA 3KROA 4OKMA 3LMDA 1YYQA 2AZKA 2E91A 3PH7A 3Q1OA 3PKOA 3W7FA 3AQ0A 3SDRA 3AE0A 3WCJA 4QXSF 4RXAA 2Z78A 2E95A 4K10A 5ERNA 5B0MA 4ZQ8A 5IK6A 3QKCA 4H5CF 3P5RA 3WEKA 5AFXA 2PS4A 3OYRA 3LDWA 1V4EA 3P8LA 4DI5A 4F62A 3LEEA 4LPGF 1UBXA 4LA6A 2AZJA 3OABB 4OMGA 3VJ9A 1V4KA 1UBVA 1RTRA 3M01A 3LK5A 2Z52A 3KRAB 4KPJA 5HN9A 3ICKA 2E8TA 2ZCSA 3ACWA 3EGTA 2F94F 5EATA 3RMGA 1YJ4A 2E4OA 3VJBA 3Q2ZA 3M00A 3N5HF 4KVYA 1WL3A 3M0GA 1HXAA 3OABA 5IMPA 5B00A 3PYAA 3KRAA 4P0WA 4NKEA 5HN8A 2J1PA 2I19A 3ADZA 4NFJF 1VG2A 3WE9A 3CKEA 1UBWA 4H5DF 5ILJA 1N1BA 3RBMA 3KRFB 1PS1A 3N6KF 4LFEA 1V4HA 2ZCOA 1YQ7A 4DEMF 1VG3A 1FPSA 5HNAA 1WL0A 3IPIA 3KRFA 3VJDA 5B01A 2Z50A 4NUAA 5HN7A 3EFQA 4JZXA 5A0IA 5DGSF 1YHLA 4XQTF 5E8LA 4P0XA 3LLWA 5IKAA 3N3LF 3N0GA 3MZVA 2J1OA 5DIQF 5DJVF 2Q9YA 5E8KA 4DHDA 4KWDA 3S9VA 3G4FA 4F6VA 1N23A 5ILZA 5I1UA 5IVGA 3CC9A 3NF2A 3KBKA 2AETA 3ICNA 3WEJA 1VG7A 3WSAA 5IK9A 3WCFA 4GP2A 3V1VA 1JFAA 4OMHA 3B7LA 3RYEA 5IL8A 3WCIA 5DJPF 3LGZB 4RXEA 4JXYA 3WCMA 2E8WA 3TFPA 3WJOA 5ILDA 3WEFA 1RQJA 4KVDA 4MC3A 5IM1A 4LZCA 5DZ2A 4RXCA 1YV5A 3DYGA 3VJAA 3ZL6A 4NFIF 3WJNA 1V4JA 3WCEA 3EZ3A 4GP1A 4F6XA 3AQBB 1N22A 3WCHA 2E8VA 3SAEA 2Z4ZA 2Z7IA 5AELA 3ZMBA 4KKMA 3LJIA 1VG4A 5CG5A 5DJRF 1N24A 3V1XA 5IMNA 4KVWA 5ERMA 3MAVA 2AELA 5IL3A 5ER8A 1HXGA 4LIXA 4DXJA 2E92A 4Q23A 3WCCA 1N20A 4RYPA 1YYRA 4L2XF 5A0KA 1WKZA 2P1CA 4EA1A 2F92F 5IK0A 2PS5A 3M02A 3N3DA 3ZMCA 1YYUA 4WK5A 3NPKA 3ID0A 3TS7A 5EASA 4EA0A 3ICMA 3BNXA 3WEHA 2ONHA 2E8UA 3OACA 3WCDA 3WSBA 4JXNA 4OGUA 2ZCQA 3WC9A 3ZOUA 4OKZA 5IMIA 2PS6A 3QQVA 2E93A 2ZY1A 1HM4A 5IKHA 1HX9A 4XQRF 1N1ZA 5B0JA 4LTZA 4LXWA 4MC8A 2F7MF 4PVXF 1EZFA 4LLTA 1UBYA 4KK2A 4HD1A 5CG6A 4KFAA 4EA2A 4E9UA 2F89F 4JZBA 5ILHA 2OPMA 5AHUB 2PS8A 2PS7A 3LOMA 1YHKA 5EROA 1YYTA 3TFVA 5DHKA 4N1ZF 2ZCRA 3ASXA 2ZEVA 3LVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UMJ A;  1V4I A;  3UCA A;  2OGD A;  5JV1 F;  2Q58 A;  3WEG A;  4LZ3 A;  3P8R A;  4KPD A;  5B03 A;  4JYX A;  5DW7 A;  1JFG A;  4DWG A;  3DYF A;  4FJQ A;  5JUZ F;  3TFN A;  3P5P A;  3Q30 A;  4LA5 A;  4LZ0 A;  1WL1 A;  5KSX F;  1HXC A;  2OA6 A;  4LLS A;  5E8H A;  5IN8 A;  4E1E A;  