4RXEA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-14
Total Genus 151
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
151
sequence length
367
structure length
358
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyl pyrophosphate synthase
publication title Farnesyl diphosphate synthase inhibitors with unique ligand-binding geometries.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 151
structure length 358
sequence length 367
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4rxeA00
3ADZA 3N1VF 3NRIA 5IL8A 4LLSA 4P0XA 4RXDA 1VG2A 2I19A 4OMGA 3WEFA 3QKCA 3ID0A 4KVIA 5C05A 3WE9A 4LZCA 5JV0F 3EZ3A 3UCAA 3KBKA 5IK0A 1HM4A 1HX9A 4KQUA 3LGKA 4UMJA 3WJKA 4P0VA 2J1OA 1N21A 5HN8A 3Q1OA 4DI5A 5B0KA 5DJVF 2OA6A 2PS7A 1UBWA 4L2XF 2AZJA 5ERNA 1UBYA 2Z4VA 5ILDA 3BNXA 4LIXA 3KRAB 2PS8A 5H9DA 5IVGA 5B0IA 5IN8A 3M02A 3N5JF 3N5HF 3P8LA 1DI1A 4JVJF 3LVSA 3WCEA 3ICZA 4GP1A 3N3LF 5DHIA 4EA0A 1RQIA 4GA3A 1WMWA 5AELA 4NFJF 3KRAA 5B00A 1VG4A 3KROB 2ZEVA 1VG7A 5ILKA 1YYQA 2Z4WA 3RMGA 5KSXF 3M0GA 2AELA 1N23A 4LXWA 2AETA 2RAHA 3P5PA 3W7FA 1WKZA 1EZFA 2ZCOA 3G4FA 4KVDA 4KK2A 4N9UA 2ONHA 4JYXA 3WCMA 5CG6A 2Z78A 2AZLA 4FP4A 3ACXA 5DJRF 2Q9ZA 5DHKA 2E91A 4QXSF 5A0KA 3LGZB 4HD1A 5I1UA 3LJIA 5JA0F 3V66A 3CKEA 3LZ9A 1VG3A 5ILYA 5DGSF 4DHDA 3LOMA 4JXNA 3OABB 1YHMA 2E8XA 3VJ8A 4F6XA 3N49F 4EA2A 4NG6A 4RXAA 3KB9A 5DJPF 3KRPA 3SDTA 3WEIA 1N24A 3VJDA 3V1XA 3ASXA 4LLTA 3SDRA 2J1PA 3OABA 3TFNA 4N1ZF 5E8KA 5DW7A 5AYPA 2Q9YA 4DWGA 4H5EF 3PDEA 4OGUA 3SDQA 5IMPA 4OKZA 3ACWA 4MC8A 3KRCB 3SDVA 3WJOA 5JUZF 4KVWA 2AZKA 5E8HA 2FORA 1YQ7A 3QQVA 1N1BA 5IKAA 3EFQA 5HN7A 2ZY1A 3WCAA 2OGDA 4E1EA 2Z4XA 3WEKA 3LEEA 4EA1A 1YYTA 3N6KF 4LTVA 3ICNA 3KRCA 2J5CA 1WY0A 4NKFA 3KRFA 5B0JA 4MC0A 3SAEA 4RXCA 1RQJA 5CG5A 3PYAA 2Z4ZA 2ZCRA 4FJQA 5IKHA 4NFKF 5IK6A 2ONGA 5HNAA 4OMHA 3NPKA 4JXYA 5ILZA 3M9UA 3PKOA 1YHKA 2F9KF 3TFPA 3VJBA 3IBAA 4XQRF 3ICMA 3RBMA 2ZEUA 3VJEA 3SDUA 2Z50A 5IM1A 4JZBA 4RYPA 4PVXF 5DGMF 1RTRA 3LSNA 2E90A 3WEJA 5AFXA 3IPIA 4MC3A 2Q58A 1KIZA 4KKMA 3TS7A 3LLWA 2E93A 1KIYA 3KRPB 4LZ0A 5B01A 2E8TA 3N3DA 5DGNF 3S4JA 4KQ5A 4PVYF 3VJCA 4KUXA 1UBXA 4NUAA 2F7MF 2F94F 4DEMF 3PYBA 1V4EA 5A0IA 2Q80A 2E95A 3DYFA 3Q2QA 3ZL6A 1YHLA 3WCFA 1V4IA 2OPMA 1YYUA 3WJNA 2OPNA 5JV2F 2QISA 3M00A 4KVYA 1ZW5A 3ZMCA 5DIQF 4KPDA 3Q2ZA 4H5DF 3LG5A 3V1VA 4KQSA 2PS4A 2EWGA 3EGTA 4Q23A 3N46F 3AQCB 1YYSA 1V4JA 3AE0A 3WCGA 4LPHF 1UBVA 4LOBA 2E8UA 3DYHA 4LUUA 3G4DA 2E4OA 3WCBA 4NKEA 1PS1A 3KRFB 1V4KA 4LFGA 3LMDA 3RYWA 2PS5A 4F6VA 2H8OA 5EATA 3N0GA 5B0MA 5AHUB 3ACYA 4KWDA 2ZCSA 4GP2A 5ERMA 3WSAA 4JZXA 3WCLA 3WCCA 3NF2A 3WSBA 5EROA 4OKMA 1VG6A 2F8CF 4E9UA 3ICKA 1JFGA 3WC9A 3OACB 2VF6A 5ILIA 3WEHA 4DZWA 4H5CF 4F62A 2E8WA 3OYRA 1DGPA 3N45F 3S9VA 2ZCQA 4QPFA 3APZA 3P41A 3Q30A 1HXCA 5EASA 2E92A 4KPJA 4LA5A 3WEGA 5IMIA 3P5RA 