3PDEA

Crystal structure of geranylgeranyl pyrophosphate synthase from lactobacillus brevis atcc 367 complexed with isoprenyl diphosphate and magnesium
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
300
structure length
289
Chain Sequence
SLINARLIAFEDQWVPALNAPLKQAILADSQDAQLAAAMTYSVLAGGKRLRPLLTVATMQSLGVTFVPERHWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAGDGLLTLAFQWLTATDLPATMQAALVQALATAAGPSGMVAGQAKDIQSEHVNLPLSQLRVLHKEKTGALLHYAVQAGLILGQAPEAQWPAYLQFADAFGLAFQIYDDILDVVSSADEAKNTYPGKLGLIGANQALIDTIHSGQAALQGLPTSTQRDDLAAFFSYFDTERVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl-diphosphate synthase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Lactobacillus brevis
total genus 114
structure length 289
sequence length 300
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3pdeA00
1JFGA 2Z78A 4LZ0A 3ACXA 5DJRF 3TS7A 4F62A 3N5HF 5HNAA 4RXDA 3VJ9A 3ACWA 3ACYA 2F9KF 4KPJA 4E9UA 2PS4A 4K10A 3W7FA 5JV0F 1WL0A 3NPKA 2EWGA 5ER8A 2Z4XA 3SDRA 3V1VA 5AELA 5ERMA 5DGNF 2OA6A 2E8TA 1N21A 2H8OA 3ZCDA 2F89F 3KRPA 3VJEA 3KRPB 4KK2A 2FORA 3WEKA 5H9DA 4JZBA 2ZEVA 4LA6A 3VJAA 5CG6A 4DWGA 3LZ9A 1RQJA 5E8HA 3PYAA 3ASXA 3TFNA 3WCCA 3N3DA 2P1CA 4LLTA 2ZEUA 3ICMA 3LDWA 4MC8A 5IKAA 1N20A 3VJDA 4P0WA 4KQUA 3CKEA 1V4JA 3LGKA 4RYPA 3ZOUA 2AZLA 1FPSA 2O1OA 3Q1OA 5DGSF 2AZJA 1V4IA 2AELA 3KRFA 1YHKA 3KRFB 3N6KF 1WL2A 4PVYF 2Z4ZA 5IM1A 3OACB 1N23A 4WK5A 3LJIA 3MZVA 1EZFA 4KFAA 1UBXA 4KVIA 1VG2A 1YJ4A 5IK0A 3SDTA 3ADZA 3KRAA 4F6VA 4LZ3A 3KRAB 3LK5A 2Z50A 3QQVA 5ERNA 3WJNA 5B00A 3P8RA 3LMDA 1YV5A 4LTVA 4GA3A 4H5CF 3N1VF 1HXAA 1YYUA 4NFIF 2PS6A 1YYRA 4LIXA 3N0FA 4MC0A 4OGUA 5B0JA 3VJ8A 2ONHA 3WCDA 1HM4A 3CP6A 5E8KA 3V66A 2I19A 3RYEA 3LOMA 4LUUA 2F8ZF 3BNXA 3PH7A 3Q2QA 2PS8A 2ZCOA 2Z7IA 1VG6A 5DZ2A 2RAHA 2Z4YA 2E8XA 3N5JF 4RXCA 4EA2A 3WEGA 1N1ZA 1HX9A 2Z7HA 3S4JA 3RMGA 5IK9A 3KRCA 3EZ3A 3KRCB 5DIQF 1HM7A 3P41A 5ILYA 4JXYA 3M02A 4KQSA 5IK6A 4KVYA 4OKMA 3V1XA 4LZCA 5ILHA 4LFVF 3WCJA 1YYSA 2J5CA 5DW7A 1WL1A 4LA5A 3LLWA 2E95A 4LPHF 4PVXF 3ZMBA 5JV1F 4LOBA 4JYXA 2Q9ZA 5B02A 5JV2F 1YYTA 3M0GA 5ILKA 5C05A 4KWDA 1YQ7A 1RQIA 2DH4A 1HXCA 3LSNA 2E93A 2OGDA 3TFPA 1VG4A 3LG5A 4XQTF 4UMJA 2E94A 2ZCSA 4EA1A 5KSXF 1N24A 3AQBB 3N3LF 1JFAA 4KVWA 3RBMA 2J1OA 5HN8A 3ZMCA 4NFJF 3AQ0A 3WCMA 4N1ZF 4H5EF 5AYPA 5A0KA 3WJKA 3OACA 3P5PA 5DJPF 5B01A 2ZY1A 5B0MA 5JUZF 3S9VA 5IVGA 4QXSF 3Q2ZA 2PS5A 3B7LA 3KROA 4QPFA 3KROB 2QISA 2F94F 3SDVA 3WEIA 2F7MF 1V4KA 4NUAA 3APZA 3MAVA 3IPIA 5ILZA 1KIZA 5IMPA 4OKZA 4Q23A 3WEFA 2ZCRA 4L2XF 4RNQA 3WE9A 3G4DA 3CC9A 4LFEA 3VJCA 3SAEA 4JVJF 4KVDA 2Q80A 4NKEA 4NFKF 3WSAA 3ZL6A 4MC3A 3OABA 1DGPA 3OABB 1N1BA 3M01A 5B03A 2E90A 3DYGA 3ID0A 4N9UA 5CG5A 3TFVA 2OPMA 2Q9YA 5IL8A 5EAUA 3WEHA 1KIYA 2ZCQA 3N0GA 3WCGA 5IMIA 5A0IA 4NG6A 1UBWA 3KB9A 3N45F 4H5DF 3P8LA 4RXAA 5DHKA 5EATA 4RXEA 3WJOA 4FJQA 4KKMA 3RYWA 2E4OA 5B0LA 