3G4D A;  4LUU A;  3Q2Q A;  5A0J A;  4KUX A;  4PVY F;  2EWG A;  4P0V A;  4FP4 A;  2RAH A;  3NRI A;  5AYP A;  4KQU A;  4XQS F;  1WY0 A;  3IBA A;  4LPH F;  3ICZ A;  2Z4Y A;  5C05 A;  3VJC A;  3KRP B;  3SDV A;  1KIY A;  1WL2 A;  2F8Z F;  3NPR A;  4JVJ F;  1KIZ A;  2J5C A;  3RYW A;  2E94 A;  2E8X A;  3KRC B;  2Z7H A;  3OAC B;  2Z4X A;  3N45 F;  3P41 A;  3VJE A;  3KB9 A;  3S4J A;  3KRP A;  4RNQ A;  5ILI A;  2O1O A;  1RQI A;  5EAU A;  2E90 A;  3WCG A;  3CP6 A;  3APZ A;  4GA3 A;  2VF6 A;  5B0I A;  2Q9Z A;  4KQS A;  5B0L A;  3TC1 A;  3ACY A;  3KRC A;  2OPN A;  3M9U A;  1VG6 A;  2ZEU A;  2F8C F;  4NFK F;  2Z4V A;  3LG5 A;  3AQC B;  3WCA A;  2H8O A;  3PYB A;  5JA0 F;  4GAX A;  2AZL A;  2F9K F;  1YYS A;  3DYH A;  4KVI A;  5B02 A;  1N21 A;  4LTV A;  4NKF A;  3N5J F;  3BNY A;  3WCL A;  3WJK A;  2Z4W A;  4RXD A;  3SDT A;  4KQ5 A;  3N1V F;  4QPF A;  4E9Z A;  4DWB A;  2Q80 A;  2ONG A;  3VJ8 A;  5JV2 F;  5B0K A;  2FTZ A;  4DZW A;  2QIS A;  4LOB A;  3V66 A;  1DI1 A;  3WCB A;  4LFV F;  3LSN A;  2FOR A;  1WMW A;  3N0F A;  5ILY A;  1HM7 A;  3WEI A;  4H5E F;  5DGM F;  3N46 F;  5JV0 F;  3KRO B;  1DGP A;  2DH4 A;  3LGK A;  1ZW5 A;  3SDQ A;  5ILK A;  4NG6 A;  3N49 F;  3PDE A;  5DHI A;  3N1W F;  3SDU A;  4N9U A;  3ZCD A;  3LZ9 A;  4MC0 A;  4LFG A;  1YHM A;  5DGN F;  2AEK A;  5H9D A;  3ACX A;  3KRO A;  4OKM A;  3LMD A;  1YYQ A;  2AZK A;  2E91 A;  3PH7 A;  3Q1O A;  3PKO A;  3W7F A;  3AQ0 A;  3SDR A;  3AE0 A;  3WCJ A;  4QXS F;  4RXA A;  2Z78 A;  2E95 A;  4K10 A;  5ERN A;  5B0M A;  4ZQ8 A;  5IK6 A;  3QKC A;  4H5C F;  3P5R A;  3WEK A;  5AFX A;  2PS4 A;  3OYR A;  3LDW A;  1V4E A;  3P8L A;  4DI5 A;  4F62 A;  3LEE A;  4LPG F;  1UBX A;  4LA6 A;  2AZJ A;  3OAB B;  4OMG A;  3VJ9 A;  1V4K A;  1UBV A;  1RTR A;  3M01 A;  3LK5 A;  2Z52 A;  3KRA B;  4KPJ A;  5HN9 A;  3ICK A;  2E8T A;  2ZCS A;  3ACW A;  3EGT A;  2F94 F;  5EAT A;  3RMG A;  1YJ4 A;  2E4O A;  3VJB A;  3Q2Z A;  3M00 A;  3N5H F;  4KVY A;  1WL3 A;  3M0G A;  1HXA A;  3OAB A;  5IMP A;  5B00 A;  3PYA A;  3KRA A;  4P0W A;  4NKE A;  5HN8 A;  2J1P A;  2I19 A;  3ADZ A;  4NFJ F;  1VG2 A;  3WE9 A;  3CKE A;  1UBW A;  4H5D F;  5ILJ A;  1N1B A;  3RBM A;  3KRF B;  1PS1 A;  3N6K F;  4LFE A;  1V4H A;  2ZCO A;  1YQ7 A;  4DEM F;  1VG3 A;  1FPS A;  5HNA A;  1WL0 A;  3IPI A;  3KRF A;  3VJD A;  5B01 A;  2Z50 A;  4NUA A;  5HN7 A;  3EFQ A;  4JZX A;  5A0I A;  5DGS F;  1YHL A;  4XQT F;  5E8L A;  4P0X A;  3LLW A;  5IKA A;  3N3L F;  3N0G A;  3MZV A;  2J1O A;  5DIQ F;  5DJV F;  2Q9Y A;  5E8K A;  4DHD A;  4KWD A;  3S9V A;  3G4F A;  4F6V A;  1N23 A;  5ILZ A;  5I1U A;  5IVG A;  3CC9 A;  3NF2 A;  3KBK A;  2AET A;  3ICN A;  3WEJ A;  1VG7 A;  3WSA A;  5IK9 A;  3WCF A;  4GP2 A;  3V1V A;  1JFA A;  4OMH A;  3B7L A;  3RYE A;  5IL8 A;  3WCI A;  5DJP F;  3LGZ B;  4RXE A;  4JXY A;  3WCM A;  2E8W A;  3TFP A;  3WJO A;  5ILD A;  3WEF A;  1RQJ A;  4KVD A;  4MC3 A;  5IM1 A;  4LZC A;  5DZ2 A;  4RXC A;  1YV5 A;  3DYG A;  3VJA A;  3ZL6 A;  4NFI F;  3WJN A;  1V4J A;  3WCE A;  3EZ3 A;  4GP1 A;  4F6X A;  3AQB B;  1N22 A;  3WCH A;  2E8V A;  3SAE A;  2Z4Z A;  2Z7I A;  5AEL A;  3ZMB A;  4KKM A;  3LJI A;  1VG4 A;  5CG5 A;  5DJR F;  1N24 A;  3V1X A;  5IMN A;  4KVW A;  5ERM A;  3MAV A;  2AEL A;  5IL3 A;  5ER8 A;  1HXG A;  4LIX A;  4DXJ A;  2E92 A;  4Q23 A;  3WCC A;  1N20 A;  4RYP A;  1YYR A;  4L2X F;  5A0K A;  1WKZ A;  2P1C A;  4EA1 A;  2F92 F;  5IK0 A;  2PS5 A;  3M02 A;  3N3D A;  3ZMC A;  1YYU A;  4WK5 A;  3NPK A;  3ID0 A;  3TS7 A;  5EAS A;  4EA0 A;  3ICM A;  3BNX A;  3WEH A;  2ONH A;  2E8U A;  3OAC A;  3WCD A;  3WSB A;  4JXN A;  4OGU A;  2ZCQ A;  3WC9 A;  3ZOU A;  4OKZ A;  5IMI A;  2PS6 A;  3QQV A;  2E93 A;  2ZY1 A;  1HM4 A;  5IKH A;  1HX9 A;  4XQR F;  1N1Z A;  5B0J A;  4LTZ A;  4LXW A;  4MC8 A;  2F7M F;  4PVX F;  1EZF A;  4LLT A;  1UBY A;  4KK2 A;  4HD1 A;  5CG6 A;  4KFA A;  4EA2 A;  4E9U A;  2F89 F;  4JZB A;  5ILH A;  2OPM A;  5AHU B;  2PS8 A;  2PS7 A;  3LOM A;  1YHK A;  5ERO A;  1YYT A;  3TFV A;  5DHK A;  4N1Z F;  2ZCR A;  3ASX A;  2ZEV A;  3LVS A; 
#chains in the Genus database with same CATH topology