1WL0A 2E8VA 1JFAA 5JV1F 5HN9A 3TC1A 3OACA 3MZVA 1HXGA 1N22A 3PH7A 4LZ3A 3WCDA 5B02A 3CP6A 3NPRA 2F89F 2F92F 4GAXA 5DZ2A 1WL3A 1YYRA 2Z52A 4WK5A 3AQBB 2O1OA 1N1ZA 1N20A 4LTZA 4DXJA 4E9ZA 3LK5A 3P8RA 5E8LA 2AEKA 4ZQ8A 4LPGF 3B7LA 4XQSF 1WL2A 1YV5A 2PS6A 1YJ4A 2Z7IA 4XQTF 4LFVF 2Z7HA 4DWBA 3KROA 5A0JA 3VJ9A 2DH4A 3M01A 3WCIA 2F8ZF 3WCHA 1FPSA 1V4HA 3DYGA 3N0FA 3AQ0A 5B03A 5IK9A 3LDWA 3ZCDA 5ILHA 2Z4YA 3ZMBA 3N1WF 3ZOUA 2FTZA 5IMNA 4P0WA 4RXEA 4RNQA 5IL3A 2E94A 3VJAA 3BNYA 1WL1A 2P1CA 5EAUA 5B0LA 3WCJA 4KFAA 1HXAA 3MAVA 4LA6A 5ILJA 1HM7A 4LFEA 3RYEA 4NFIF 5ER8A 3TFVA 3CC9A 4K10A
chains in the Genus database with same CATH superfamily
3ADZA 3N1VF 3NRIA 5IL8A 4LLSA 4P0XA 4RXDA 1VG2A 2I19A 4OMGA 3WEFA 3QKCA 3ID0A 4KVIA 5C05A 3WE9A 4LZCA 5JV0F 3EZ3A 3UCAA 3KBKA 5IK0A 1HM4A 1HX9A 4KQUA 3LGKA 4UMJA 3WJKA 4P0VA 2J1OA 1N21A 5HN8A 3Q1OA 4DI5A 5B0KA 5DJVF 2OA6A 2PS7A 1UBWA 4L2XF 2AZJA 5ERNA 1UBYA 2Z4VA 5ILDA 3BNXA 4LIXA 3KRAB 2PS8A 5H9DA 5IVGA 5B0IA 5IN8A 3M02A 3N5JF 3N5HF 3P8LA 1DI1A 4JVJF 3LVSA 3WCEA 3ICZA 4GP1A 3N3LF 5DHIA 4EA0A 1RQIA 4GA3A 1WMWA 5AELA 4NFJF 3KRAA 5B00A 1VG4A 3KROB 2ZEVA 1VG7A 5ILKA 1YYQA 2Z4WA 3RMGA 5KSXF 3M0GA 2AELA 1N23A 4LXWA 2AETA 2RAHA 3P5PA 3W7FA 1WKZA 1EZFA 2ZCOA 3G4FA 4KVDA 4KK2A 4N9UA 2ONHA 4JYXA 3WCMA 5CG6A 2Z78A 2AZLA 4FP4A 3ACXA 5DJRF 2Q9ZA 5DHKA 2E91A 4QXSF 5A0KA 3LGZB 4HD1A 5I1UA 3LJIA 5JA0F 3V66A 3CKEA 3LZ9A 1VG3A 5ILYA 5DGSF 4DHDA 3LOMA 4JXNA 3OABB 1YHMA 2E8XA 3VJ8A 4F6XA 3N49F 4EA2A 4NG6A 4RXAA 3KB9A 5DJPF 3KRPA 3SDTA 3WEIA 1N24A 3VJDA 3V1XA 3ASXA 4LLTA 3SDRA 2J1PA 3OABA 3TFNA 4N1ZF 5E8KA 5DW7A 5AYPA 2Q9YA 4DWGA 4H5EF 3PDEA 4OGUA 3SDQA 5IMPA 4OKZA 3ACWA 4MC8A 3KRCB 3SDVA 3WJOA 5JUZF 4KVWA 2AZKA 5E8HA 2FORA 1YQ7A 3QQVA 1N1BA 5IKAA 3EFQA 5HN7A 2ZY1A 3WCAA 2OGDA 4E1EA 2Z4XA 3WEKA 3LEEA 4EA1A 1YYTA 3N6KF 4LTVA 3ICNA 3KRCA 2J5CA 1WY0A 4NKFA 3KRFA 5B0JA 4MC0A 3SAEA 4RXCA 1RQJA 5CG5A 3PYAA 2Z4ZA 2ZCRA 4FJQA 5IKHA 4NFKF 5IK6A 2ONGA 5HNAA 4OMHA 3NPKA 4JXYA 5ILZA 3M9UA 3PKOA 1YHKA 2F9KF 3TFPA 3VJBA 3IBAA 4XQRF 3ICMA 3RBMA 2ZEUA 3VJEA 3SDUA 2Z50A 5IM1A 4JZBA 4RYPA 4PVXF 5DGMF 1RTRA 3LSNA 2E90A 3WEJA 5AFXA 3IPIA 4MC3A 2Q58A 1KIZA 4KKMA 3TS7A 3LLWA 2E93A 1KIYA 3KRPB 4LZ0A 5B01A 2E8TA 3N3DA 5DGNF 3S4JA 4KQ5A 4PVYF 3VJCA 4KUXA 1UBXA 4NUAA 2F7MF 2F94F 4DEMF 3PYBA 1V4EA 5A0IA 2Q80A 2E95A 3DYFA 3Q2QA 3ZL6A 1YHLA 3WCFA 1V4IA 2OPMA 1YYUA 3WJNA 2OPNA 5JV2F 2QISA 3M00A 4KVYA 1ZW5A 3ZMCA 5DIQF 4KPDA 3Q2ZA 4H5DF 3LG5A 3V1VA 4KQSA 2PS4A 2EWGA 3EGTA 4Q23A 3N46F 3AQCB 1YYSA 1V4JA 3AE0A 3WCGA 4LPHF 1UBVA 4LOBA 2E8UA 3DYHA 4LUUA 3G4DA 2E4OA 3WCBA 4NKEA 1PS1A 3KRFB 1V4KA 4LFGA 3LMDA 3RYWA 2PS5A 4F6VA 2H8OA 5EATA 3N0GA 5B0MA 5AHUB 3ACYA 4KWDA 2ZCSA 4GP2A 5ERMA 3WSAA 4JZXA 3WCLA 3WCCA 3NF2A 3WSBA 5EROA 4OKMA 1VG6A 2F8CF 4E9UA 3ICKA 1JFGA 3WC9A 3OACB 2VF6A 5ILIA 3WEHA 