4E9ZA 5I1UA 5ILIA 1VG3A 3WCIA 5E8LA 1UBYA 1V4HA 3M9UA 1WL3A 3WCAA 3KBKA 1UBVA 2PS7A 5HN9A 3G4FA 4GP1A 2AZKA 3LVSA 4LFGA 1YHMA 3VJBA 2J1PA 4DXJA 1PS1A 3SDQA 4E1EA 1DI1A 2AEKA 3LEEA 4LXWA 1WY0A 2E91A 3WSBA 4KQ5A 3WCHA 4DHDA 2Z4VA 3EGTA 1ZW5A 3TC1A 4DI5A 3OYRA 3WCBA 2F8CF 2FTZA 2E8WA 4LTZA 1WMWA 3DYFA 3PKOA 2E8UA 5IKHA 2E8VA 2E92A 3DYHA 5AHUB 5EASA 2Q58A 1WKZA 3M00A 4DZWA 3N46F 4FP4A 3ICKA 3N49F 1V4EA 3NRIA 4JXNA 4KPDA 4OMHA 3PDEA 3ICNA 5JA0F 3SDUA 2VF6A 2ONGA 4JZXA 3Q30A 5DGMF 1VG7A 2AETA 5IL3A 3NF2A 4KUXA 5A0JA 4P0VA 3WCFA 5IMNA 4OMGA 3WCEA 2Z52A 5IN8A 4LPGF 4DEMF 4NKFA 5AFXA 3BNYA 4XQSF 5ILJA 5HN7A 3WEJA 4LLSA 4P0XA 4GAXA 1HXGA 3N1WF 3EFQA 5EROA 5DHIA 4HD1A 5B0IA 5B0KA 5ILDA 3LGZB 2OPNA 3ICZA 3WC9A 4F6XA 2Z4WA 4XQRF 3AQCB 4GP2A 3NPRA 1RTRA 3PYBA 4EA0A 3IBAA 3WCLA 1YHLA 2F92F 3UCAA 4ZQ8A 1N22A 3QKCA 1YYQA 3P5RA 5DJVF 3AE0A 4DWBA
chains in the Genus database with same CATH superfamily
1JFGA 2Z78A 4LZ0A 3ACXA 5DJRF 3TS7A 4F62A 3N5HF 5HNAA 4RXDA 3VJ9A 3ACWA 3ACYA 2F9KF 4KPJA 4E9UA 2PS4A 4K10A 3W7FA 5JV0F 1WL0A 3NPKA 2EWGA 5ER8A 2Z4XA 3SDRA 3V1VA 5AELA 5ERMA 5DGNF 2OA6A 2E8TA 1N21A 2H8OA 3ZCDA 2F89F 3KRPA 3VJEA 3KRPB 4KK2A 2FORA 3WEKA 5H9DA 4JZBA 2ZEVA 4LA6A 3VJAA 5CG6A 4DWGA 3LZ9A 1RQJA 5E8HA 3PYAA 3ASXA 3TFNA 3WCCA 3N3DA 2P1CA 4LLTA 2ZEUA 3ICMA 3LDWA 4MC8A 5IKAA 1N20A 3VJDA 4P0WA 4KQUA 3CKEA 1V4JA 3LGKA 4RYPA 3ZOUA 2AZLA 1FPSA 2O1OA 3Q1OA 5DGSF 2AZJA 1V4IA 2AELA 3KRFA 1YHKA 3KRFB 3N6KF 1WL2A 4PVYF 2Z4ZA 5IM1A 3OACB 1N23A 4WK5A 3LJIA 3MZVA 1EZFA 4KFAA 1UBXA 4KVIA 1VG2A 1YJ4A 5IK0A 3SDTA 3ADZA 3KRAA 4F6VA 4LZ3A 3KRAB 3LK5A 2Z50A 3QQVA 5ERNA 3WJNA 5B00A 3P8RA 3LMDA 1YV5A 4LTVA 4GA3A 4H5CF 3N1VF 1HXAA 1YYUA 4NFIF 2PS6A 1YYRA 4LIXA 3N0FA 4MC0A 4OGUA 5B0JA 3VJ8A 2ONHA 3WCDA 1HM4A 3CP6A 5E8KA 3V66A 2I19A 3RYEA 3LOMA 4LUUA 2F8ZF 3BNXA 3PH7A 3Q2QA 2PS8A 2ZCOA 2Z7IA 1VG6A 5DZ2A 2RAHA 2Z4YA 2E8XA 3N5JF 4RXCA 4EA2A 3WEGA 1N1ZA 1HX9A 2Z7HA 3S4JA 3RMGA 5IK9A 3KRCA 3EZ3A 3KRCB 5DIQF 1HM7A 3P41A 5ILYA 4JXYA 3M02A 4KQSA 5IK6A 4KVYA 4OKMA 3V1XA 4LZCA 5ILHA 4LFVF 3WCJA 1YYSA 2J5CA 5DW7A 1WL1A 4LA5A 3LLWA 2E95A 4LPHF 4PVXF 3ZMBA 5JV1F 4LOBA 4JYXA 2Q9ZA 5B02A 5JV2F 1YYTA 3M0GA 5ILKA 5C05A 4KWDA 1YQ7A 1RQIA 2DH4A 1HXCA 3LSNA 2E93A 2OGDA 3TFPA 1VG4A 3LG5A 4XQTF 4UMJA 2E94A 2ZCSA 4EA1A 5KSXF 1N24A 3AQBB 3N3LF 1JFAA 4KVWA 3RBMA 2J1OA 5HN8A 3ZMCA 4NFJF 3AQ0A 3WCMA 4N1ZF 4H5EF 5AYPA 5A0KA 3WJKA 3OACA 3P5PA 5DJPF 5B01A 2ZY1A 5B0MA 5JUZF 3S9VA 5IVGA 4QXSF 3Q2ZA 2PS5A 3B7LA 3KROA 4QPFA 3KROB 2QISA 2F94F 3SDVA 3WEIA 2F7MF 1V4KA 4NUAA 3APZA 3MAVA 3IPIA 5ILZA 1KIZA 5IMPA 4OKZA 4Q23A 3WEFA 2ZCRA 4L2XF 4RNQA 3WE9A 3G4DA 3CC9A 4LFEA 3VJCA 3SAEA 4JVJF 4KVDA 2Q80A 4NKEA 4NFKF 3WSAA 3ZL6A 4MC3A 3OABA 1DGPA 3OABB 1N1BA 3M01A 5B03A 2E90A 3DYGA 3ID0A 4N9UA 5CG5A 3TFVA 2OPMA 2Q9YA 5IL8A 5EAUA 3WEHA 1KIYA 2ZCQA 3N0GA 3WCGA 5IMIA 5A0IA 4NG6A 