4KKMA

Crystal structure of a fpp/gfpp synthase (target efi-501952) from zymomonas mobilis, apo structure
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
295
structure length
278
Chain Sequence
MAVNLKTMMEQVAQDIDRLFAEQLPVPEDPRRRLVEAMRYAAIGGGKRLRPLLVVATCALFNVDREAALRVGMAIECIHVYSLIHDDMPCMDNDDLRRGKPTVHKAFDDASAVLSGDALQALAFEILSEEKIHTDPHVRLELIQALAIASGKDGMVGGQAIDLAAETSTVPFDLPTITRLQQLKTGALFGFCLEAGAIMGRQNKDIRDRLKAYARDIGLAFQIADDLIDAGKATFLSLLGLEKARSQAQALVDQAIAHLSVFGSEADYLRSIARYIVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Polyprenyl synthetase
publication title Crystal structure of a FPP/GFPP synthase (Target EFI-501952) from Zymomonas mobilis, apo structure
rcsb
source organism Zymomonas mobilis subsp. mobilis
total genus 109
structure length 278
sequence length 295
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2013-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4kkmA00
2E8UA 3AQBB 3MAVA 1V4KA 4NKFA 3ASXA 3WJNA 5HN9A 4XQTF 3RYWA 5KSXF 3LVSA 4E9UA 3ID0A 5IKHA 4LLSA 2Z7IA 3N46F 3WCGA 1DI1A 3WEGA 4KPDA 4LPHF 3V66A 5ILKA 3N5JF 3WCCA 4E1EA 1UBWA 2J1PA 5ER8A 2E90A 2PS5A 2ZCSA 4DWGA 4OMGA 2Q9ZA 5DW7A 3SDTA 1DGPA 2E8WA 3P8RA 4H5DF 4KVDA 3LJIA 2EWGA 2Z4YA 4KQ5A 1UBYA 5DIQF 3VJEA 1YJ4A 5AYPA 2E8VA 3WEJA 2Q80A 3PH7A 1UBVA 1FPSA 1YHKA 1RTRA 3KB9A 4PVYF 3KRFA 4QXSF 3SDQA 3KBKA 3LGZB 1WL2A 3OACB 5ERMA 3WCBA 5DZ2A 5C05A 3N49F 3WC9A 4NUAA 4JXNA 3N6KF 3APZA 3SAEA 3M9UA 3VJ9A 1YHLA 3W7FA 3WSBA 4DXJA 3NPKA 3KROA 4GA3A 3OABA 3VJAA 3N3DA 4DI5A 4KFAA 3ZOUA 1HXCA 5IL8A 4LOBA 5B0IA 4LZCA 1HXAA 3KRCA 3N0FA 1V4EA 2FORA 2F89F 5IM1A 4LZ3A 3PKOA 3WCLA 3WE9A 4Q23A 2Z4WA 5AFXA 5HN7A 2F92F 3LMDA 1YYTA 3M0GA 1YYSA 3CKEA 3PYAA 3LZ9A 2F9KF 5ERNA 2Q9YA 4H5CF 4DHDA 5B0LA 4MC0A 1N20A 5IMPA 2Z50A 1N1BA 2ZEUA 2J1OA 1YYUA 2ZY1A 3V1XA 1V4HA 2E8XA 5AELA 5EAUA 3N0GA 2PS4A 3KRAA 3QKCA 4KQUA 5DJPF 5JV0F 2AELA 5ILYA 3S4JA 4FP4A 5B03A 3DYFA 1UBXA 2ONHA 5I1UA 4HD1A 5E8LA 3LSNA 4LTVA 4NG6A 2AETA 4JZBA 3WCIA 4H5EF 5EATA 3WCDA 4JZXA 4WK5A 4E9ZA 2F7MF 4GAXA 5CG5A 4RXDA 4XQRF 2Z78A 1N1ZA 4JVJF 5ILJA 3KRFB 3RBMA 3EFQA 4JYXA 4RXCA 3LEEA 5B0MA 3N1VF 3ICNA 3WCAA 2VF6A 3SDUA 3QQVA 4F6VA 3AE0A 5H9DA 4RXEA 4NFJF 5ILHA 2E4OA 3KROB 3IBAA 3OABB 4NKEA 3BNXA 3Q30A 4NFKF 1YV5A 4FJQA 3WEHA 2P1CA 3KRCB 5B02A 3Q2ZA 4LFVF 2AZKA 1YHMA 3KRPA 2ZCQA 5B0JA 4KVIA 2FTZA 4LIXA 3P5RA 3AQ0A 4RNQA 3ACXA 5E8KA 4LUUA 5B00A 3M01A 1VG7A 3SDRA 4EA1A 3M02A 1RQJA 5HNAA 3ZCDA 4LA6A 3N3LF 1JFAA 5HN8A 4LXWA 5A0IA 5JV2F 4RXAA 4DWBA 5DGNF 3ZMCA 3LDWA 3WEIA 4ZQ8A 2OGDA 5IK9A 1N21A 2F94F 3KRAB 4L2XF 5DHIA 5DHKA 2DH4A 5B01A 2Z4ZA 3VJ8A 3WCMA 1V4JA 3EGTA 3CP6A 2F8ZF 4JXYA 1HM4A 3G4DA 3RYEA 2AZJA 1KIYA 3LLWA 4KQSA 3UCAA 5EROA 5IVGA 3CC9A 4LFGA 3TFVA 2ZCRA 3LG5A 2OPNA 3VJCA 3M00A 4XQSF 4N9UA 3TS7A 3NRIA 3WCHA 3WSAA 2E95A 2ONGA 1HX9A 5A0JA 4GP1A 4P0XA 4LLTA 1ZW5A 3WCFA 3PDEA 1HM7A 5IMIA 1RQIA 