4DZWA 4H5CF 4F62A 2E8WA 3OYRA 1DGPA 3N45F 3S9VA 2ZCQA 4QPFA 3APZA 3P41A 3Q30A 1HXCA 5EASA 2E92A 4KPJA 4LA5A 3WEGA 5IMIA 3P5RA 1WL0A 2E8VA 1JFAA 5JV1F 5HN9A 3TC1A 3OACA 3MZVA 1HXGA 1N22A 3PH7A 4LZ3A 3WCDA 5B02A 3CP6A 3NPRA 2F89F 2F92F 4GAXA 5DZ2A 1WL3A 1YYRA 2Z52A 4WK5A 3AQBB 2O1OA 1N1ZA 1N20A 4LTZA 4DXJA 4E9ZA 3LK5A 3P8RA 5E8LA 2AEKA 4ZQ8A 4LPGF 3B7LA 4XQSF 1WL2A 1YV5A 2PS6A 1YJ4A 2Z7IA 4XQTF 4LFVF 2Z7HA 4DWBA 3KROA 5A0JA 3VJ9A 2DH4A 3M01A 3WCIA 2F8ZF 3WCHA 1FPSA 1V4HA 3DYGA 3N0FA 3AQ0A 5B03A 5IK9A 3LDWA 3ZCDA 5ILHA 2Z4YA 3ZMBA 3N1WF 3ZOUA 2FTZA 5IMNA 4P0WA 4RXEA 4RNQA 5IL3A 2E94A 3VJAA 3BNYA 1WL1A 2P1CA 5EAUA 5B0LA 3WCJA 4KFAA 1HXAA 3MAVA 4LA6A 5ILJA 1HM7A 4LFEA 3RYEA 4NFIF 5ER8A 3TFVA 3CC9A 4K10A
chains in the Genus database with same CATH topology
3ADZA 3N1VF 3NRIA 5IL8A 4LLSA 4P0XA 4RXDA 1VG2A 2I19A 4OMGA 3WEFA 3QKCA 3ID0A 4KVIA 5C05A 3WE9A 4LZCA 5JV0F 3EZ3A 3UCAA 3KBKA 5IK0A 1HM4A 1HX9A 4KQUA 3LGKA 4UMJA 3WJKA 4P0VA 2J1OA 1N21A 5HN8A 3Q1OA 4DI5A 5B0KA 5DJVF 2OA6A 2PS7A 1UBWA 4L2XF 2AZJA 5ERNA 1UBYA 2Z4VA 5ILDA 3BNXA 4LIXA 3KRAB 2PS8A 5H9DA 5IVGA 5B0IA 5IN8A 3M02A 3N5JF 3N5HF 3P8LA 1DI1A 4JVJF 3LVSA 3WCEA 3ICZA 4GP1A 3N3LF 5DHIA 4EA0A 1RQIA 4GA3A 1WMWA 5AELA 4NFJF 3KRAA 5B00A 1VG4A 3KROB 2ZEVA 1VG7A 5ILKA 1YYQA 2Z4WA 3RMGA 5KSXF 3M0GA 2AELA 1N23A 4LXWA 2AETA 2RAHA 3P5PA 3W7FA 1WKZA 1EZFA 2ZCOA 3G4FA 4KVDA 4KK2A 4N9UA 2ONHA 4JYXA 3WCMA 5CG6A 2Z78A 2AZLA 4FP4A 3ACXA 5DJRF 2Q9ZA 5DHKA 2E91A 4QXSF 5A0KA 3LGZB 4HD1A 5I1UA 3LJIA 5JA0F 3V66A 3CKEA 3LZ9A 1VG3A 5ILYA 5DGSF 4DHDA 3LOMA 4JXNA 3OABB 1YHMA 2E8XA 3VJ8A 4F6XA 3N49F 4EA2A 4NG6A 4RXAA 3KB9A 5DJPF 3KRPA 3SDTA 3WEIA 1N24A 3VJDA 3V1XA 3ASXA 4LLTA 3SDRA 2J1PA 3OABA 3TFNA 4N1ZF 5E8KA 5DW7A 5AYPA 2Q9YA 4DWGA 4H5EF 3PDEA 4OGUA 3SDQA 5IMPA 4OKZA 3ACWA 4MC8A 3KRCB 3SDVA 3WJOA 5JUZF 4KVWA 2AZKA 5E8HA 2FORA 1YQ7A 3QQVA 1N1BA 5IKAA 3EFQA 5HN7A 2ZY1A 3WCAA 2OGDA 4E1EA 2Z4XA 3WEKA 3LEEA 4EA1A 1YYTA 3N6KF 4LTVA 3ICNA 3KRCA 2J5CA 1WY0A 4NKFA 3KRFA 5B0JA 4MC0A 3SAEA 4RXCA 1RQJA 5CG5A 3PYAA 2Z4ZA 2ZCRA 4FJQA 5IKHA 4NFKF 5IK6A 2ONGA 5HNAA 4OMHA 3NPKA 4JXYA 5ILZA 3M9UA 3PKOA 1YHKA 2F9KF 3TFPA 3VJBA 3IBAA 4XQRF 3ICMA 3RBMA 2ZEUA 3VJEA 3SDUA 2Z50A 5IM1A 4JZBA 4RYPA 4PVXF 5DGMF 1RTRA 3LSNA 2E90A 3WEJA 5AFXA 3IPIA 4MC3A 2Q58A 1KIZA 4KKMA 3TS7A 3LLWA 2E93A 1KIYA 3KRPB 4LZ0A 5B01A 2E8TA 3N3DA 5DGNF 3S4JA 4KQ5A 4PVYF 3VJCA 4KUXA 1UBXA 4NUAA 2F7MF 2F94F 4DEMF 3PYBA 1V4EA 5A0IA 2Q80A 2E95A 3DYFA 3Q2QA 3ZL6A 1YHLA 3WCFA 1V4IA 2OPMA 1YYUA 3WJNA 2OPNA 5JV2F 2QISA 3M00A 4KVYA 1ZW5A 3ZMCA 5DIQF 4KPDA 3Q2ZA 4H5DF 3LG5A 3V1VA 4KQSA 2PS4A 2EWGA 3EGTA 4Q23A 3N46F 3AQCB 1YYSA 1V4JA 3AE0A 3WCGA 4LPHF 1UBVA 4LOBA 2E8UA 3DYHA 4LUUA 3G4DA 2E4OA 3WCBA 4NKEA 1PS1A 3KRFB 1V4KA 4LFGA 3LMDA 3RYWA 2PS5A 4F6VA 2H8OA 5EATA 3N0GA 5B0MA 5AHUB 3ACYA 4KWDA 2ZCSA 