1UBWA 3KB9A 3N45F 4H5DF 3P8LA 4RXAA 5DHKA 5EATA 4RXEA 3WJOA 4FJQA 4KKMA 3RYWA 2E4OA 5B0LA 4E9ZA 5I1UA 5ILIA 1VG3A 3WCIA 5E8LA 1UBYA 1V4HA 3M9UA 1WL3A 3WCAA 3KBKA 1UBVA 2PS7A 5HN9A 3G4FA 4GP1A 2AZKA 3LVSA 4LFGA 1YHMA 3VJBA 2J1PA 4DXJA 1PS1A 3SDQA 4E1EA 1DI1A 2AEKA 3LEEA 4LXWA 1WY0A 2E91A 3WSBA 4KQ5A 3WCHA 4DHDA 2Z4VA 3EGTA 1ZW5A 3TC1A 4DI5A 3OYRA 3WCBA 2F8CF 2FTZA 2E8WA 4LTZA 1WMWA 3DYFA 3PKOA 2E8UA 5IKHA 2E8VA 2E92A 3DYHA 5AHUB 5EASA 2Q58A 1WKZA 3M00A 4DZWA 3N46F 4FP4A 3ICKA 3N49F 1V4EA 3NRIA 4JXNA 4KPDA 4OMHA 3PDEA 3ICNA 5JA0F 3SDUA 2VF6A 2ONGA 4JZXA 3Q30A 5DGMF 1VG7A 2AETA 5IL3A 3NF2A 4KUXA 5A0JA 4P0VA 3WCFA 5IMNA 4OMGA 3WCEA 2Z52A 5IN8A 4LPGF 4DEMF 4NKFA 5AFXA 3BNYA 4XQSF 5ILJA 5HN7A 3WEJA 4LLSA 4P0XA 4GAXA 1HXGA 3N1WF 3EFQA 5EROA 5DHIA 4HD1A 5B0IA 5B0KA 5ILDA 3LGZB 2OPNA 3ICZA 3WC9A 4F6XA 2Z4WA 4XQRF 3AQCB 4GP2A 3NPRA 1RTRA 3PYBA 4EA0A 3IBAA 3WCLA 1YHLA 2F92F 3UCAA 4ZQ8A 1N22A 3QKCA 1YYQA 3P5RA 5DJVF 3AE0A 4DWBA
chains in the Genus database with same CATH topology
1JFGA 2Z78A 4LZ0A 3ACXA 5DJRF 3TS7A 4F62A 3N5HF 5HNAA 4RXDA 3VJ9A 3ACWA 3ACYA 2F9KF 4KPJA 4E9UA 2PS4A 4K10A 3W7FA 5JV0F 1WL0A 3NPKA 2EWGA 5ER8A 2Z4XA 3SDRA 3V1VA 5AELA 5ERMA 5DGNF 2OA6A 2E8TA 1N21A 2H8OA 3ZCDA 2F89F 3KRPA 3VJEA 3KRPB 4KK2A 2FORA 3WEKA 5H9DA 4JZBA 2ZEVA 4LA6A 3VJAA 5CG6A 4DWGA 3LZ9A 1RQJA 5E8HA 3PYAA 3ASXA 3TFNA 3WCCA 3N3DA 2P1CA 4LLTA 2ZEUA 3ICMA 3LDWA 4MC8A 5IKAA 1N20A 3VJDA 4P0WA 4KQUA 3CKEA 1V4JA 3LGKA 4RYPA 3ZOUA 2AZLA 1FPSA 2O1OA 3Q1OA 5DGSF 2AZJA 1V4IA 2AELA 3KRFA 1YHKA 3KRFB 3N6KF 1WL2A 4PVYF 2Z4ZA 5IM1A 3OACB 1N23A 4WK5A 3LJIA 3MZVA 1EZFA 4KFAA 1UBXA 4KVIA 1VG2A 1YJ4A 5IK0A 3SDTA 3ADZA 3KRAA 4F6VA 4LZ3A 3KRAB 3LK5A 2Z50A 3QQVA 5ERNA 3WJNA 5B00A 3P8RA 3LMDA 1YV5A 4LTVA 4GA3A 4H5CF 3N1VF 1HXAA 1YYUA 4NFIF 2PS6A 1YYRA 4LIXA 3N0FA 4MC0A 4OGUA 5B0JA 3VJ8A 2ONHA 3WCDA 1HM4A 3CP6A 5E8KA 3V66A 2I19A 3RYEA 3LOMA 4LUUA 2F8ZF 3BNXA 3PH7A 3Q2QA 2PS8A 2ZCOA 2Z7IA 1VG6A 5DZ2A 2RAHA 2Z4YA 2E8XA 3N5JF 4RXCA 4EA2A 3WEGA 1N1ZA 1HX9A 2Z7HA 3S4JA 3RMGA 5IK9A 3KRCA 3EZ3A 3KRCB 5DIQF 1HM7A 3P41A 5ILYA 4JXYA 3M02A 4KQSA 5IK6A 4KVYA 4OKMA 3V1XA 4LZCA 5ILHA 4LFVF 3WCJA 1YYSA 2J5CA 5DW7A 1WL1A 4LA5A 3LLWA 2E95A 4LPHF 4PVXF 3ZMBA 5JV1F 4LOBA 4JYXA 2Q9ZA 5B02A 5JV2F 1YYTA 3M0GA 5ILKA 5C05A 4KWDA 1YQ7A 1RQIA 2DH4A 1HXCA 3LSNA 2E93A 2OGDA 3TFPA 1VG4A 3LG5A 4XQTF 4UMJA 2E94A 2ZCSA 4EA1A 5KSXF 1N24A 3AQBB 3N3LF 1JFAA 4KVWA 3RBMA 2J1OA 5HN8A 3ZMCA 4NFJF 3AQ0A 3WCMA 4N1ZF 4H5EF 5AYPA 5A0KA 3WJKA 3OACA 3P5PA 5DJPF 5B01A 2ZY1A 5B0MA 5JUZF 3S9VA 5IVGA 4QXSF 3Q2ZA 2PS5A 3B7LA 3KROA 4QPFA 3KROB 2QISA 2F94F 3SDVA 3WEIA 2F7MF 1V4KA 4NUAA 3APZA 3MAVA 3IPIA 5ILZA 1KIZA 5IMPA 4OKZA 4Q23A 3WEFA 2ZCRA 4L2XF 4RNQA 3WE9A 3G4DA 3CC9A 4LFEA 3VJCA 3SAEA 4JVJF 4KVDA 2Q80A 4NKEA 4NFKF 3WSAA 3ZL6A 4MC3A 3OABA 1DGPA 3OABB 1N1BA 3M01A 5B03A 2E90A 3DYGA 3ID0A 4N9UA 