4P0VA 4N1ZF 1EZFA 3SDVA 4OKMA 1WL1A 4F62A 1V4IA 3EZ3A 1VG2A 2AZLA 2Z4VA 2RAHA 3VJBA 3MZVA 1N23A 2Z52A 5DGSF 5EASA 3N45F 3P8LA 4LFEA 3TC1A 3LK5A 4DZWA 3WCEA 3IPIA 5AHUB 3P41A 1WL0A 4KKMA 4MC3A 2E91A 4DEMF 5DJRF 4GP2A 2E8TA 3Q1OA 3ZMBA 4LTZA 3KRPB 2AEKA 5ILIA 4LA5A 5ILDA 4PVXF 5CG6A 2E92A 2ZCOA 5IK0A 3S9VA 4OMHA 3BNYA 3ICKA 1YQ7A 3ACWA 4MC8A 5DGMF 5E8HA 1HXGA 1VG4A 2OPMA 3LOMA 4P0WA 3AQCB 3VJDA 2OA6A 4RYPA 4F6XA 1WMWA 4LZ0A 1JFGA 3DYGA 3PYBA 3WEFA 2Z7HA 1VG3A 2E94A 3WCJA 4NFIF 1N22A 3Q2QA 1WKZA 4KVWA 3N5HF 4KWDA 5ILZA 1PS1A 3WEKA 5IN8A 4KK2A 4EA2A 2PS7A 4KVYA 1N24A 2H8OA 1YYQA 3ICZA 5IKAA 3ACYA 3P5PA 5IL3A 3ICMA 3OACA 5B0KA 5DJVF 3G4FA 3RMGA 3DYHA 4LPGF 2PS8A 3NF2A 5IMNA 5JUZF 2O1OA 1KIZA 3ZL6A 2J5CA 4OGUA 3V1VA 2PS6A 4OKZA 5IK6A 3B7LA 2QISA 3TFNA 5A0KA 3LGKA 4UMJA 2Q58A 4KPJA 5JA0F 5JV1F 2E93A 4EA0A 3WJOA 3WJKA 2I19A 1WY0A 3TFPA 4KUXA 2Z4XA 2ZEVA 2F8CF 3N1WF 3ADZA 3NPRA 1VG6A 4K10A 4QPFA 1YYRA 1WL3A 3OYRA
chains in the Genus database with same CATH superfamily
2E8UA 3AQBB 3MAVA 1V4KA 4NKFA 3ASXA 3WJNA 5HN9A 4XQTF 3RYWA 5KSXF 3LVSA 4E9UA 3ID0A 5IKHA 4LLSA 2Z7IA 3N46F 3WCGA 1DI1A 3WEGA 4KPDA 4LPHF 3V66A 5ILKA 3N5JF 3WCCA 4E1EA 1UBWA 2J1PA 5ER8A 2E90A 2PS5A 2ZCSA 4DWGA 4OMGA 2Q9ZA 5DW7A 3SDTA 1DGPA 2E8WA 3P8RA 4H5DF 4KVDA 3LJIA 2EWGA 2Z4YA 4KQ5A 1UBYA 5DIQF 3VJEA 1YJ4A 5AYPA 2E8VA 3WEJA 2Q80A 3PH7A 1UBVA 1FPSA 1YHKA 1RTRA 3KB9A 4PVYF 3KRFA 4QXSF 3SDQA 3KBKA 3LGZB 1WL2A 3OACB 5ERMA 3WCBA 5DZ2A 5C05A 3N49F 3WC9A 4NUAA 4JXNA 3N6KF 3APZA 3SAEA 3M9UA 3VJ9A 1YHLA 3W7FA 3WSBA 4DXJA 3NPKA 3KROA 4GA3A 3OABA 3VJAA 3N3DA 4DI5A 4KFAA 3ZOUA 1HXCA 5IL8A 4LOBA 5B0IA 4LZCA 1HXAA 3KRCA 3N0FA 1V4EA 2FORA 2F89F 5IM1A 4LZ3A 3PKOA 3WCLA 3WE9A 4Q23A 2Z4WA 5AFXA 5HN7A 2F92F 3LMDA 1YYTA 3M0GA 1YYSA 3CKEA 3PYAA 3LZ9A 2F9KF 5ERNA 2Q9YA 4H5CF 4DHDA 5B0LA 4MC0A 1N20A 5IMPA 2Z50A 1N1BA 2ZEUA 2J1OA 1YYUA 2ZY1A 3V1XA 1V4HA 2E8XA 5AELA 5EAUA 3N0GA 2PS4A 3KRAA 3QKCA 4KQUA 5DJPF 5JV0F 2AELA 5ILYA 3S4JA 4FP4A 5B03A 3DYFA 1UBXA 2ONHA 5I1UA 4HD1A 5E8LA 3LSNA 4LTVA 4NG6A 2AETA 4JZBA 3WCIA 4H5EF 5EATA 3WCDA 4JZXA 4WK5A 4E9ZA 2F7MF 4GAXA 5CG5A 4RXDA 4XQRF 2Z78A 1N1ZA 4JVJF 5ILJA 3KRFB 3RBMA 3EFQA 4JYXA 4RXCA 3LEEA 5B0MA 3N1VF 3ICNA 3WCAA 2VF6A 3SDUA 3QQVA 4F6VA 3AE0A 5H9DA 4RXEA 4NFJF 5ILHA 2E4OA 3KROB 3IBAA 3OABB 4NKEA 3BNXA 3Q30A 4NFKF 1YV5A 4FJQA 3WEHA 2P1CA 3KRCB 5B02A 3Q2ZA 4LFVF 2AZKA 1YHMA 3KRPA 2ZCQA 5B0JA 4KVIA 2FTZA 4LIXA 3P5RA 3AQ0A 4RNQA 3ACXA 5E8KA 4LUUA 5B00A 3M01A 1VG7A 3SDRA 4EA1A 3M02A 1RQJA 5HNAA 3ZCDA 4LA6A 3N3LF 1JFAA 5HN8A 4LXWA 5A0IA 5JV2F 4RXAA 4DWBA 5DGNF 3ZMCA 3LDWA 3WEIA 4ZQ8A 2OGDA 5IK9A 1N21A 2F94F 3KRAB 4L2XF 5DHIA 5DHKA 2DH4A 5B01A 2Z4ZA 3VJ8A 3WCMA 1V4JA 3EGTA 3CP6A 2F8ZF 4JXYA 1HM4A 3G4DA 3RYEA 2AZJA 1KIYA 3LLWA 4KQSA 3UCAA 5EROA 5IVGA 3CC9A 4LFGA 3TFVA 2ZCRA 3LG5A 2OPNA 3VJCA 3M00A 4XQSF 4N9UA 3TS7A 3NRIA 3WCHA 3WSAA 