4GP2A 5ERMA 3WSAA 4JZXA 3WCLA 3WCCA 3NF2A 3WSBA 5EROA 4OKMA 1VG6A 2F8CF 4E9UA 3ICKA 1JFGA 3WC9A 3OACB 2VF6A 5ILIA 3WEHA 4DZWA 4H5CF 4F62A 2E8WA 3OYRA 1DGPA 3N45F 3S9VA 2ZCQA 4QPFA 3APZA 3P41A 3Q30A 1HXCA 5EASA 2E92A 4KPJA 4LA5A 3WEGA 5IMIA 3P5RA 1WL0A 2E8VA 1JFAA 5JV1F 5HN9A 3TC1A 3OACA 3MZVA 1HXGA 1N22A 3PH7A 4LZ3A 3WCDA 5B02A 3CP6A 3NPRA 2F89F 2F92F 4GAXA 5DZ2A 1WL3A 1YYRA 2Z52A 4WK5A 3AQBB 2O1OA 1N1ZA 1N20A 4LTZA 4DXJA 4E9ZA 3LK5A 3P8RA 5E8LA 2AEKA 4ZQ8A 4LPGF 3B7LA 4XQSF 1WL2A 1YV5A 2PS6A 1YJ4A 2Z7IA 4XQTF 4LFVF 2Z7HA 4DWBA 3KROA 5A0JA 3VJ9A 2DH4A 3M01A 3WCIA 2F8ZF 3WCHA 1FPSA 1V4HA 3DYGA 3N0FA 3AQ0A 5B03A 5IK9A 3LDWA 3ZCDA 5ILHA 2Z4YA 3ZMBA 3N1WF 3ZOUA 2FTZA 5IMNA 4P0WA 4RXEA 4RNQA 5IL3A 2E94A 3VJAA 3BNYA 1WL1A 2P1CA 5EAUA 5B0LA 3WCJA 4KFAA 1HXAA 3MAVA 4LA6A 5ILJA 1HM7A 4LFEA 3RYEA 4NFIF 5ER8A 3TFVA 3CC9A 4K10A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ADZ A;  3N1V F;  3NRI A;  5IL8 A;  4LLS A;  4P0X A;  4RXD A;  1VG2 A;  2I19 A;  4OMG A;  3WEF A;  3QKC A;  3ID0 A;  4KVI A;  5C05 A;  3WE9 A;  4LZC A;  5JV0 F;  3EZ3 A;  3UCA A;  3KBK A;  5IK0 A;  1HM4 A;  1HX9 A;  4KQU A;  3LGK A;  4UMJ A;  3WJK A;  4P0V A;  2J1O A;  1N21 A;  5HN8 A;  3Q1O A;  4DI5 A;  5B0K A;  5DJV F;  2OA6 A;  2PS7 A;  1UBW A;  4L2X F;  2AZJ A;  5ERN A;  1UBY A;  2Z4V A;  5ILD A;  3BNX A;  4LIX A;  3KRA B;  2PS8 A;  5H9D A;  5IVG A;  5B0I A;  5IN8 A;  3M02 A;  3N5J F;  3N5H F;  3P8L A;  1DI1 A;  4JVJ F;  3LVS A;  3WCE A;  3ICZ A;  4GP1 A;  3N3L F;  5DHI A;  4EA0 A;  1RQI A;  4GA3 A;  1WMW A;  5AEL A;  4NFJ F;  3KRA A;  5B00 A;  1VG4 A;  3KRO B;  2ZEV A;  1VG7 A;  5ILK A;  1YYQ A;  2Z4W A;  3RMG A;  5KSX F;  3M0G A;  2AEL A;  1N23 A;  4LXW A;  2AET A;  2RAH A;  3P5P A;  3W7F A;  1WKZ A;  1EZF A;  2ZCO A;  3G4F A;  4KVD A;  4KK2 A;  4N9U A;  2ONH A;  4JYX A;  3WCM A;  5CG6 A;  2Z78 A;  2AZL A;  4FP4 A;  3ACX A;  5DJR F;  2Q9Z A;  5DHK A;  2E91 A;  4QXS F;  5A0K A;  3LGZ B;  4HD1 A;  5I1U A;  3LJI A;  5JA0 F;  3V66 A;  3CKE A;  3LZ9 A;  1VG3 A;  5ILY A;  5DGS F;  4DHD A;  3LOM A;  4JXN A;  3OAB B;  1YHM A;  2E8X A;  3VJ8 A;  4F6X A;  3N49 F;  4EA2 A;  4NG6 A;  4RXA A;  3KB9 A;  5DJP F;  3KRP A;  3SDT A;  3WEI A;  1N24 A;  3VJD A;  3V1X A;  3ASX A;  4LLT A;  3SDR A;  2J1P A;  3OAB A;  3TFN A;  4N1Z F;  5E8K A;  5DW7 A;  5AYP A;  2Q9Y A;  4DWG A;  4H5E F;  3PDE A;  4OGU A;  3SDQ A;  5IMP A;  4OKZ A;  3ACW A;  4MC8 A;  3KRC B;  3SDV A;  3WJO A;  5JUZ F;  4KVW A;  2AZK A;  5E8H A;  2FOR A;  1YQ7 A;  3QQV A;  1N1B A;  5IKA A;  3EFQ A;  5HN7 A;  2ZY1 A;  3WCA A;  2OGD A;  4E1E A;  2Z4X A;  3WEK A;  3LEE A;  4EA1 A;  1YYT A;  3N6K F;  4LTV A;  3ICN A;  3KRC A;  2J5C A;  1WY0 A;  4NKF A;  3KRF A;  5B0J A;  4MC0 A;  3SAE A;  4RXC A;  1RQJ A;  5CG5 A;  3PYA A;  2Z4Z A;  2ZCR A;  4FJQ A;  