5CG5A 3TFVA 2OPMA 2Q9YA 5IL8A 5EAUA 3WEHA 1KIYA 2ZCQA 3N0GA 3WCGA 5IMIA 5A0IA 4NG6A 1UBWA 3KB9A 3N45F 4H5DF 3P8LA 4RXAA 5DHKA 5EATA 4RXEA 3WJOA 4FJQA 4KKMA 3RYWA 2E4OA 5B0LA 4E9ZA 5I1UA 5ILIA 1VG3A 3WCIA 5E8LA 1UBYA 1V4HA 3M9UA 1WL3A 3WCAA 3KBKA 1UBVA 2PS7A 5HN9A 3G4FA 4GP1A 2AZKA 3LVSA 4LFGA 1YHMA 3VJBA 2J1PA 4DXJA 1PS1A 3SDQA 4E1EA 1DI1A 2AEKA 3LEEA 4LXWA 1WY0A 2E91A 3WSBA 4KQ5A 3WCHA 4DHDA 2Z4VA 3EGTA 1ZW5A 3TC1A 4DI5A 3OYRA 3WCBA 2F8CF 2FTZA 2E8WA 4LTZA 1WMWA 3DYFA 3PKOA 2E8UA 5IKHA 2E8VA 2E92A 3DYHA 5AHUB 5EASA 2Q58A 1WKZA 3M00A 4DZWA 3N46F 4FP4A 3ICKA 3N49F 1V4EA 3NRIA 4JXNA 4KPDA 4OMHA 3PDEA 3ICNA 5JA0F 3SDUA 2VF6A 2ONGA 4JZXA 3Q30A 5DGMF 1VG7A 2AETA 5IL3A 3NF2A 4KUXA 5A0JA 4P0VA 3WCFA 5IMNA 4OMGA 3WCEA 2Z52A 5IN8A 4LPGF 4DEMF 4NKFA 5AFXA 3BNYA 4XQSF 5ILJA 5HN7A 3WEJA 4LLSA 4P0XA 4GAXA 1HXGA 3N1WF 3EFQA 5EROA 5DHIA 4HD1A 5B0IA 5B0KA 5ILDA 3LGZB 2OPNA 3ICZA 3WC9A 4F6XA 2Z4WA 4XQRF 3AQCB 4GP2A 3NPRA 1RTRA 3PYBA 4EA0A 3IBAA 3WCLA 1YHLA 2F92F 3UCAA 4ZQ8A 1N22A 3QKCA 1YYQA 3P5RA 5DJVF 3AE0A 4DWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JFG A;  2Z78 A;  4LZ0 A;  3ACX A;  5DJR F;  3TS7 A;  4F62 A;  3N5H F;  5HNA A;  4RXD A;  3VJ9 A;  3ACW A;  3ACY A;  2F9K F;  4KPJ A;  4E9U A;  2PS4 A;  4K10 A;  3W7F A;  5JV0 F;  1WL0 A;  3NPK A;  2EWG A;  5ER8 A;  2Z4X A;  3SDR A;  3V1V A;  5AEL A;  5ERM A;  5DGN F;  2OA6 A;  2E8T A;  1N21 A;  2H8O A;  3ZCD A;  2F89 F;  3KRP A;  3VJE A;  3KRP B;  4KK2 A;  2FOR A;  3WEK A;  5H9D A;  4JZB A;  2ZEV A;  4LA6 A;  3VJA A;  5CG6 A;  4DWG A;  3LZ9 A;  1RQJ A;  5E8H A;  3PYA A;  3ASX A;  3TFN A;  3WCC A;  3N3D A;  2P1C A;  4LLT A;  2ZEU A;  3ICM A;  3LDW A;  4MC8 A;  5IKA A;  1N20 A;  3VJD A;  4P0W A;  4KQU A;  3CKE A;  1V4J A;  3LGK A;  4RYP A;  3ZOU A;  2AZL A;  1FPS A;  2O1O A;  3Q1O A;  5DGS F;  2AZJ A;  1V4I A;  2AEL A;  3KRF A;  1YHK A;  3KRF B;  3N6K F;  1WL2 A;  4PVY F;  2Z4Z A;  5IM1 A;  3OAC B;  1N23 A;  4WK5 A;  3LJI A;  3MZV A;  1EZF A;  4KFA A;  1UBX A;  4KVI A;  1VG2 A;  1YJ4 A;  5IK0 A;  3SDT A;  3ADZ A;  3KRA A;  4F6V A;  4LZ3 A;  3KRA B;  3LK5 A;  2Z50 A;  3QQV A;  5ERN A;  3WJN A;  5B00 A;  3P8R A;  3LMD A;  1YV5 A;  4LTV A;  4GA3 A;  4H5C F;  3N1V F;  1HXA A;  1YYU A;  4NFI F;  2PS6 A;  1YYR A;  4LIX A;  3N0F A;  4MC0 A;  4OGU A;  5B0J A;  3VJ8 A;  2ONH A;  3WCD A;  1HM4 A;  3CP6 A;  5E8K A;  3V66 A;  2I19 A;  3RYE A;  3LOM A;  4LUU A;  2F8Z F;  3BNX A;  3PH7 A;  3Q2Q A;  2PS8 A;  2ZCO A;  2Z7I A;  1VG6 A;  5DZ2 A;  2RAH A;  2Z4Y A;  2E8X A;  3N5J F;  4RXC A;  4EA2 A;  3WEG A;  1N1Z A;  1HX9 A;  2Z7H A;  3S4J A;  3RMG A;  5IK9 A;  3KRC A;  3EZ3 A;  3KRC B;  5DIQ F;  1HM7 A;  3P41 A;  5ILY A;  4JXY A;  3M02 A;  4KQS A;  5IK6 A;  4KVY A;  4OKM A;  3V1X A;  4LZC A;  5ILH A;  4LFV F;  3WCJ A;  1YYS A;  2J5C A;  5DW7 A;  1WL1 A;  4LA5 A;  3LLW