3PDEA

Crystal structure of geranylgeranyl pyrophosphate synthase from lactobacillus brevis atcc 367 complexed with isoprenyl diphosphate and magnesium
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
300
structure length
289
Chain Sequence
SLINARLIAFEDQWVPALNAPLKQAILADSQDAQLAAAMTYSVLAGGKRLRPLLTVATMQSLGVTFVPERHWRPVMALELLHTYSLIHDDLPAMDNDALRRGEPTNHVKFGAGMATLAGDGLLTLAFQWLTATDLPATMQAALVQALATAAGPSGMVAGQAKDIQSEHVNLPLSQLRVLHKEKTGALLHYAVQAGLILGQAPEAQWPAYLQFADAFGLAFQIYDDILDVVSSADEAKNTYPGKLGLIGANQALIDTIHSGQAALQGLPTSTQRDDLAAFFSYFDTERVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl-diphosphate synthase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Lactobacillus brevis
molecule tags Transferase
total genus 114
structure length 289
sequence length 300
chains with identical sequence B, C, D
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2010-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3pdeA00
3N3LF 4LXWA 1HM7A 2F92F 3QQVA 4KQSA 4H5CF 1YV5A 1N22A 1JFGA 3VJ9A 2PS4A 3BNYA 1WMWA 2Z50A 3LJIA 3KRAB 5B01A 4DWBA 3WCMA 4NG6A 2P1CA 1VG2A 2PS6A 3OABA 3G4DA 3TFVA 2E93A 3WSAA 3CP6A 4L2XF 2E92A 5EATA 2OA6A 3WCAA 2AEKA 2Q58A 3VJBA 4PVXF 3SDVA 5B00A 4PVYF 1V4KA 4NFIF 5A0KA 2E95A 3LVSA 5ILHA 5ILZA 2J1PA 3P8RA 4OKZA 4MC0A 3TC1A 2F89F 4FJQA 3SDQA 2F9KF 3WEJA 2ZCSA 5ERNA 2E4OA 2E8VA 4K10A 3APZA 3AQ0A 4KPJA 2Z4WA 3Q2ZA 3KRAA 4KPDA 3SDTA 4KKMA 3TFNA 2ZCRA 3ICKA 4RXAA 3ZOUA 4H5DF 3ID0A 3OACB 2Z7IA 4NKFA 5IKHA 5DGMF 4JVJF 4LIXA 1YJ4A 3WSBA 4LA6A 3N0GA 3RYWA 5ILJA 5H9DA 5ILYA 1VG4A 3KBKA 3VJ8A 4JXYA 5IMIA 3MZVA 4EA1A 1ZW5A 5ERMA 2ZEUA 1UBYA 3ICMA 4NFJF 4KQUA 1N1BA 4DI5A 3KB9A 2E94A 2AZJA 4HD1A 3SAEA 4LFVF 5ER8A 3WCEA 1VG6A 2AZKA 5DGSF 5JV2F 2OPMA 3RBMA 3M9UA 1HXAA 3PYBA 5E8KA 1PS1A 5HN9A 2OPNA 1WL1A 3OABB 5JV1F 3IPIA 1YHMA 3WCBA 1KIZA 5AFXA 1HXGA 2PS5A 1VG3A 3LDWA 2OGDA 3TS7A 3OACA 5HN7A 3ICZA 4DZWA 5CG5A 4GA3A 3MAVA 3P5RA 5IMNA 3WJNA 3WCDA 4DWGA 3WJOA 4RXDA 4LFGA 3RYEA 5IM1A 4EA0A 2F8ZF 3W7FA 5HN8A 2O1OA 4KK2A 5AHUB 3TFPA 3PDEA 3IBAA 1RTRA 4WK5A 4ZQ8A 4Q23A 1YYSA 3LGZB 4LOBA 2DH4A 3LGKA 2E8UA 1N1ZA 5IK9A 1DI1A 3VJAA 2Q9ZA 5JUZF 5JA0F 4GP1A 5ILIA 3N5HF 3LK5A 5IL8A 2F7MF 2Q9YA 1YYRA 3KROA 3PKOA 2ZCQA 4KVIA 1RQJA 5IMPA 1WL3A 2E8XA 5B0JA 3VJEA 4P0VA 1UBWA 3KRPB 4KVWA 1N24A 2E90A 5DIQF 1KIYA 4LLSA 4LZ3A 3WE9A 4DXJA 2F8CF 4EA2A 4H5EF 3EGTA 4DEMF 2J5CA 4LPHF 2ZY1A 4OMGA 4OMHA 5DHIA 2E8WA 1YHLA 3WCHA 2I19A 3N1VF 5E8HA 3V1VA 1YYQA 2Z4YA 4NFKF 3V1XA 4LTZA 3NPRA 3WEHA 5ILKA 3WCLA 3M00A 4P0WA 4P0XA 4FP4A 3CC9A 4GAXA 5E8LA 2RAHA 4OKMA 3N5JF 4NKEA 3NF2A 3DYHA 4XQRF 2H8OA 