2E95A 2ONGA 1HX9A 5A0JA 4GP1A 4P0XA 4LLTA 1ZW5A 3WCFA 3PDEA 1HM7A 5IMIA 1RQIA 4P0VA 4N1ZF 1EZFA 3SDVA 4OKMA 1WL1A 4F62A 1V4IA 3EZ3A 1VG2A 2AZLA 2Z4VA 2RAHA 3VJBA 3MZVA 1N23A 2Z52A 5DGSF 5EASA 3N45F 3P8LA 4LFEA 3TC1A 3LK5A 4DZWA 3WCEA 3IPIA 5AHUB 3P41A 1WL0A 4KKMA 4MC3A 2E91A 4DEMF 5DJRF 4GP2A 2E8TA 3Q1OA 3ZMBA 4LTZA 3KRPB 2AEKA 5ILIA 4LA5A 5ILDA 4PVXF 5CG6A 2E92A 2ZCOA 5IK0A 3S9VA 4OMHA 3BNYA 3ICKA 1YQ7A 3ACWA 4MC8A 5DGMF 5E8HA 1HXGA 1VG4A 2OPMA 3LOMA 4P0WA 3AQCB 3VJDA 2OA6A 4RYPA 4F6XA 1WMWA 4LZ0A 1JFGA 3DYGA 3PYBA 3WEFA 2Z7HA 1VG3A 2E94A 3WCJA 4NFIF 1N22A 3Q2QA 1WKZA 4KVWA 3N5HF 4KWDA 5ILZA 1PS1A 3WEKA 5IN8A 4KK2A 4EA2A 2PS7A 4KVYA 1N24A 2H8OA 1YYQA 3ICZA 5IKAA 3ACYA 3P5PA 5IL3A 3ICMA 3OACA 5B0KA 5DJVF 3G4FA 3RMGA 3DYHA 4LPGF 2PS8A 3NF2A 5IMNA 5JUZF 2O1OA 1KIZA 3ZL6A 2J5CA 4OGUA 3V1VA 2PS6A 4OKZA 5IK6A 3B7LA 2QISA 3TFNA 5A0KA 3LGKA 4UMJA 2Q58A 4KPJA 5JA0F 5JV1F 2E93A 4EA0A 3WJOA 3WJKA 2I19A 1WY0A 3TFPA 4KUXA 2Z4XA 2ZEVA 2F8CF 3N1WF 3ADZA 3NPRA 1VG6A 4K10A 4QPFA 1YYRA 1WL3A 3OYRA
chains in the Genus database with same CATH topology
2E8UA 3AQBB 3MAVA 1V4KA 4NKFA 3ASXA 3WJNA 5HN9A 4XQTF 3RYWA 5KSXF 3LVSA 4E9UA 3ID0A 5IKHA 4LLSA 2Z7IA 3N46F 3WCGA 1DI1A 3WEGA 4KPDA 4LPHF 3V66A 5ILKA 3N5JF 3WCCA 4E1EA 1UBWA 2J1PA 5ER8A 2E90A 2PS5A 2ZCSA 4DWGA 4OMGA 2Q9ZA 5DW7A 3SDTA 1DGPA 2E8WA 3P8RA 4H5DF 4KVDA 3LJIA 2EWGA 2Z4YA 4KQ5A 1UBYA 5DIQF 3VJEA 1YJ4A 5AYPA 2E8VA 3WEJA 2Q80A 3PH7A 1UBVA 1FPSA 1YHKA 1RTRA 3KB9A 4PVYF 3KRFA 4QXSF 3SDQA 3KBKA 3LGZB 1WL2A 3OACB 5ERMA 3WCBA 5DZ2A 5C05A 3N49F 3WC9A 4NUAA 4JXNA 3N6KF 3APZA 3SAEA 3M9UA 3VJ9A 1YHLA 3W7FA 3WSBA 4DXJA 3NPKA 3KROA 4GA3A 3OABA 3VJAA 3N3DA 4DI5A 4KFAA 3ZOUA 1HXCA 5IL8A 4LOBA 5B0IA 4LZCA 1HXAA 3KRCA 3N0FA 1V4EA 2FORA 2F89F 5IM1A 4LZ3A 3PKOA 3WCLA 3WE9A 4Q23A 2Z4WA 5AFXA 5HN7A 2F92F 3LMDA 1YYTA 3M0GA 1YYSA 3CKEA 3PYAA 3LZ9A 2F9KF 5ERNA 2Q9YA 4H5CF 4DHDA 5B0LA 4MC0A 1N20A 5IMPA 2Z50A 1N1BA 2ZEUA 2J1OA 1YYUA 2ZY1A 3V1XA 1V4HA 2E8XA 5AELA 5EAUA 3N0GA 2PS4A 3KRAA 3QKCA 4KQUA 5DJPF 5JV0F 2AELA 5ILYA 3S4JA 4FP4A 5B03A 3DYFA 1UBXA 2ONHA 5I1UA 4HD1A 5E8LA 3LSNA 4LTVA 4NG6A 2AETA 4JZBA 3WCIA 4H5EF 5EATA 3WCDA 4JZXA 4WK5A 4E9ZA 2F7MF 4GAXA 5CG5A 4RXDA 4XQRF 2Z78A 1N1ZA 4JVJF 5ILJA 3KRFB 3RBMA 3EFQA 4JYXA 4RXCA 3LEEA 5B0MA 3N1VF 3ICNA 3WCAA 2VF6A 3SDUA 3QQVA 4F6VA 3AE0A 5H9DA 4RXEA 4NFJF 5ILHA 2E4OA 3KROB 3IBAA 3OABB 4NKEA 3BNXA 3Q30A 4NFKF 1YV5A 4FJQA 3WEHA 2P1CA 3KRCB 5B02A 3Q2ZA 4LFVF 2AZKA 1YHMA 3KRPA 2ZCQA 5B0JA 4KVIA 2FTZA 4LIXA 3P5RA 3AQ0A 4RNQA 3ACXA 5E8KA 4LUUA 5B00A 3M01A 1VG7A 3SDRA 4EA1A 3M02A 1RQJA 5HNAA 3ZCDA 4LA6A 3N3LF 1JFAA 5HN8A 4LXWA 5A0IA 5JV2F 4RXAA 4DWBA 5DGNF 3ZMCA 3LDWA 3WEIA 4ZQ8A 2OGDA 5IK9A 1N21A 2F94F 3KRAB 4L2XF 5DHIA 5DHKA 2DH4A 5B01A 2Z4ZA 3VJ8A 3WCMA 1V4JA 3EGTA 3CP6A 2F8ZF 4JXYA 1HM4A 3G4DA 3RYEA 2AZJA 1KIYA 3LLWA 4KQSA 3UCAA 5EROA 5IVGA 3CC9A 