A;  2E95 A;  4LPH F;  4PVX F;  3ZMB A;  5JV1 F;  4LOB A;  4JYX A;  2Q9Z A;  5B02 A;  5JV2 F;  1YYT A;  3M0G A;  5ILK A;  5C05 A;  4KWD A;  1YQ7 A;  1RQI A;  2DH4 A;  1HXC A;  3LSN A;  2E93 A;  2OGD A;  3TFP A;  1VG4 A;  3LG5 A;  4XQT F;  4UMJ A;  2E94 A;  2ZCS A;  4EA1 A;  5KSX F;  1N24 A;  3AQB B;  3N3L F;  1JFA A;  4KVW A;  3RBM A;  2J1O A;  5HN8 A;  3ZMC A;  4NFJ F;  3AQ0 A;  3WCM A;  4N1Z F;  4H5E F;  5AYP A;  5A0K A;  3WJK A;  3OAC A;  3P5P A;  5DJP F;  5B01 A;  2ZY1 A;  5B0M A;  5JUZ F;  3S9V A;  5IVG A;  4QXS F;  3Q2Z A;  2PS5 A;  3B7L A;  3KRO A;  4QPF A;  3KRO B;  2QIS A;  2F94 F;  3SDV A;  3WEI A;  2F7M F;  1V4K A;  4NUA A;  3APZ A;  3MAV A;  3IPI A;  5ILZ A;  1KIZ A;  5IMP A;  4OKZ A;  4Q23 A;  3WEF A;  2ZCR A;  4L2X F;  4RNQ A;  3WE9 A;  3G4D A;  3CC9 A;  4LFE A;  3VJC A;  3SAE A;  4JVJ F;  4KVD A;  2Q80 A;  4NKE A;  4NFK F;  3WSA A;  3ZL6 A;  4MC3 A;  3OAB A;  1DGP A;  3OAB B;  1N1B A;  3M01 A;  5B03 A;  2E90 A;  3DYG A;  3ID0 A;  4N9U A;  5CG5 A;  3TFV A;  2OPM A;  2Q9Y A;  5IL8 A;  5EAU A;  3WEH A;  1KIY A;  2ZCQ A;  3N0G A;  3WCG A;  5IMI A;  5A0I A;  4NG6 A;  1UBW A;  3KB9 A;  3N45 F;  4H5D F;  3P8L A;  4RXA A;  5DHK A;  5EAT A;  4RXE A;  3WJO A;  4FJQ A;  4KKM A;  3RYW A;  2E4O A;  5B0L A;  4E9Z A;  5I1U A;  5ILI A;  1VG3 A;  3WCI A;  5E8L A;  1UBY A;  1V4H A;  3M9U A;  1WL3 A;  3WCA A;  3KBK A;  1UBV A;  2PS7 A;  5HN9 A;  3G4F A;  4GP1 A;  2AZK A;  3LVS A;  4LFG A;  1YHM A;  3VJB A;  2J1P A;  4DXJ A;  1PS1 A;  3SDQ A;  4E1E A;  1DI1 A;  2AEK A;  3LEE A;  4LXW A;  1WY0 A;  2E91 A;  3WSB A;  4KQ5 A;  3WCH A;  4DHD A;  2Z4V A;  3EGT A;  1ZW5 A;  3TC1 A;  4DI5 A;  3OYR A;  3WCB A;  2F8C F;  2FTZ A;  2E8W A;  4LTZ A;  1WMW A;  3DYF A;  3PKO A;  2E8U A;  5IKH A;  2E8V A;  2E92 A;  3DYH A;  5AHU B;  5EAS A;  2Q58 A;  1WKZ A;  3M00 A;  4DZW A;  3N46 F;  4FP4 A;  3ICK A;  3N49 F;  1V4E A;  3NRI A;  4JXN A;  4KPD A;  4OMH A;  3PDE A;  3ICN A;  5JA0 F;  3SDU A;  2VF6 A;  2ONG A;  4JZX A;  3Q30 A;  5DGM F;  1VG7 A;  2AET A;  5IL3 A;  3NF2 A;  4KUX A;  5A0J A;  4P0V A;  3WCF A;  5IMN A;  4OMG A;  3WCE A;  2Z52 A;  5IN8 A;  4LPG F;  4DEM F;  4NKF A;  5AFX A;  3BNY A;  4XQS F;  5ILJ A;  5HN7 A;  3WEJ A;  4LLS A;  4P0X A;  4GAX A;  1HXG A;  3N1W F;  3EFQ A;  5ERO A;  5DHI A;  4HD1 A;  5B0I A;  5B0K A;  5ILD A;  3LGZ B;  2OPN A;  3ICZ A;  3WC9 A;  4F6X A;  2Z4W A;  4XQR F;  3AQC B;  4GP2 A;  3NPR A;  1RTR A;  3PYB A;  4EA0 A;  3IBA A;  3WCL A;  1YHL A;  2F92 F;  3UCA A;  4ZQ8 A;  1N22 A;  3QKC A;  1YYQ A;  3P5R A;  5DJV F;  3AE0 A;  4DWB A; 
#chains in the Genus database with same CATH topology