 4UMJ A;  1V4I A;  3UCA A;  2OGD A;  5JV1 F;  2Q58 A;  3WEG A;  4LZ3 A;  3P8R A;  4KPD A;  5B03 A;  4JYX A;  5DW7 A;  1JFG A;  4DWG A;  3DYF A;  4FJQ A;  5JUZ F;  3TFN A;  3P5P A;  3Q30 A;  4LA5 A;  4LZ0 A;  1WL1 A;  5KSX F;  1HXC A;  2OA6 A;  4LLS A;  5E8H A;  5IN8 A;  4E1E A;  3G4D A;  4LUU A;  3Q2Q A;  5A0J A;  4KUX A;  4PVY F;  2EWG A;  4P0V A;  4FP4 A;  2RAH A;  3NRI A;  5AYP A;  4KQU A;  4XQS F;  1WY0 A;  3IBA A;  4LPH F;  3ICZ A;  2Z4Y A;  5C05 A;  3VJC A;  3KRP B;  3SDV A;  1KIY A;  1WL2 A;  2F8Z F;  3NPR A;  4JVJ F;  1KIZ A;  2J5C A;  3RYW A;  2E94 A;  2E8X A;  3KRC B;  2Z7H A;  3OAC B;  2Z4X A;  3N45 F;  3P41 A;  3VJE A;  3KB9 A;  3S4J A;  3KRP A;  4RNQ A;  5ILI A;  2O1O A;  1RQI A;  5EAU A;  2E90 A;  3WCG A;  3CP6 A;  3APZ A;  4GA3 A;  2VF6 A;  5B0I A;  2Q9Z A;  4KQS A;  5B0L A;  3TC1 A;  3ACY A;  3KRC A;  2OPN A;  3M9U A;  1VG6 A;  2ZEU A;  2F8C F;  4NFK F;  2Z4V A;  3LG5 A;  3AQC B;  3WCA A;  2H8O A;  3PYB A;  5JA0 F;  4GAX A;  2AZL A;  2F9K F;  1YYS A;  3DYH A;  4KVI A;  5B02 A;  1N21 A;  4LTV A;  4NKF A;  3N5J F;  3BNY A;  3WCL A;  3WJK A;  2Z4W A;  4RXD A;  3SDT A;  4KQ5 A;  3N1V F;  4QPF A;  4E9Z A;  4DWB A;  2Q80 A;  2ONG A;  3VJ8 A;  5JV2 F;  5B0K A;  2FTZ A;  4DZW A;  2QIS A;  4LOB A;  3V66 A;  1DI1 A;  3WCB A;  4LFV F;  3LSN A;  2FOR A;  1WMW A;  3N0F A;  5ILY A;  1HM7 A;  3WEI A;  4H5E F;  5DGM F;  3N46 F;  5JV0 F;  3KRO B;  1DGP A;  2DH4 A;  3LGK A;  1ZW5 A;  3SDQ A;  5ILK A;  4NG6 A;  3N49 F;  3PDE A;  5DHI A;  3N1W F;  3SDU A;  4N9U A;  3ZCD A;  3LZ9 A;  4MC0 A;  4LFG A;  1YHM A;  5DGN F;  2AEK A;  5H9D A;  3ACX A;  3KRO A;  4OKM A;  3LMD A;  1YYQ A;  2AZK A;  2E91 A;  3PH7 A;  3Q1O A;  3PKO A;  3W7F A;  3AQ0 A;  3SDR A;  3AE0 A;  3WCJ A;  4QXS F;  4RXA A;  2Z78 A;  2E95 A;  4K10 A;  5ERN A;  5B0M A;  4ZQ8 A;  5IK6 A;  3QKC A;  4H5C F;  3P5R A;  3WEK A;  5AFX A;  2PS4 A;  3OYR A;  3LDW A;  1V4E A;  3P8L A;  4DI5 A;  4F62 A;  3LEE A;  4LPG F;  1UBX A;  4LA6 A;  2AZJ A;  3OAB B;  4OMG A;  3VJ9 A;  1V4K A;  1UBV A;  1RTR A;  3M01 A;  3LK5 A;  2Z52 A;  3KRA B;  4KPJ A;  5HN9 A;  3ICK A;  2E8T A;  2ZCS A;  3ACW A;  3EGT A;  2F94 F;  5EAT A;  3RMG A;  1YJ4 A;  2E4O A;  3VJB A;  3Q2Z A;  3M00 A;  3N5H F;  4KVY A;  1WL3 A;  3M0G A;  1HXA A;  3OAB A;  5IMP A;  5B00 A;  3PYA A;  3KRA A;  4P0W