4LFGA 3TFVA 2ZCRA 3LG5A 2OPNA 3VJCA 3M00A 4XQSF 4N9UA 3TS7A 3NRIA 3WCHA 3WSAA 2E95A 2ONGA 1HX9A 5A0JA 4GP1A 4P0XA 4LLTA 1ZW5A 3WCFA 3PDEA 1HM7A 5IMIA 1RQIA 4P0VA 4N1ZF 1EZFA 3SDVA 4OKMA 1WL1A 4F62A 1V4IA 3EZ3A 1VG2A 2AZLA 2Z4VA 2RAHA 3VJBA 3MZVA 1N23A 2Z52A 5DGSF 5EASA 3N45F 3P8LA 4LFEA 3TC1A 3LK5A 4DZWA 3WCEA 3IPIA 5AHUB 3P41A 1WL0A 4KKMA 4MC3A 2E91A 4DEMF 5DJRF 4GP2A 2E8TA 3Q1OA 3ZMBA 4LTZA 3KRPB 2AEKA 5ILIA 4LA5A 5ILDA 4PVXF 5CG6A 2E92A 2ZCOA 5IK0A 3S9VA 4OMHA 3BNYA 3ICKA 1YQ7A 3ACWA 4MC8A 5DGMF 5E8HA 1HXGA 1VG4A 2OPMA 3LOMA 4P0WA 3AQCB 3VJDA 2OA6A 4RYPA 4F6XA 1WMWA 4LZ0A 1JFGA 3DYGA 3PYBA 3WEFA 2Z7HA 1VG3A 2E94A 3WCJA 4NFIF 1N22A 3Q2QA 1WKZA 4KVWA 3N5HF 4KWDA 5ILZA 1PS1A 3WEKA 5IN8A 4KK2A 4EA2A 2PS7A 4KVYA 1N24A 2H8OA 1YYQA 3ICZA 5IKAA 3ACYA 3P5PA 5IL3A 3ICMA 3OACA 5B0KA 5DJVF 3G4FA 3RMGA 3DYHA 4LPGF 2PS8A 3NF2A 5IMNA 5JUZF 2O1OA 1KIZA 3ZL6A 2J5CA 4OGUA 3V1VA 2PS6A 4OKZA 5IK6A 3B7LA 2QISA 3TFNA 5A0KA 3LGKA 4UMJA 2Q58A 4KPJA 5JA0F 5JV1F 2E93A 4EA0A 3WJOA 3WJKA 2I19A 1WY0A 3TFPA 4KUXA 2Z4XA 2ZEVA 2F8CF 3N1WF 3ADZA 3NPRA 1VG6A 4K10A 4QPFA 1YYRA 1WL3A 3OYRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8U A;  3AQB B;  3MAV A;  1V4K A;  4NKF A;  3ASX A;  3WJN A;  5HN9 A;  4XQT F;  3RYW A;  5KSX F;  3LVS A;  4E9U A;  3ID0 A;  5IKH A;  4LLS A;  2Z7I A;  3N46 F;  3WCG A;  1DI1 A;  3WEG A;  4KPD A;  4LPH F;  3V66 A;  5ILK A;  3N5J F;  3WCC A;  4E1E A;  1UBW A;  2J1P A;  5ER8 A;  2E90 A;  2PS5 A;  2ZCS A;  4DWG A;  4OMG A;  2Q9Z A;  5DW7 A;  3SDT A;  1DGP A;  2E8W A;  3P8R A;  4H5D F;  4KVD A;  3LJI A;  2EWG A;  2Z4Y A;  4KQ5 A;  1UBY A;  5DIQ F;  3VJE A;  1YJ4 A;  5AYP A;  2E8V A;  3WEJ A;  2Q80 A;  3PH7 A;  1UBV A;  1FPS A;  1YHK A;  1RTR A;  3KB9 A;  4PVY F;  3KRF A;  4QXS F;  3SDQ A;  3KBK A;  3LGZ B;  1WL2 A;  3OAC B;  5ERM A;  3WCB A;  5DZ2 A;  5C05 A;  3N49 F;  3WC9 A;  4NUA A;  4JXN A;  3N6K F;  3APZ A;  3SAE A;  3M9U A;  3VJ9 A;  1YHL A;  3W7F A;  3WSB A;  4DXJ A;  3NPK A;  3KRO A;  4GA3 A;  3OAB A;  3VJA A;  3N3D A;  4DI5 A;  4KFA A;  3ZOU A;  1HXC A;  5IL8 A;  4LOB A;  5B0I A;  4LZC A;  1HXA A;  3KRC A;  3N0F A;  1V4E A;  2FOR A;  2F89 F;  5IM1 A;  4LZ3 A;  3PKO A;  3WCL A;  3WE9 A;  4Q23 A;  2Z4W A;  5AFX A;  5HN7 A;  2F92 F;  3LMD A;  1YYT A;  3M0G A;  1YYS A;  3CKE A;  3PYA A;  3LZ9 A;  2F9K F;  5ERN A;  2Q9Y A;  4H5C F;  4DHD A;  5B0L A;  4MC0 A;  1N20 A;  5IMP A;  2Z50 A;  1N1B A;  2ZEU A;  2J1O A;  1YYU A;  2ZY1 A;  3V1X A;  1V4H A;  2E8X A;  5AEL A;  5EAU A;  3N0G A;  2PS4 A;  3KRA A;  3QKC A;  4KQU A;  5DJP F;  5JV0 F;  2AEL A;  5ILY A;  3S4J A;  4FP4 A;  5B03 A;  3DYF A;  1UBX A;  2ONH A;  5I1U A;  4HD1 A;  5E8L A;  3LSN A;  4LTV A;  4NG6 A;  2AET A;  4JZB A;  3WCI A;  4H5E F;  5EAT A;  3WCD A;  4JZX A;  4WK5 A;  4E9Z A;  2F7M F;  4GAX A;  5CG5 A;  4RXD A;  4XQR F;  2Z78 A;  1N1Z A;  4JVJ F;  5ILJ A;  3KRF B;  3RBM A;  3EFQ A;  4JYX A;  4RXC A;  3LEE A;  5B0M A;  3N1V F;  3ICN A;  3WCA A;  2VF6 A;  3SDU A;  3QQV A;  4F6V A;  3AE0 A;  5H9D A;  4RXE A;  4NFJ F;  5ILH A;  2E4O A;  3KRO B;  3IBA A;  3OAB B;  4NKE A;  3BNX A;  3Q30 A;  4NFK F;  1YV5 A;  4FJQ A;  3WEH A;  2P1C A;  3KRC B;  5B02 A;  3Q2Z A;  4LFV F;  2AZK A;  1YHM A;  3KRP A;  2ZCQ A;  5B0J A;  4KVI A;  2FTZ A;  4LIX A;  3P5R A;  3AQ0 A;  4RNQ A;  3ACX A;  5E8K A;  4LUU A;  5B00 A;  3M01 A;  1VG7 A;  3SDR A;  4EA1 A;  3M02 A;  1RQJ A;  5HNA A;  3ZCD A;  4LA6 A;  3N3L F;  1JFA A;  5HN8 A;  4LXW A;  5A0I A;  5JV2 F;  4RXA A;  4DWB A;  5DGN F;  3ZMC A;  3LDW A;  3WEI A;  4ZQ8 A;  2OGD A;  5IK9 A;  1N21 A;  2F94 F;  3KRA B;  4L2X F;  5DHI A;  5DHK A;  2DH4 A;  5B01 A;  2Z4Z A;  3VJ8 A;  3WCM A;  1V4J A;  3EGT A;  3CP6 A;  2F8Z F;  4JXY A;  1HM4 A;  3G4D A;  3RYE A;  2AZJ A;  1KIY A;  3LLW A;  4KQS A;  3UCA A;  5ERO A;  5IVG A;  3CC9 A;  4LFG A;  3TFV A;  2ZCR A;  3LG5 A;  2OPN A;  3VJC A;  3M00 A;  4XQS F;  4N9U A;  3TS7 A;  3NRI A;  3WCH A;  3WSA A;  2E95 A;  2ONG A;  1HX9 A;  5A0J A;  4GP1 A;  4P0X A;  4LLT A;  1ZW5 A;  3WCF A;  3PDE A;  1HM7 A;  5IMI A;  1RQI A;  4P0V A;  4N1Z F;  1EZF A;  3SDV A;  4OKM A;  1WL1 A;  4F62 A;  1V4I A;  3EZ3 A;  1VG2 A;  2AZL A;  2Z4V A;  2RAH A;  3VJB A;  3MZV A;  1N23 A;  2Z52 A;  5DGS F;  5EAS A;  3N45 F;  3P8L A;  4LFE A;  3TC1 A;  3LK5 A;  4DZW A;  3WCE A;  3IPI A;  5AHU B;  3P41 A;  1WL0 A;  4KKM A;  4MC3 A;  2E91 A;  4DEM F;  5DJR F;  4GP2 A;  2E8T A;  3Q1O A;  3ZMB A;  4LTZ A;  3KRP B;  2AEK A;  5ILI A;  4LA5 A;  5ILD A;  4PVX F;  5CG6 A;  2E92 A;  2ZCO A;  5IK0 A;  3S9V A;  4OMH A;  3BNY A;  3ICK A;  1YQ7 A;  3ACW A;  4MC8 A;  5DGM F;  5E8H A;  1HXG A;  1VG4 A;  2OPM A;  3LOM A;  4P0W A;  3AQC B;  3VJD A;  2OA6 A;  4RYP A;  4F6X A;  1WMW A;  4LZ0 A;  1JFG A;  3DYG A;  3PYB A;  3WEF A;  2Z7H A;  1VG3 A;  2E94 A;  3WCJ A;  4NFI F;  1N22 A;  3Q2Q A;  1WKZ A;  4KVW A;  3N5H F;  4KWD A;  5ILZ A;  1PS1 A;  3WEK A;  5IN8 A;  4KK2 A;  4EA2 A;  2PS7 A;  4KVY A;  1N24 A;  2H8O A;  1YYQ A;  3ICZ A;  5IKA A;  3ACY A;  3P5P A;  5IL3 A;  3ICM A;  3OAC A;  5B0K A;  5DJV F;  3G4F A;  3RMG A;  3DYH A;  4LPG F;  2PS8 A;  3NF2 A;  5IMN A;  5JUZ F;  2O1O A;  1KIZ A;  3ZL6 A;  2J5C A;  4OGU A;  3V1V A;  2PS6 A;  4OKZ A;  5IK6 A;  3B7L A;  2QIS A;  3TFN A;  5A0K A;  3LGK A;  4UMJ A;  2Q58 A;  4KPJ A;  5JA0 F;  5JV1 F;  2E93 A;  4EA0 A;  3WJO A;  3WJK A;  2I19 A;  1WY0 A;  3TFP A;  4KUX A;  2Z4X A;  2ZEV A;  2F8C F;  3N1W F;  3ADZ A;  3NPR A;  1VG6 A;  4K10 A;  4QPF A;  1YYR A;  1WL3 A;  3OYR A; 
#chains in the Genus database with same CATH topology