 1JFG A;  2Z78 A;  4LZ0 A;  3ACX A;  5DJR F;  3TS7 A;  4F62 A;  3N5H F;  5HNA A;  4RXD A;  3VJ9 A;  3ACW A;  3ACY A;  2F9K F;  4KPJ A;  4E9U A;  2PS4 A;  4K10 A;  3W7F A;  5JV0 F;  1WL0 A;  3NPK A;  2EWG A;  5ER8 A;  2Z4X A;  3SDR A;  3V1V A;  5AEL A;  5ERM A;  5DGN F;  2OA6 A;  2E8T A;  1N21 A;  2H8O A;  3ZCD A;  2F89 F;  3KRP A;  3VJE A;  3KRP B;  4KK2 A;  2FOR A;  3WEK A;  5H9D A;  4JZB A;  2ZEV A;  4LA6 A;  3VJA A;  5CG6 A;  4DWG A;  3LZ9 A;  1RQJ A;  5E8H A;  3PYA A;  3ASX A;  3TFN A;  3WCC A;  3N3D A;  2P1C A;  4LLT A;  2ZEU A;  3ICM A;  3LDW A;  4MC8 A;  5IKA A;  1N20 A;  3VJD A;  4P0W A;  4KQU A;  3CKE A;  1V4J A;  3LGK A;  4RYP A;  3ZOU A;  2AZL A;  1FPS A;  2O1O A;  3Q1O A;  5DGS F;  2AZJ A;  1V4I A;  2AEL A;  3KRF A;  1YHK A;  3KRF B;  3N6K F;  1WL2 A;  4PVY F;  2Z4Z A;  5IM1 A;  3OAC B;  1N23 A;  4WK5 A;  3LJI A;  3MZV A;  1EZF A;  4KFA A;  1UBX A;  4KVI A;  1VG2 A;  1YJ4 A;  5IK0 A;  3SDT A;  3ADZ A;  3KRA A;  4F6V A;  4LZ3 A;  3KRA B;  3LK5 A;  2Z50 A;  3QQV A;  5ERN A;  3WJN A;  5B00 A;  3P8R A;  3LMD A;  1YV5 A;  4LTV A;  4GA3 A;  4H5C F;  3N1V F;  1HXA A;  1YYU A;  4NFI F;  2PS6 A;  1YYR A;  4LIX A;  3N0F A;  4MC0 A;  4OGU A;  5B0J A;  3VJ8 A;  2ONH A;  3WCD A;  1HM4 A;  3CP6 A;  5E8K A;  3V66 A;  2I19 A;  3RYE A;  3LOM A;  4LUU A;  2F8Z F;  3BNX A;  3PH7 A;  3Q2Q A;  2PS8 A;  2ZCO A;  2Z7I A;  1VG6 A;  5DZ2 A;  2RAH A;  2Z4Y A;  2E8X A;  3N5J F;  4RXC A;  4EA2 A;  3WEG A;  1N1Z A;  1HX9 A;  2Z7H A;  3S4J A;  3RMG A;  5IK9 A;  3KRC A;  3EZ3 A;  3KRC B;  5DIQ F;  1HM7 A;  3P41 A;  5ILY A;  4JXY A;  3M02 A;  4KQS A;  5IK6 A;  4KVY A;  4OKM A;  3V1X A;  4LZC A;  5ILH A;  4LFV F;  3WCJ A;  1YYS A;  2J5C A;  5DW7 A;  1WL1 A;  4LA5 A;  3LLW A;  2E95 A;  4LPH F;  4PVX F;  3ZMB A;  5JV1 F;  4LOB A;  4JYX A;  2Q9Z A;  5B02 A;  5JV2 F;  1YYT A;  3M0G A;  5ILK A;  5C05 A;  4KWD A;  1YQ7 A;  1RQI A;  2DH4 A;  1HXC A;  3LSN A;  2E93 A;  2OGD A;  3TFP A;  1VG4 A;  3LG5 A;  4XQT F;  4UMJ A;  2E94 A;  2ZCS A;  4EA1 A;  5KSX F;  1N24 A;  3AQB B;  3N3L F;  1JFA A;  4KVW A;  3RBM A;  2J1O A;  5HN8 A;  3ZMC A;  4NFJ F;  3AQ0 A;  3WCM A;  4N1Z F;  4H5E F;  5AYP A;  5A0K A;  3WJK A;  3OAC A;  3P5P A;  5DJP F;  5B01 A;  2ZY1 A;  5B0M A;  5JUZ F;  3S9V A;  5IVG A;  4QXS F;  3Q2Z A;  2PS5 A;  3B7L A;  3KRO A;  4QPF A;  3KRO B;  2QIS A;  2F94 F;  3SDV A;  3WEI A;  2F7M F;  1V4K A;  4NUA A;  3APZ A;  3MAV A;  3IPI A;  5ILZ A;  1KIZ A;  5IMP A;  4OKZ A;  4Q23 A;  3WEF A;  2ZCR A;  4L2X F;  4RNQ A;  3WE9 A;  3G4D A;  3CC9 A;  4LFE A;  3VJC A;  3SAE A;  4JVJ F;  4KVD A;  2Q80 A;  4NKE A;  4NFK F;  3WSA A;  3ZL6 A;  4MC3 A;  3OAB A;  1DGP A;  3OAB B;  1N1B A;  3M01 A;  5B03 A;  2E90 A;  3DYG A;  3ID0 A;  4N9U A;  5CG5 A;  3TFV A;  2OPM A;  2Q9Y A;  5IL8 A;  5EAU A;  3WEH A;  1KIY A;  2ZCQ A;  3N0G A;  3WCG A;  5IMI A;  5A0I A;  4NG6 A;  1UBW A;  3KB9 A;  3N45 F;  4H5D F;  3P8L A;  4RXA A;  5DHK A;  5EAT A;  4RXE A;  3WJO A;  4FJQ A;  4KKM A;  3RYW A;  2E4O A;  5B0L A;  4E9Z A;  5I1U A;  5ILI A;  1VG3 A;  3WCI