A;  4NKE A;  5HN8 A;  2J1P A;  2I19 A;  3ADZ A;  4NFJ F;  1VG2 A;  3WE9 A;  3CKE A;  1UBW A;  4H5D F;  5ILJ A;  1N1B A;  3RBM A;  3KRF B;  1PS1 A;  3N6K F;  4LFE A;  1V4H A;  2ZCO A;  1YQ7 A;  4DEM F;  1VG3 A;  1FPS A;  5HNA A;  1WL0 A;  3IPI A;  3KRF A;  3VJD A;  5B01 A;  2Z50 A;  4NUA A;  5HN7 A;  3EFQ A;  4JZX A;  5A0I A;  5DGS F;  1YHL A;  4XQT F;  5E8L A;  4P0X A;  3LLW A;  5IKA A;  3N3L F;  3N0G A;  3MZV A;  2J1O A;  5DIQ F;  5DJV F;  2Q9Y A;  5E8K A;  4DHD A;  4KWD A;  3S9V A;  3G4F A;  4F6V A;  1N23 A;  5ILZ A;  5I1U A;  5IVG A;  3CC9 A;  3NF2 A;  3KBK A;  2AET A;  3ICN A;  3WEJ A;  1VG7 A;  3WSA A;  5IK9 A;  3WCF A;  4GP2 A;  3V1V A;  1JFA A;  4OMH A;  3B7L A;  3RYE A;  5IL8 A;  3WCI A;  5DJP F;  3LGZ B;  4RXE A;  4JXY A;  3WCM A;  2E8W A;  3TFP A;  3WJO A;  5ILD A;  3WEF A;  1RQJ A;  4KVD A;  4MC3 A;  5IM1 A;  4LZC A;  5DZ2 A;  4RXC A;  1YV5 A;  3DYG A;  3VJA A;  3ZL6 A;  4NFI F;  3WJN A;  1V4J A;  3WCE A;  3EZ3 A;  4GP1 A;  4F6X A;  3AQB B;  1N22 A;  3WCH A;  2E8V A;  3SAE A;  2Z4Z A;  2Z7I A;  5AEL A;  3ZMB A;  4KKM A;  3LJI A;  1VG4 A;  5CG5 A;  5DJR F;  1N24 A;  3V1X A;  5IMN A;  4KVW A;  5ERM A;  3MAV A;  2AEL A;  5IL3 A;  5ER8 A;  1HXG A;  4LIX A;  4DXJ A;  2E92 A;  4Q23 A;  3WCC A;  1N20 A;  4RYP A;  1YYR A;  4L2X F;  5A0K A;  1WKZ A;  2P1C A;  4EA1 A;  2F92 F;  5IK0 A;  2PS5 A;  3M02 A;  3N3D A;  3ZMC A;  1YYU A;  4WK5 A;  3NPK A;  3ID0 A;  3TS7 A;  5EAS A;  4EA0 A;  3ICM A;  3BNX A;  3WEH A;  2ONH A;  2E8U A;  3OAC A;  3WCD A;  3WSB A;  4JXN A;  4OGU A;  2ZCQ A;  3WC9 A;  3ZOU A;  4OKZ A;  5IMI A;  2PS6 A;  3QQV A;  2E93 A;  2ZY1 A;  1HM4 A;  5IKH A;  1HX9 A;  4XQR F;  1N1Z A;  5B0J A;  4LTZ A;  4LXW A;  4MC8 A;  2F7M F;  4PVX F;  1EZF A;  4LLT A;  1UBY A;  4KK2 A;  4HD1 A;  5CG6 A;  4KFA A;  4EA2 A;  4E9U A;  2F89 F;  4JZB A;  5ILH A;  2OPM A;  5AHU B;  2PS8 A;  2PS7 A;  3LOM A;  1YHK A;  5ERO A;  1YYT A;  3TFV A;  5DHK A;  4N1Z F;  2ZCR A;  3ASX A;  2ZEV A;  3LVS A; 
#chains in the Genus database with same CATH homology