5IKH A;  4NFK F;  5IK6 A;  2ONG A;  5HNA A;  4OMH A;  3NPK A;  4JXY A;  5ILZ A;  3M9U A;  3PKO A;  1YHK A;  2F9K F;  3TFP A;  3VJB A;  3IBA A;  4XQR F;  3ICM A;  3RBM A;  2ZEU A;  3VJE A;  3SDU A;  2Z50 A;  5IM1 A;  4JZB A;  4RYP A;  4PVX F;  5DGM F;  1RTR A;  3LSN A;  2E90 A;  3WEJ A;  5AFX A;  3IPI A;  4MC3 A;  2Q58 A;  1KIZ A;  4KKM A;  3TS7 A;  3LLW A;  2E93 A;  1KIY A;  3KRP B;  4LZ0 A;  5B01 A;  2E8T A;  3N3D A;  5DGN F;  3S4J A;  4KQ5 A;  4PVY F;  3VJC A;  4KUX A;  1UBX A;  4NUA A;  2F7M F;  2F94 F;  4DEM F;  3PYB A;  1V4E A;  5A0I A;  2Q80 A;  2E95 A;  3DYF A;  3Q2Q A;  3ZL6 A;  1YHL A;  3WCF A;  1V4I A;  2OPM A;  1YYU A;  3WJN A;  2OPN A;  5JV2 F;  2QIS A;  3M00 A;  4KVY A;  1ZW5 A;  3ZMC A;  5DIQ F;  4KPD A;  3Q2Z A;  4H5D F;  3LG5 A;  3V1V A;  4KQS A;  2PS4 A;  2EWG A;  3EGT A;  4Q23 A;  3N46 F;  3AQC B;  1YYS A;  1V4J A;  3AE0 A;  3WCG A;  4LPH F;  1UBV A;  4LOB A;  2E8U A;  3DYH A;  4LUU A;  3G4D A;  2E4O A;  3WCB A;  4NKE A;  1PS1 A;  3KRF B;  1V4K A;  4LFG A;  3LMD A;  3RYW A;  2PS5 A;  4F6V A;  2H8O A;  5EAT A;  3N0G A;  5B0M A;  5AHU B;  3ACY A;  4KWD A;  2ZCS A;  4GP2 A;  5ERM A;  3WSA A;  4JZX A;  3WCL A;  3WCC A;  3NF2 A;  3WSB A;  5ERO A;  4OKM A;  1VG6 A;  2F8C F;  4E9U A;  3ICK A;  1JFG A;  3WC9 A;  3OAC B;  2VF6 A;  5ILI A;  3WEH A;  4DZW A;  4H5C F;  4F62 A;  2E8W A;  3OYR A;  1DGP A;  3N45 F;  3S9V A;  2ZCQ A;  4QPF A;  3APZ A;  3P41 A;  3Q30 A;  1HXC A;  5EAS A;  2E92 A;  4KPJ A;  4LA5 A;  3WEG A;  5IMI A;  3P5R A;  1WL0 A;  2E8V A;  1JFA A;  5JV1 F;  5HN9 A;  3TC1 A;  3OAC A;  3MZV A;  1HXG A;  1N22 A;  3PH7 A;  4LZ3 A;  3WCD A;  5B02 A;  3CP6 A;  3NPR A;  2F89 F;  2F92 F;  4GAX A;  5DZ2 A;  1WL3 A;  1YYR A;  2Z52 A;  4WK5 A;  3AQB B;  2O1O A;  1N1Z A;  1N20 A;  4LTZ A;  4DXJ A;  4E9Z A;  3LK5 A;  3P8R A;  5E8L A;  2AEK A;  4ZQ8 A;  4LPG F;  3B7L A;  4XQS F;  1WL2 A;  1YV5 A;  2PS6 A;  1YJ4 A;  2Z7I A;  4XQT F;  4LFV F;  2Z7H A;  4DWB A;  3KRO A;  5A0J A;  3VJ9 A;  2DH4 A;  3M01 A;  3WCI A;  2F8Z F;  3WCH A;  1FPS A;  1V4H A;  3DYG A;  3N0F A;  3AQ0 A;  5B03 A;  5IK9 A;  3LDW A;  3ZCD A;  5ILH A;  2Z4Y A;  3ZMB A;  3N1W F;  3ZOU A;  2FTZ A;  5IMN A;  4P0W A;  4RXE A;  4RNQ A;  5IL3 A;  2E94 A;  3VJA A;  3BNY A;  1WL1 A;  2P1C A;  5EAU A;  5B0L A;  3WCJ A;  4KFA A;  1HXA A;  3MAV A;  4LA6 A;  5ILJ A;  1HM7 A;  4LFE A;  3RYE A;  4NFI F;  5ER8 A;  3TFV A;  3CC9 A;  4K10 A; 
#chains in the Genus database with same CATH topology