A;  5E8L A;  1UBY A;  1V4H A;  3M9U A;  1WL3 A;  3WCA A;  3KBK A;  1UBV A;  2PS7 A;  5HN9 A;  3G4F A;  4GP1 A;  2AZK A;  3LVS A;  4LFG A;  1YHM A;  3VJB A;  2J1P A;  4DXJ A;  1PS1 A;  3SDQ A;  4E1E A;  1DI1 A;  2AEK A;  3LEE A;  4LXW A;  1WY0 A;  2E91 A;  3WSB A;  4KQ5 A;  3WCH A;  4DHD A;  2Z4V A;  3EGT A;  1ZW5 A;  3TC1 A;  4DI5 A;  3OYR A;  3WCB A;  2F8C F;  2FTZ A;  2E8W A;  4LTZ A;  1WMW A;  3DYF A;  3PKO A;  2E8U A;  5IKH A;  2E8V A;  2E92 A;  3DYH A;  5AHU B;  5EAS A;  2Q58 A;  1WKZ A;  3M00 A;  4DZW A;  3N46 F;  4FP4 A;  3ICK A;  3N49 F;  1V4E A;  3NRI A;  4JXN A;  4KPD A;  4OMH A;  3PDE A;  3ICN A;  5JA0 F;  3SDU A;  2VF6 A;  2ONG A;  4JZX A;  3Q30 A;  5DGM F;  1VG7 A;  2AET A;  5IL3 A;  3NF2 A;  4KUX A;  5A0J A;  4P0V A;  3WCF A;  5IMN A;  4OMG A;  3WCE A;  2Z52 A;  5IN8 A;  4LPG F;  4DEM F;  4NKF A;  5AFX A;  3BNY A;  4XQS F;  5ILJ A;  5HN7 A;  3WEJ A;  4LLS A;  4P0X A;  4GAX A;  1HXG A;  3N1W F;  3EFQ A;  5ERO A;  5DHI A;  4HD1 A;  5B0I A;  5B0K A;  5ILD A;  3LGZ B;  2OPN A;  3ICZ A;  3WC9 A;  4F6X A;  2Z4W A;  4XQR F;  3AQC B;  4GP2 A;  3NPR A;  1RTR A;  3PYB A;  4EA0 A;  3IBA A;  3WCL A;  1YHL A;  2F92 F;  3UCA A;  4ZQ8 A;  1N22 A;  3QKC A;  1YYQ A;  3P5R A;  5DJV F;  3AE0 A;  4DWB A; 
#chains in the Genus database with same CATH homology
 1JFG A;  2Z78 A;  4LZ0 A;  3ACX A;  5DJR F;  3TS7 A;  4F62 A;  3N5H F;  5HNA A;  4RXD A;  3VJ9 A;  3ACW A;  3ACY A;  2F9K F;  4KPJ A;  4E9U A;  2PS4 A;  4K10 A;  3W7F A;  5JV0 F;  1WL0 A;  3NPK A;  2EWG A;  5ER8 A;  2Z4X A;  3SDR A;  3V1V A;  5AEL A;  5ERM A;  5DGN F;  2OA6 A;  2E8T A;  1N21 A;  2H8O A;  3ZCD A;  2F89 F;  3KRP A;  3VJE A;  3KRP B;  4KK2 A;  2FOR A;  3WEK A;  5H9D A;  4JZB A;  2ZEV A;  4LA6 A;  3VJA A;  5CG6 A;  4DWG A;  3LZ9 A;  1RQJ A;  5E8H A;  3PYA A;  3ASX A;  3TFN A;  3WCC A;  3N3D A;  2P1C A;  4LLT A;  2ZEU A;  3ICM A;  3LDW A;  4MC8 A;  5IKA A;  1N20 A;  3VJD A;  4P0W A;  4KQU A;  3CKE A;  1V4J A;  3LGK A;  4RYP A;  3ZOU A;  2AZL A;  1FPS A;  2O1O A;  3Q1O A;  5DGS F;  2AZJ A;  1V4I A;  2AEL A;  3KRF A;  1YHK A;  3KRF B;  3N6K F;  1WL2 A;  4PVY F;  2Z4Z A;  5IM1 A;  3OAC B;  1N23 A;  4WK5 A;  3LJI A;  3MZV A;  1EZF A;  4KFA A;  1UBX A;  4KVI A;  1VG2 A;  1YJ4 A;  5IK0 A;  3SDT A;  3ADZ A;  3KRA A;  4F6V A;  4LZ3 A;  3KRA B;  3LK5 A;  2Z50 A;  3QQV A;  5ERN A;  3WJN A;  5B00 A;  3P8R A;  3LMD A;  1YV5 A;  4LTV A;  4GA3 A;  4H5C F;  3N1V F;  1HXA A;  1YYU A;  4NFI F;  2PS6 A;  1YYR A;  4LIX A;  3N0F A;  4MC0 A;  4OGU A;  5B0J A;  3VJ8 A;  2ONH A;  3WCD A;  1HM4 A;  3CP6 A;  5E8K A;  3V66 A;  2I19 A;  3RYE A;  3LOM A;  4LUU A;  2F8Z F;  3BNX A;  3PH7 A;  3Q2Q A;  2PS8 A;  2ZCO A;  2Z7I A;  1VG6 A;  5DZ2 A;  2RAH A;  2Z4Y A;  2E8X A;  3N5J F;  4RXC A;  4EA2 A;  3WEG A;  1N1Z A;  1HX9 A;  2Z7H A;  3S4J A;  3RMG A;  5IK9 A;  3KRC