 4UMJ A;  1V4I A;  3UCA A;  2OGD A;  5JV1 F;  2Q58 A;  3WEG A;  4LZ3 A;  3P8R A;  4KPD A;  5B03 A;  4JYX A;  5DW7 A;  1JFG A;  4DWG A;  3DYF A;  4FJQ A;  5JUZ F;  3TFN A;  3P5P A;  3Q30 A;  4LA5 A;  4LZ0 A;  1WL1 A;  5KSX F;  1HXC A;  2OA6 A;  4LLS A;  5E8H A;  5IN8 A;  4E1E A;  3G4D A;  4LUU A;  3Q2Q A;  5A0J A;  4KUX A;  4PVY F;  2EWG A;  4P0V A;  4FP4 A;  2RAH A;  3NRI A;  5AYP A;  4KQU A;  4XQS F;  1WY0 A;  3IBA A;  4LPH F;  3ICZ A;  2Z4Y A;  5C05 A;  3VJC A;  3KRP B;  3SDV A;  1KIY A;  1WL2 A;  2F8Z F;  3NPR A;  4JVJ F;  1KIZ A;  2J5C A;  3RYW A;  2E94 A;  2E8X A;  3KRC B;  2Z7H A;  3OAC B;  2Z4X A;  3N45 F;  3P41 A;  3VJE A;  3KB9 A;  3S4J A;  3KRP A;  4RNQ A;  5ILI A;  2O1O A;  1RQI A;  5EAU A;  2E90 A;  3WCG A;  3CP6 A;  3APZ A;  4GA3 A;  2VF6 A;  5B0I A;  2Q9Z A;  4KQS A;  5B0L A;  3TC1 A;  3ACY A;  3KRC A;  2OPN A;  3M9U A;  1VG6 A;  2ZEU A;  2F8C F;  4NFK F;  2Z4V A;  3LG5 A;  3AQC B;  3WCA A;  2H8O A;  3PYB A;  5JA0 F;  4GAX A;  2AZL A;  2F9K F;  1YYS A;  3DYH A;  4KVI A;  5B02 A;  1N21 A;  4LTV A;  4NKF A;  3N5J F;  3BNY A;  3WCL A;  3WJK A;  2Z4W A;  4RXD A;  3SDT A;  4KQ5 A;  3N1V F;  4QPF A;  4E9Z A;  4DWB A;  2Q80 A;  2ONG A;  3VJ8 A;  5JV2 F;  5B0K A;  2FTZ A;  4DZW A;  2QIS A;  4LOB A;  3V66 A;  1DI1 A;  3WCB A;  4LFV F;  3LSN A;  2FOR A;  1WMW A;  3N0F A;  5ILY A;  1HM7 A;  3WEI A;  4H5E F;  5DGM F;  3N46 F;  5JV0 F;  3KRO B;  1DGP A;  2DH4 A;  3LGK A;  1ZW5 A;  3SDQ A;  5ILK A;  4NG6 A;  3N49 F;  3PDE A;  5DHI A;  3N1W F;  3SDU A;  4N9U A;  3ZCD A;  3LZ9 A;  4MC0 A;  4LFG A;  1YHM A;  5DGN F;  2AEK A;  5H9D A;  3ACX A;  3KRO A;  4OKM A;  3LMD A;  1YYQ A;  2AZK A;  2E91 A;  3PH7 A;  3Q1O A;  3PKO A;  3W7F A;  3AQ0 A;  3SDR A;  3AE0 A;  3WCJ A;  4QXS F;  4RXA A;  2Z78 A;  2E95 A;  4K10 A;  5ERN A;  5B0M A;  4ZQ8 A;  5IK6 A;  3QKC A;  4H5C F;  3P5R A;  3WEK A;  5AFX A;  2PS4 A;  3OYR A;  3LDW A;  1V4E A;  3P8L A;  4DI5 A;  4F62 A;  3LEE A;  4LPG F;  1UBX A;  4LA6 A;  2AZJ A;  3OAB B;  4OMG A;  3VJ9 A;  1V4K A;  1UBV A;  1RTR A;  3M01 A;  3LK5 A;  2Z52 A;  3KRA B;  4KPJ A;  5HN9 A;  3ICK A;  2E8T A;  2ZCS A;  3ACW A;  3EGT A;  2F94 F;  5EAT A;  3RMG A;  1YJ4 A;  2E4O A;  3VJB A;  3Q2Z A;  3M00 A;  