 2E8U A;  3AQB B;  3MAV A;  1V4K A;  4NKF A;  3ASX A;  3WJN A;  5HN9 A;  4XQT F;  3RYW A;  5KSX F;  3LVS A;  4E9U A;  3ID0 A;  5IKH A;  4LLS A;  2Z7I A;  3N46 F;  3WCG A;  1DI1 A;  3WEG A;  4KPD A;  4LPH F;  3V66 A;  5ILK A;  3N5J F;  3WCC A;  4E1E A;  1UBW A;  2J1P A;  5ER8 A;  2E90 A;  2PS5 A;  2ZCS A;  4DWG A;  4OMG A;  2Q9Z A;  5DW7 A;  3SDT A;  1DGP A;  2E8W A;  3P8R A;  4H5D F;  4KVD A;  3LJI A;  2EWG A;  2Z4Y A;  4KQ5 A;  1UBY A;  5DIQ F;  3VJE A;  1YJ4 A;  5AYP A;  2E8V A;  3WEJ A;  2Q80 A;  3PH7 A;  1UBV A;  1FPS A;  1YHK A;  1RTR A;  3KB9 A;  4PVY F;  3KRF A;  4QXS F;  3SDQ A;  3KBK A;  3LGZ B;  1WL2 A;  3OAC B;  5ERM A;  3WCB A;  5DZ2 A;  5C05 A;  3N49 F;  3WC9 A;  4NUA A;  4JXN A;  3N6K F;  3APZ A;  3SAE A;  3M9U A;  3VJ9 A;  1YHL A;  3W7F A;  3WSB A;  4DXJ A;  3NPK A;  3KRO A;  4GA3 A;  3OAB A;  3VJA A;  3N3D A;  4DI5 A;  4KFA A;  3ZOU A;  1HXC A;  5IL8 A;  4LOB A;  5B0I A;  4LZC A;  1HXA A;  3KRC A;  3N0F A;  1V4E A;  2FOR A;  2F89 F;  5IM1 A;  4LZ3 A;  3PKO A;  3WCL A;  3WE9 A;  4Q23 A;  2Z4W A;  5AFX A;  5HN7 A;  2F92 F;  3LMD A;  1YYT A;  3M0G A;  1YYS A;  3CKE A;  3PYA A;  3LZ9 A;  2F9K F;  5ERN A;  2Q9Y A;  4H5C F;  4DHD A;  5B0L A;  4MC0 A;  1N20 A;  5IMP A;  2Z50 A;  1N1B A;  2ZEU A;  2J1O A;  1YYU A;  2ZY1 A;  3V1X A;  1V4H A;  2E8X A;  5AEL A;  5EAU A;  3N0G A;  2PS4 A;  3KRA A;  3QKC A;  4KQU A;  5DJP F;  5JV0 F;  2AEL A;  5ILY A;  3S4J A;  4FP4 A;  5B03 A;  3DYF A;  1UBX A;  2ONH A;  5I1U A;  4HD1 A;  5E8L A;  3LSN A;  4LTV A;  4NG6 A;  2AET A;  4JZB A;  3WCI A;  4H5E F;  5EAT A;  3WCD A;  4JZX A;  4WK5 A;  4E9Z A;  2F7M F;  4GAX A;  5CG5 A;  4RXD A;  4XQR F;  2Z78 A;  1N1Z A;  4JVJ F;  5ILJ A;  3KRF B;  3RBM A;  3EFQ A;  4JYX A;  4RXC A;  3LEE A;  5B0M A;  3N1V F;  3ICN A;  3WCA A;  2VF6 A;  3SDU A;  3QQV A;  4F6V A;  3AE0 A;  5H9D A;  4RXE A;  4NFJ F;  5ILH A;  2E4O A;  3KRO B;  3IBA A;  3OAB B;  4NKE A;  3BNX A;  3Q30 A;  4NFK F;  1YV5 A;  4FJQ A;  3WEH A;  2P1C A;  3KRC B;  5B02 A;  3Q2Z A;  4LFV F;  2AZK A;  1YHM A;  3KRP A;  2ZCQ A;  5B0J A;  4KVI A;  2FTZ A;  4LIX A;  3P5R A;  3AQ0 A;  4RNQ A;  3ACX A;  5E8K A;  4LUU A;  5B00 A;  3M01 A;  1VG7 A;  3SDR A;  4EA1 A;  3M02 A;  1RQJ A;  5HNA A;  3ZCD A;  4LA6 A;  3N3L F;  1JFA A;  5HN8 A;  4LXW A;  5A0I A;  5JV2 F;  4RXA A;  4DWB A;  5DGN F;  3ZMC A;  3LDW A;  3WEI A;  4ZQ8 A;  2OGD A;  5IK9 A;  1N21 A;  2F94 F;  3KRA B;  4L2X F;  5DHI A;  5DHK A;  2DH4 A;  5B01 A;  2Z4Z A;  3VJ8 A;  3WCM A;  1V4J A;  3EGT A;  3CP6 A;  2F8Z F;  4JXY A;  1HM4 A;  3G4D A;  3RYE A;  2AZJ A;  1KIY A;  3LLW A;  4KQS A;  3UCA A;  5ERO A;  5IVG A;  3CC9 A;  4LFG A;  3TFV A;  2ZCR A;  3LG5 A;  2OPN A;  3VJC A;  3M00 A;  4XQS F;  4N9U A;  3TS7 A;  3NRI A;  3WCH A;  3WSA A;  2E95 A;  2ONG A;  1HX9 A;  5A0J A;  4GP1 A;  4P0X A;  4LLT A;  1ZW5 A;  3WCF A;  3PDE A;  1HM7 A;  5IMI A;  1RQI A;  4P0V A;  4N1Z F;  1EZF A;  3SDV A;  4OKM A;  1WL1 A;  4F62 A;  1V4I A;  3EZ3 A;  1VG2 A;  2AZL A;  2Z4V A;  2RAH A;  3VJB A;  3MZV A;  