 3ADZ A;  3N1V F;  3NRI A;  5IL8 A;  4LLS A;  4P0X A;  4RXD A;  1VG2 A;  2I19 A;  4OMG A;  3WEF A;  3QKC A;  3ID0 A;  4KVI A;  5C05 A;  3WE9 A;  4LZC A;  5JV0 F;  3EZ3 A;  3UCA A;  3KBK A;  5IK0 A;  1HM4 A;  1HX9 A;  4KQU A;  3LGK A;  4UMJ A;  3WJK A;  4P0V A;  2J1O A;  1N21 A;  5HN8 A;  3Q1O A;  4DI5 A;  5B0K A;  5DJV F;  2OA6 A;  2PS7 A;  1UBW A;  4L2X F;  2AZJ A;  5ERN A;  1UBY A;  2Z4V A;  5ILD A;  3BNX A;  4LIX A;  3KRA B;  2PS8 A;  5H9D A;  5IVG A;  5B0I A;  5IN8 A;  3M02 A;  3N5J F;  3N5H F;  3P8L A;  1DI1 A;  4JVJ F;  3LVS A;  3WCE A;  3ICZ A;  4GP1 A;  3N3L F;  5DHI A;  4EA0 A;  1RQI A;  4GA3 A;  1WMW A;  5AEL A;  4NFJ F;  3KRA A;  5B00 A;  1VG4 A;  3KRO B;  2ZEV A;  1VG7 A;  5ILK A;  1YYQ A;  2Z4W A;  3RMG A;  5KSX F;  3M0G A;  2AEL A;  1N23 A;  4LXW A;  2AET A;  2RAH A;  3P5P A;  3W7F A;  1WKZ A;  1EZF A;  2ZCO A;  3G4F A;  4KVD A;  4KK2 A;  4N9U A;  2ONH A;  4JYX A;  3WCM A;  5CG6 A;  2Z78 A;  2AZL A;  4FP4 A;  3ACX A;  5DJR F;  2Q9Z A;  5DHK A;  2E91 A;  4QXS F;  5A0K A;  3LGZ B;  4HD1 A;  5I1U A;  3LJI A;  5JA0 F;  3V66 A;  3CKE A;  3LZ9 A;  1VG3 A;  5ILY A;  5DGS F;  4DHD A;  3LOM A;  4JXN A;  3OAB B;  1YHM A;  2E8X A;  3VJ8 A;  4F6X A;  3N49 F;  4EA2 A;  4NG6 A;  4RXA A;  3KB9 A;  5DJP F;  3KRP A;  3SDT A;  3WEI A;  1N24 A;  3VJD A;  3V1X A;  3ASX A;  4LLT A;  3SDR A;  2J1P A;  3OAB A;  3TFN A;  4N1Z F;  5E8K A;  5DW7 A;  5AYP A;  2Q9Y A;  4DWG A;  4H5E F;  3PDE A;  4OGU A;  3SDQ A;  5IMP A;  4OKZ A;  3ACW A;  4MC8 A;  3KRC B;  3SDV A;  3WJO A;  5JUZ F;  4KVW A;  2AZK A;  5E8H A;  2FOR A;  1YQ7 A;  3QQV A;  1N1B A;  5IKA A;  3EFQ A;  5HN7 A;  2ZY1 A;  3WCA A;  2OGD A;  4E1E A;  2Z4X A;  3WEK A;  3LEE A;  4EA1 A;  1YYT A;  3N6K F;  4LTV A;  3ICN A;  3KRC A;  2J5C A;  1WY0 A;  4NKF A;  3KRF A;  5B0J A;  4MC0 A;  3SAE A;  4RXC A;  1RQJ A;  5CG5 A;  3PYA A;  2Z4Z A;  2ZCR A;  4FJQ A;  5IKH A;  4NFK F;  5IK6 A;  2ONG A;  5HNA A;  4OMH A;  3NPK A;  4JXY A;  5ILZ A;  3M9U A;  3PKO A;  1YHK A;  2F9K F;  3TFP A;  3VJB A;  3IBA A;  4XQR F;  3ICM A;  3RBM A;  2ZEU A;  3VJE A;  3SDU A;  2Z50 A;  5IM1 A;  4JZB A;  4RYP A;  4PVX F;  5DGM F;  1RTR A;  3LSN A;  2E90 A;  3WEJ A;  5AFX A;  3IPI A;  4MC3 A;  2Q58 A;  1KIZ A;  4KKM A;  3TS7 A;  3LLW A;  2E93 A;  1KIY A;  3KRP B;  4LZ0 A;  5B01 A;  2E8T A;  3N3D A;  5DGN F;  3S4J A;  4KQ5 A;  4PVY F;  3VJC A;  4KUX A;  1UBX A;  4NUA A;  2F7M F;  2F94 F;  4DEM F;  3PYB A;  1V4E A;  5A0I A;  2Q80 A;  2E95 A;  3DYF A;  3Q2Q A;  3ZL6 A;  1YHL A;  3WCF A;  1V4I A;  2OPM A;  1YYU A;  3WJN A;  2OPN A;  5JV2 F;  2QIS A;  3M00 A;  4KVY A;  1ZW5 A;  3ZMC A;  5DIQ F;  4KPD A;  3Q2Z A;  4H5D F;  3LG5 A;  3V1V A;  4KQS A;  2PS4 A;  2EWG A;  3EGT A;  4Q23 A;  3N46 F;  3AQC B;  1YYS A;  1V4J A;  3AE0 A;  3WCG A;  4LPH F;  1UBV A;  4LOB A;  2E8U A;  3DYH A;  4LUU A;  3G4D A;  2E4O A;  3WCB A;  4NKE A;  1PS1 A;  3KRF B;  1V4K A;  4LFG A;  3LMD A;  3RYW A;  2PS5 A;  4F6V A;  2H8O A;  5EAT A;  3N0G A;  5B0M A;  5AHU B;  3ACY A;  4KWD A;  2ZCS A;  4GP2 A;  5ERM A;  3WSA A;  4JZX A;  3WCL A;  3WCC A;  3NF2 A;  3WSB A;  5ERO A;  4OKM A;  1VG6 A;  