A;  3EZ3 A;  3KRC B;  5DIQ F;  1HM7 A;  3P41 A;  5ILY A;  4JXY A;  3M02 A;  4KQS A;  5IK6 A;  4KVY A;  4OKM A;  3V1X A;  4LZC A;  5ILH A;  4LFV F;  3WCJ A;  1YYS A;  2J5C A;  5DW7 A;  1WL1 A;  4LA5 A;  3LLW A;  2E95 A;  4LPH F;  4PVX F;  3ZMB A;  5JV1 F;  4LOB A;  4JYX A;  2Q9Z A;  5B02 A;  5JV2 F;  1YYT A;  3M0G A;  5ILK A;  5C05 A;  4KWD A;  1YQ7 A;  1RQI A;  2DH4 A;  1HXC A;  3LSN A;  2E93 A;  2OGD A;  3TFP A;  1VG4 A;  3LG5 A;  4XQT F;  4UMJ A;  2E94 A;  2ZCS A;  4EA1 A;  5KSX F;  1N24 A;  3AQB B;  3N3L F;  1JFA A;  4KVW A;  3RBM A;  2J1O A;  5HN8 A;  3ZMC A;  4NFJ F;  3AQ0 A;  3WCM A;  4N1Z F;  4H5E F;  5AYP A;  5A0K A;  3WJK A;  3OAC A;  3P5P A;  5DJP F;  5B01 A;  2ZY1 A;  5B0M A;  5JUZ F;  3S9V A;  5IVG A;  4QXS F;  3Q2Z A;  2PS5 A;  3B7L A;  3KRO A;  4QPF A;  3KRO B;  2QIS A;  2F94 F;  3SDV A;  3WEI A;  2F7M F;  1V4K A;  4NUA A;  3APZ A;  3MAV A;  3IPI A;  5ILZ A;  1KIZ A;  5IMP A;  4OKZ A;  4Q23 A;  3WEF A;  2ZCR A;  4L2X F;  4RNQ A;  3WE9 A;  3G4D A;  3CC9 A;  4LFE A;  3VJC A;  3SAE A;  4JVJ F;  4KVD A;  2Q80 A;  4NKE A;  4NFK F;  3WSA A;  3ZL6 A;  4MC3 A;  3OAB A;  1DGP A;  3OAB B;  1N1B A;  3M01 A;  5B03 A;  2E90 A;  3DYG A;  3ID0 A;  4N9U A;  5CG5 A;  3TFV A;  2OPM A;  2Q9Y A;  5IL8 A;  5EAU A;  3WEH A;  1KIY A;  2ZCQ A;  3N0G A;  3WCG A;  5IMI A;  5A0I A;  4NG6 A;  1UBW A;  3KB9 A;  3N45 F;  4H5D F;  3P8L A;  4RXA A;  5DHK A;  5EAT A;  4RXE A;  3WJO A;  4FJQ A;  4KKM A;  3RYW A;  2E4O A;  5B0L A;  4E9Z A;  5I1U A;  5ILI A;  1VG3 A;  3WCI A;  5E8L A;  1UBY A;  1V4H A;  3M9U A;  1WL3 A;  3WCA A;  3KBK A;  1UBV A;  2PS7 A;  5HN9 A;  3G4F A;  4GP1 A;  2AZK A;  3LVS A;  4LFG A;  1YHM A;  3VJB A;  2J1P A;  4DXJ A;  1PS1 A;  3SDQ A;  4E1E A;  1DI1 A;  2AEK A;  3LEE A;  4LXW A;  1WY0 A;  2E91 A;  3WSB A;  4KQ5 A;  3WCH A;  4DHD A;  2Z4V A;  3EGT A;  1ZW5 A;  3TC1 A;  4DI5 A;  3OYR A;  3WCB A;  2F8C F;  2FTZ A;  2E8W A;  4LTZ A;  1WMW A;  3DYF A;  3PKO A;  2E8U A;  5IKH A;  2E8V A;  2E92 A;  3DYH A;  5AHU B;  5EAS A;  2Q58 A;  1WKZ A;  3M00 A;  4DZW A;  3N46 F;  4FP4 A;  3ICK A;  3N49 F;  1V4E A;  3NRI A;  4JXN A;  4KPD A;  4OMH A;  3PDE A;  3ICN A;  5JA0 F;  3SDU A;  2VF6 A;  2ONG A;  4JZX A;  3Q30 A;  5DGM F;  1VG7 A;  2AET A;  5IL3 A;  3NF2 A;  4KUX A;  5A0J A;  4P0V A;  3WCF A;  5IMN A;  4OMG A;  3WCE A;  2Z52 A;  5IN8 A;  4LPG F;  4DEM F;  4NKF A;  5AFX A;  3BNY A;  4XQS F;  5ILJ A;  5HN7 A;  3WEJ A;  4LLS A;  4P0X A;  4GAX A;  1HXG A;  3N1W F;  3EFQ A;  5ERO A;  5DHI A;  4HD1 A;  5B0I A;  5B0K A;  5ILD A;  3LGZ B;  2OPN A;  3ICZ A;  3WC9 A;  4F6X A;  2Z4W A;  4XQR F;  3AQC B;  4GP2 A;  3NPR A;  1RTR A;  3PYB A;  4EA0 A;  3IBA A;  3WCL A;  1YHL A;  2F92 F;  3UCA A;  4ZQ8 A;  1N22 A;  3QKC A;  1YYQ A;  3P5R A;  5DJV F;  3AE0 A;  4DWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...