1N23 A;  2Z52 A;  5DGS F;  5EAS A;  3N45 F;  3P8L A;  4LFE A;  3TC1 A;  3LK5 A;  4DZW A;  3WCE A;  3IPI A;  5AHU B;  3P41 A;  1WL0 A;  4KKM A;  4MC3 A;  2E91 A;  4DEM F;  5DJR F;  4GP2 A;  2E8T A;  3Q1O A;  3ZMB A;  4LTZ A;  3KRP B;  2AEK A;  5ILI A;  4LA5 A;  5ILD A;  4PVX F;  5CG6 A;  2E92 A;  2ZCO A;  5IK0 A;  3S9V A;  4OMH A;  3BNY A;  3ICK A;  1YQ7 A;  3ACW A;  4MC8 A;  5DGM F;  5E8H A;  1HXG A;  1VG4 A;  2OPM A;  3LOM A;  4P0W A;  3AQC B;  3VJD A;  2OA6 A;  4RYP A;  4F6X A;  1WMW A;  4LZ0 A;  1JFG A;  3DYG A;  3PYB A;  3WEF A;  2Z7H A;  1VG3 A;  2E94 A;  3WCJ A;  4NFI F;  1N22 A;  3Q2Q A;  1WKZ A;  4KVW A;  3N5H F;  4KWD A;  5ILZ A;  1PS1 A;  3WEK A;  5IN8 A;  4KK2 A;  4EA2 A;  2PS7 A;  4KVY A;  1N24 A;  2H8O A;  1YYQ A;  3ICZ A;  5IKA A;  3ACY A;  3P5P A;  5IL3 A;  3ICM A;  3OAC A;  5B0K A;  5DJV F;  3G4F A;  3RMG A;  3DYH A;  4LPG F;  2PS8 A;  3NF2 A;  5IMN A;  5JUZ F;  2O1O A;  1KIZ A;  3ZL6 A;  2J5C A;  4OGU A;  3V1V A;  2PS6 A;  4OKZ A;  5IK6 A;  3B7L A;  2QIS A;  3TFN A;  5A0K A;  3LGK A;  4UMJ A;  2Q58 A;  4KPJ A;  5JA0 F;  5JV1 F;  2E93 A;  4EA0 A;  3WJO A;  3WJK A;  2I19 A;  1WY0 A;  3TFP A;  4KUX A;  2Z4X A;  2ZEV A;  2F8C F;  3N1W F;  3ADZ A;  3NPR A;  1VG6 A;  4K10 A;  4QPF A;  1YYR A;  1WL3 A;  3OYR A; 
#chains in the Genus database with same CATH homology
 2E8U A;  3AQB B;  3MAV A;  1V4K A;  4NKF A;  3ASX A;  3WJN A;  5HN9 A;  4XQT F;  3RYW A;  5KSX F;  3LVS A;  4E9U A;  3ID0 A;  5IKH A;  4LLS A;  2Z7I A;  3N46 F;  3WCG A;  1DI1 A;  3WEG A;  4KPD A;  4LPH F;  3V66 A;  5ILK A;  3N5J F;  3WCC A;  4E1E A;  1UBW A;  2J1P A;  5ER8 A;  2E90 A;  2PS5 A;  2ZCS A;  4DWG A;  4OMG A;  2Q9Z A;  5DW7 A;  3SDT A;  1DGP A;  2E8W A;  3P8R A;  4H5D F;  4KVD A;  3LJI A;  2EWG A;  2Z4Y A;  4KQ5 A;  1UBY A;  5DIQ F;  3VJE A;  1YJ4 A;  5AYP A;  2E8V A;  3WEJ A;  2Q80 A;  3PH7 A;  1UBV A;  1FPS A;  1YHK A;  1RTR A;  3KB9 A;  4PVY F;  3KRF A;  4QXS F;  3SDQ A;  3KBK A;  3LGZ B;  1WL2 A;  3OAC B;  5ERM A;  3WCB A;  5DZ2 A;  5C05 A;  3N49 F;  3WC9 A;  4NUA A;  4JXN A;  3N6K F;  3APZ A;  3SAE A;  3M9U A;  3VJ9 A;  1YHL A;  3W7F A;  3WSB A;  4DXJ A;  3NPK A;  3KRO A;  4GA3 A;  3OAB A;  3VJA A;  3N3D A;  4DI5 A;  4KFA A;  3ZOU A;  1HXC A;  5IL8 A;  4LOB A;  5B0I A;  4LZC A;  1HXA A;  3KRC A;  3N0F A;  1V4E A;  2FOR A;  2F89 F;  5IM1 A;  4LZ3 A;  3PKO A;  3WCL A;  3WE9 A;  4Q23 A;  2Z4W A;  5AFX A;  5HN7 A;  2F92 F;  3LMD A;  1YYT A;  3M0G A;  1YYS A;  3CKE A;  3PYA A;  3LZ9 A;  2F9K F;  5ERN A;  2Q9Y A;  4H5C F;  4DHD A;  5B0L A;  4MC0 A;  1N20 A;  5IMP A;  2Z50 A;  1N1B A;  2ZEU A;  2J1O A;  1YYU A;  2ZY1 A;  3V1X A;  1V4H A;  2E8X A;  5AEL A;  5EAU A;  3N0G A;  2PS4 A;  3KRA A;  3QKC A;  4KQU A;  5DJP F;  5JV0 F;  2AEL A;  5ILY A;  3S4J A;  4FP4 A;  5B03 A;  3DYF A;  1UBX A;  2ONH A;  5I1U A;  4HD1 A;  5E8L A;  3LSN