2F8C F;  4E9U A;  3ICK A;  1JFG A;  3WC9 A;  3OAC B;  2VF6 A;  5ILI A;  3WEH A;  4DZW A;  4H5C F;  4F62 A;  2E8W A;  3OYR A;  1DGP A;  3N45 F;  3S9V A;  2ZCQ A;  4QPF A;  3APZ A;  3P41 A;  3Q30 A;  1HXC A;  5EAS A;  2E92 A;  4KPJ A;  4LA5 A;  3WEG A;  5IMI A;  3P5R A;  1WL0 A;  2E8V A;  1JFA A;  5JV1 F;  5HN9 A;  3TC1 A;  3OAC A;  3MZV A;  1HXG A;  1N22 A;  3PH7 A;  4LZ3 A;  3WCD A;  5B02 A;  3CP6 A;  3NPR A;  2F89 F;  2F92 F;  4GAX A;  5DZ2 A;  1WL3 A;  1YYR A;  2Z52 A;  4WK5 A;  3AQB B;  2O1O A;  1N1Z A;  1N20 A;  4LTZ A;  4DXJ A;  4E9Z A;  3LK5 A;  3P8R A;  5E8L A;  2AEK A;  4ZQ8 A;  4LPG F;  3B7L A;  4XQS F;  1WL2 A;  1YV5 A;  2PS6 A;  1YJ4 A;  2Z7I A;  4XQT F;  4LFV F;  2Z7H A;  4DWB A;  3KRO A;  5A0J A;  3VJ9 A;  2DH4 A;  3M01 A;  3WCI A;  2F8Z F;  3WCH A;  1FPS A;  1V4H A;  3DYG A;  3N0F A;  3AQ0 A;  5B03 A;  5IK9 A;  3LDW A;  3ZCD A;  5ILH A;  2Z4Y A;  3ZMB A;  3N1W F;  3ZOU A;  2FTZ A;  5IMN A;  4P0W A;  4RXE A;  4RNQ A;  5IL3 A;  2E94 A;  3VJA A;  3BNY A;  1WL1 A;  2P1C A;  5EAU A;  5B0L A;  3WCJ A;  4KFA A;  1HXA A;  3MAV A;  4LA6 A;  5ILJ A;  1HM7 A;  4LFE A;  3RYE A;  4NFI F;  5ER8 A;  3TFV A;  3CC9 A;  4K10 A; 
#chains in the Genus database with same CATH homology
 3ADZ A;  3N1V F;  3NRI A;  5IL8 A;  4LLS A;  4P0X A;  4RXD A;  1VG2 A;  2I19 A;  4OMG A;  3WEF A;  3QKC A;  3ID0 A;  4KVI A;  5C05 A;  3WE9 A;  4LZC A;  5JV0 F;  3EZ3 A;  3UCA A;  3KBK A;  5IK0 A;  1HM4 A;  1HX9 A;  4KQU A;  3LGK A;  4UMJ A;  3WJK A;  4P0V A;  2J1O A;  1N21 A;  5HN8 A;  3Q1O A;  4DI5 A;  5B0K A;  5DJV F;  2OA6 A;  2PS7 A;  1UBW A;  4L2X F;  2AZJ A;  5ERN A;  1UBY A;  2Z4V A;  5ILD A;  3BNX A;  4LIX A;  3KRA B;  2PS8 A;  5H9D A;  5IVG A;  5B0I A;  5IN8 A;  3M02 A;  3N5J F;  3N5H F;  3P8L A;  1DI1 A;  4JVJ F;  3LVS A;  3WCE A;  3ICZ A;  4GP1 A;  3N3L F;  5DHI A;  4EA0 A;  1RQI A;  4GA3 A;  1WMW A;  5AEL A;  4NFJ F;  3KRA A;  5B00 A;  1VG4 A;  3KRO B;  2ZEV A;  1VG7 A;  5ILK A;  1YYQ A;  2Z4W A;  3RMG A;  5KSX F;  3M0G A;  2AEL A;  1N23 A;  4LXW A;  2AET A;  2RAH A;  3P5P A;  3W7F A;  1WKZ A;  1EZF A;  2ZCO A;  3G4F A;  4KVD A;  4KK2 A;  4N9U A;  2ONH A;  4JYX A;  3WCM A;  5CG6 A;  2Z78 A;  2AZL A;  4FP4 A;  3ACX A;  5DJR F;  2Q9Z A;  5DHK A;  2E91 A;  4QXS F;  5A0K A;  3LGZ B;  4HD1 A;  5I1U A;  3LJI A;  5JA0 F;  3V66 A;  3CKE A;  3LZ9 A;  1VG3 A;  5ILY A;  5DGS F;  4DHD A;  3LOM A;  4JXN A;  3OAB B;  1YHM A;  2E8X A;  3VJ8 A;  4F6X A;  3N49 F;  4EA2 A;  4NG6 A;  4RXA A;  3KB9 A;  5DJP F;  3KRP A;  3SDT A;  3WEI A;  1N24 A;  3VJD A;  3V1X A;  3ASX A;  4LLT A;  3SDR A;  2J1P A;  3OAB A;  3TFN A;  4N1Z F;  5E8K A;  5DW7 A;  5AYP A;  2Q9Y A;  4DWG A;  4H5E F;  3PDE A;  4OGU A;  3SDQ A;  5IMP A;  4OKZ A;  3ACW A;  4MC8 A;  3KRC B;  3SDV A;  3WJO A;  5JUZ F;  4KVW A;  2AZK A;  