3N5H F;  4KVY A;  1WL3 A;  3M0G A;  1HXA A;  3OAB A;  5IMP A;  5B00 A;  3PYA A;  3KRA A;  4P0W A;  4NKE A;  5HN8 A;  2J1P A;  2I19 A;  3ADZ A;  4NFJ F;  1VG2 A;  3WE9 A;  3CKE A;  1UBW A;  4H5D F;  5ILJ A;  1N1B A;  3RBM A;  3KRF B;  1PS1 A;  3N6K F;  4LFE A;  1V4H A;  2ZCO A;  1YQ7 A;  4DEM F;  1VG3 A;  1FPS A;  5HNA A;  1WL0 A;  3IPI A;  3KRF A;  3VJD A;  5B01 A;  2Z50 A;  4NUA A;  5HN7 A;  3EFQ A;  4JZX A;  5A0I A;  5DGS F;  1YHL A;  4XQT F;  5E8L A;  4P0X A;  3LLW A;  5IKA A;  3N3L F;  3N0G A;  3MZV A;  2J1O A;  5DIQ F;  5DJV F;  2Q9Y A;  5E8K A;  4DHD A;  4KWD A;  3S9V A;  3G4F A;  4F6V A;  1N23 A;  5ILZ A;  5I1U A;  5IVG A;  3CC9 A;  3NF2 A;  3KBK A;  2AET A;  3ICN A;  3WEJ A;  1VG7 A;  3WSA A;  5IK9 A;  3WCF A;  4GP2 A;  3V1V A;  1JFA A;  4OMH A;  3B7L A;  3RYE A;  5IL8 A;  3WCI A;  5DJP F;  3LGZ B;  4RXE A;  4JXY A;  3WCM A;  2E8W A;  3TFP A;  3WJO A;  5ILD A;  3WEF A;  1RQJ A;  4KVD A;  4MC3 A;  5IM1 A;  4LZC A;  5DZ2 A;  4RXC A;  1YV5 A;  3DYG A;  3VJA A;  3ZL6 A;  4NFI F;  3WJN A;  1V4J A;  3WCE A;  3EZ3 A;  4GP1 A;  4F6X A;  3AQB B;  1N22 A;  3WCH A;  2E8V A;  3SAE A;  2Z4Z A;  2Z7I A;  5AEL A;  3ZMB A;  4KKM A;  3LJI A;  1VG4 A;  5CG5 A;  5DJR F;  1N24 A;  3V1X A;  5IMN A;  4KVW A;  5ERM A;  3MAV A;  2AEL A;  5IL3 A;  5ER8 A;  1HXG A;  4LIX A;  4DXJ A;  2E92 A;  4Q23 A;  3WCC A;  1N20 A;  4RYP A;  1YYR A;  4L2X F;  5A0K A;  1WKZ A;  2P1C A;  4EA1 A;  2F92 F;  5IK0 A;  2PS5 A;  3M02 A;  3N3D A;  3ZMC A;  1YYU A;  4WK5 A;  3NPK A;  3ID0 A;  3TS7 A;  5EAS A;  4EA0 A;  3ICM A;  3BNX A;  3WEH A;  2ONH A;  2E8U A;  3OAC A;  3WCD A;  3WSB A;  4JXN A;  4OGU A;  2ZCQ A;  3WC9 A;  3ZOU A;  4OKZ A;  5IMI A;  2PS6 A;  3QQV A;  2E93 A;  2ZY1 A;  1HM4 A;  5IKH A;  1HX9 A;  4XQR F;  1N1Z A;  5B0J A;  4LTZ A;  4LXW A;  4MC8 A;  2F7M F;  4PVX F;  1EZF A;  4LLT A;  1UBY A;  4KK2 A;  4HD1 A;  5CG6 A;  4KFA A;  4EA2 A;  4E9U A;  2F89 F;  4JZB A;  5ILH A;  2OPM A;  5AHU B;  2PS8 A;  2PS7 A;  3LOM A;  1YHK A;  5ERO A;  1YYT A;  3TFV A;  5DHK A;  4N1Z F;  2ZCR A;  3ASX A;  2ZEV A;  3LVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...