A;  4LTV A;  4NG6 A;  2AET A;  4JZB A;  3WCI A;  4H5E F;  5EAT A;  3WCD A;  4JZX A;  4WK5 A;  4E9Z A;  2F7M F;  4GAX A;  5CG5 A;  4RXD A;  4XQR F;  2Z78 A;  1N1Z A;  4JVJ F;  5ILJ A;  3KRF B;  3RBM A;  3EFQ A;  4JYX A;  4RXC A;  3LEE A;  5B0M A;  3N1V F;  3ICN A;  3WCA A;  2VF6 A;  3SDU A;  3QQV A;  4F6V A;  3AE0 A;  5H9D A;  4RXE A;  4NFJ F;  5ILH A;  2E4O A;  3KRO B;  3IBA A;  3OAB B;  4NKE A;  3BNX A;  3Q30 A;  4NFK F;  1YV5 A;  4FJQ A;  3WEH A;  2P1C A;  3KRC B;  5B02 A;  3Q2Z A;  4LFV F;  2AZK A;  1YHM A;  3KRP A;  2ZCQ A;  5B0J A;  4KVI A;  2FTZ A;  4LIX A;  3P5R A;  3AQ0 A;  4RNQ A;  3ACX A;  5E8K A;  4LUU A;  5B00 A;  3M01 A;  1VG7 A;  3SDR A;  4EA1 A;  3M02 A;  1RQJ A;  5HNA A;  3ZCD A;  4LA6 A;  3N3L F;  1JFA A;  5HN8 A;  4LXW A;  5A0I A;  5JV2 F;  4RXA A;  4DWB A;  5DGN F;  3ZMC A;  3LDW A;  3WEI A;  4ZQ8 A;  2OGD A;  5IK9 A;  1N21 A;  2F94 F;  3KRA B;  4L2X F;  5DHI A;  5DHK A;  2DH4 A;  5B01 A;  2Z4Z A;  3VJ8 A;  3WCM A;  1V4J A;  3EGT A;  3CP6 A;  2F8Z F;  4JXY A;  1HM4 A;  3G4D A;  3RYE A;  2AZJ A;  1KIY A;  3LLW A;  4KQS A;  3UCA A;  5ERO A;  5IVG A;  3CC9 A;  4LFG A;  3TFV A;  2ZCR A;  3LG5 A;  2OPN A;  3VJC A;  3M00 A;  4XQS F;  4N9U A;  3TS7 A;  3NRI A;  3WCH A;  3WSA A;  2E95 A;  2ONG A;  1HX9 A;  5A0J A;  4GP1 A;  4P0X A;  4LLT A;  1ZW5 A;  3WCF A;  3PDE A;  1HM7 A;  5IMI A;  1RQI A;  4P0V A;  4N1Z F;  1EZF A;  3SDV A;  4OKM A;  1WL1 A;  4F62 A;  1V4I A;  3EZ3 A;  1VG2 A;  2AZL A;  2Z4V A;  2RAH A;  3VJB A;  3MZV A;  1N23 A;  2Z52 A;  5DGS F;  5EAS A;  3N45 F;  3P8L A;  4LFE A;  3TC1 A;  3LK5 A;  4DZW A;  3WCE A;  3IPI A;  5AHU B;  3P41 A;  1WL0 A;  4KKM A;  4MC3 A;  2E91 A;  4DEM F;  5DJR F;  4GP2 A;  2E8T A;  3Q1O A;  3ZMB A;  4LTZ A;  3KRP B;  2AEK A;  5ILI A;  4LA5 A;  5ILD A;  4PVX F;  5CG6 A;  2E92 A;  2ZCO A;  5IK0 A;  3S9V A;  4OMH A;  3BNY A;  3ICK A;  1YQ7 A;  3ACW A;  4MC8 A;  5DGM F;  5E8H A;  1HXG A;  1VG4 A;  2OPM A;  3LOM A;  4P0W A;  3AQC B;  3VJD A;  2OA6 A;  4RYP A;  4F6X A;  1WMW A;  4LZ0 A;  1JFG A;  3DYG A;  3PYB A;  3WEF A;  2Z7H A;  1VG3 A;  2E94 A;  3WCJ A;  4NFI F;  1N22 A;  3Q2Q A;  1WKZ A;  4KVW A;  3N5H F;  4KWD A;  5ILZ A;  1PS1 A;  3WEK A;  5IN8 A;  4KK2 A;  4EA2 A;  2PS7 A;  4KVY A;  1N24 A;  2H8O A;  1YYQ A;  3ICZ A;  5IKA A;  3ACY A;  3P5P A;  5IL3 A;  3ICM A;  3OAC A;  5B0K A;  5DJV F;  3G4F A;  3RMG A;  3DYH A;  4LPG F;  2PS8 A;  3NF2 A;  5IMN A;  5JUZ F;  2O1O A;  1KIZ A;  3ZL6 A;  2J5C A;  4OGU A;  3V1V A;  2PS6 A;  4OKZ A;  5IK6 A;  3B7L A;  2QIS A;  3TFN A;  5A0K A;  3LGK A;  4UMJ A;  2Q58 A;  4KPJ A;  5JA0 F;  5JV1 F;  2E93 A;  4EA0 A;  3WJO A;  3WJK A;  2I19 A;  1WY0 A;  3TFP A;  4KUX A;  2Z4X A;  2ZEV A;  2F8C F;  3N1W F;  3ADZ A;  3NPR A;  1VG6 A;  4K10 A;  4QPF A;  1YYR A;  1WL3 A;  3OYR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...