5E8H A;  2FOR A;  1YQ7 A;  3QQV A;  1N1B A;  5IKA A;  3EFQ A;  5HN7 A;  2ZY1 A;  3WCA A;  2OGD A;  4E1E A;  2Z4X A;  3WEK A;  3LEE A;  4EA1 A;  1YYT A;  3N6K F;  4LTV A;  3ICN A;  3KRC A;  2J5C A;  1WY0 A;  4NKF A;  3KRF A;  5B0J A;  4MC0 A;  3SAE A;  4RXC A;  1RQJ A;  5CG5 A;  3PYA A;  2Z4Z A;  2ZCR A;  4FJQ A;  5IKH A;  4NFK F;  5IK6 A;  2ONG A;  5HNA A;  4OMH A;  3NPK A;  4JXY A;  5ILZ A;  3M9U A;  3PKO A;  1YHK A;  2F9K F;  3TFP A;  3VJB A;  3IBA A;  4XQR F;  3ICM A;  3RBM A;  2ZEU A;  3VJE A;  3SDU A;  2Z50 A;  5IM1 A;  4JZB A;  4RYP A;  4PVX F;  5DGM F;  1RTR A;  3LSN A;  2E90 A;  3WEJ A;  5AFX A;  3IPI A;  4MC3 A;  2Q58 A;  1KIZ A;  4KKM A;  3TS7 A;  3LLW A;  2E93 A;  1KIY A;  3KRP B;  4LZ0 A;  5B01 A;  2E8T A;  3N3D A;  5DGN F;  3S4J A;  4KQ5 A;  4PVY F;  3VJC A;  4KUX A;  1UBX A;  4NUA A;  2F7M F;  2F94 F;  4DEM F;  3PYB A;  1V4E A;  5A0I A;  2Q80 A;  2E95 A;  3DYF A;  3Q2Q A;  3ZL6 A;  1YHL A;  3WCF A;  1V4I A;  2OPM A;  1YYU A;  3WJN A;  2OPN A;  5JV2 F;  2QIS A;  3M00 A;  4KVY A;  1ZW5 A;  3ZMC A;  5DIQ F;  4KPD A;  3Q2Z A;  4H5D F;  3LG5 A;  3V1V A;  4KQS A;  2PS4 A;  2EWG A;  3EGT A;  4Q23 A;  3N46 F;  3AQC B;  1YYS A;  1V4J A;  3AE0 A;  3WCG A;  4LPH F;  1UBV A;  4LOB A;  2E8U A;  3DYH A;  4LUU A;  3G4D A;  2E4O A;  3WCB A;  4NKE A;  1PS1 A;  3KRF B;  1V4K A;  4LFG A;  3LMD A;  3RYW A;  2PS5 A;  4F6V A;  2H8O A;  5EAT A;  3N0G A;  5B0M A;  5AHU B;  3ACY A;  4KWD A;  2ZCS A;  4GP2 A;  5ERM A;  3WSA A;  4JZX A;  3WCL A;  3WCC A;  3NF2 A;  3WSB A;  5ERO A;  4OKM A;  1VG6 A;  2F8C F;  4E9U A;  3ICK A;  1JFG A;  3WC9 A;  3OAC B;  2VF6 A;  5ILI A;  3WEH A;  4DZW A;  4H5C F;  4F62 A;  2E8W A;  3OYR A;  1DGP A;  3N45 F;  3S9V A;  2ZCQ A;  4QPF A;  3APZ A;  3P41 A;  3Q30 A;  1HXC A;  5EAS A;  2E92 A;  4KPJ A;  4LA5 A;  3WEG A;  5IMI A;  3P5R A;  1WL0 A;  2E8V A;  1JFA A;  5JV1 F;  5HN9 A;  3TC1 A;  3OAC A;  3MZV A;  1HXG A;  1N22 A;  3PH7 A;  4LZ3 A;  3WCD A;  5B02 A;  3CP6 A;  3NPR A;  2F89 F;  2F92 F;  4GAX A;  5DZ2 A;  1WL3 A;  1YYR A;  2Z52 A;  4WK5 A;  3AQB B;  2O1O A;  1N1Z A;  1N20 A;  4LTZ A;  4DXJ A;  4E9Z A;  3LK5 A;  3P8R A;  5E8L A;  2AEK A;  4ZQ8 A;  4LPG F;  3B7L A;  4XQS F;  1WL2 A;  1YV5 A;  2PS6 A;  1YJ4 A;  2Z7I A;  4XQT F;  4LFV F;  2Z7H A;  4DWB A;  3KRO A;  5A0J A;  3VJ9 A;  2DH4 A;  3M01 A;  3WCI A;  2F8Z F;  3WCH A;  1FPS A;  1V4H A;  3DYG A;  3N0F A;  3AQ0 A;  5B03 A;  5IK9 A;  3LDW A;  3ZCD A;  5ILH A;  2Z4Y A;  3ZMB A;  3N1W F;  3ZOU A;  2FTZ A;  5IMN A;  4P0W A;  4RXE A;  4RNQ A;  5IL3 A;  2E94 A;  3VJA A;  3BNY A;  1WL1 A;  2P1C A;  5EAU A;  5B0L A;  3WCJ A;  4KFA A;  1HXA A;  3MAV A;  4LA6 A;  5ILJ A;  1HM7 A;  4LFE A;  3RYE A;  4NFI F;  5ER8 A;  3TFV A;  3CC9 A;  4K10 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...