4LUUA 3KRPA 1WL2A 1YYUA 3NPKA 3KRCA 3RMGA 2J1OA 3N45F 3P5PA 4JYXA 5IVGA 4LTVA 5IK0A 2Z78A 1UBVA 3N3DA 2PS7A 3KRFB 5AELA 2ONHA 1JFAA 2AELA 3SDUA 3N0FA 3WEGA 4E9ZA 2PS8A 3KROB 5B03A 3ACXA 3AE0A 3ASXA 3LOMA 3WC9A 5B0MA 1N21A 3PYAA 3WEKA 5IL3A 4N1ZF 3S9VA 5DHKA 4MC8A 4OGUA 2EWGA 1HX9A 3Q2QA 2Z7HA 3VJDA 3LEEA 4KFAA 3ZMBA 2VF6A 1DGPA 3ZL6A 3BNXA 4JZXA 5HNAA 1V4IA 5DGNF 1YHKA 3WEIA 4RXCA 5B0IA 3WEFA 3KRFA 5JV0F 5ILDA 3WCIA 5AYPA 3WCFA 1WY0A 4UMJA 3OYRA 4RYPA 1WKZA 3LG5A 5IN8A 5I1UA 4QXSF 3DYGA 4XQSF 3ICNA 3M0GA 3M02A 5DJRF 3ACWA 4LLTA 1V4JA 4NUAA 5EROA 4E9UA 5IKAA 5C05A 2E91A 2AZLA 1UBXA 4KVDA 3ACYA 2F94F 3KRCB 3NRIA 3N46F 2FTZA 4RNQA 4F6XA 3AQCB 3G4FA 4LFEA 4XQTF 4RXEA 3Q30A 3WCCA 5EAUA 1HM4A 2ZCOA 3P41A 3PH7A 4LA5A 3LZ9A 2Z4VA 2Z4ZA 4QPFA 1N20A 3SDRA 3WCJA 3EZ3A 2QISA 3WJKA 2Z4XA 5B0LA 4F62A 4KQ5A 1WL0A 2ZEVA 3B7LA 3V66A 5B02A 5DJVF 4KUXA 1V4HA 3N6KF 2Z52A 5IK6A 3WCGA 4KWDA 5EASA 1N23A 3QKCA 3M01A 3ZMCA 5DJPF 5DW7A 4GP2A 2E8TA 5A0IA 4LZ0A 1YYTA 5A0JA 3EFQA 5KSXF 1HXCA 3N49F 3N1WF 3UCAA 4N9UA 4JXNA 3ADZA 3Q1OA 1RQIA 4JZBA 3AQBB 1FPSA 4MC3A 1V4EA 5B0KA 2Q80A 4LPGF 4LZCA 4E1EA 1EZFA 3DYFA 3S4JA 4DHDA 1YQ7A 3LSNA 2ONGA 3VJCA 2AETA 3LLWA 4KVYA 5DZ2A 3ZCDA 2FORA 5CG6A 4F6VA 3LMDA 1VG7A 3CKEA 3P8LA
chains in the Genus database with same CATH superfamily
3N3LF 4LXWA 1HM7A 2F92F 3QQVA 4KQSA 4H5CF 1YV5A 1N22A 1JFGA 3VJ9A 2PS4A 3BNYA 1WMWA 2Z50A 3LJIA 3KRAB 5B01A 4DWBA 3WCMA 4NG6A 2P1CA 1VG2A 2PS6A 3OABA 3G4DA 3TFVA 2E93A 3WSAA 3CP6A 4L2XF 2E92A 5EATA 2OA6A 3WCAA 2AEKA 2Q58A 3VJBA 4PVXF 3SDVA 5B00A 4PVYF 1V4KA 4NFIF 5A0KA 2E95A 3LVSA 5ILHA 5ILZA 2J1PA 3P8RA 4OKZA 4MC0A 3TC1A 2F89F 4FJQA 3SDQA 2F9KF 3WEJA 2ZCSA 5ERNA 2E4OA 2E8VA 4K10A 3APZA 3AQ0A 4KPJA 2Z4WA 3Q2ZA 3KRAA 4KPDA 3SDTA 4KKMA 3TFNA 2ZCRA 3ICKA 4RXAA 3ZOUA 4H5DF 3ID0A 3OACB 2Z7IA 4NKFA 5IKHA 5DGMF 4JVJF 4LIXA 1YJ4A 3WSBA 4LA6A 3N0GA 3RYWA 5ILJA 5H9DA 5ILYA 1VG4A 3KBKA 3VJ8A 4JXYA 5IMIA 3MZVA 4EA1A 1ZW5A 5ERMA 2ZEUA 1UBYA 3ICMA 4NFJF 4KQUA 1N1BA 4DI5A 3KB9A 2E94A 2AZJA 4HD1A 3SAEA 4LFVF 5ER8A 3WCEA 1VG6A 2AZKA 5DGSF 5JV2F 2OPMA 3RBMA 3M9UA 1HXAA 3PYBA 5E8KA 1PS1A 5HN9A 2OPNA 1WL1A 3OABB 5JV1F 3IPIA 1YHMA 3WCBA 1KIZA 5AFXA 1HXGA 2PS5A 1VG3A 3LDWA 2OGDA 3TS7A 3OACA 5HN7A 3ICZA 4DZWA 5CG5A 4GA3A 3MAVA 3P5RA 5IMNA 3WJNA 3WCDA 4DWGA 3WJOA 4RXDA 4LFGA 3RYEA 5IM1A 4EA0A 2F8ZF 3W7FA 5HN8A 2O1OA 4KK2A 5AHUB 3TFPA 3PDEA 3IBAA 1RTRA 4WK5A 4ZQ8A 4Q23A 1YYSA 3LGZB 4LOBA 2DH4A 3LGKA 2E8UA 1N1ZA 5IK9A 1DI1A 3VJAA 2Q9ZA 5JUZF 5JA0F 4GP1A 5ILIA 3N5HF 3LK5A 5IL8A 2F7MF 2Q9YA 1YYRA 3KROA 3PKOA 2ZCQA 4KVIA 1RQJA 5IMPA 1WL3A 2E8XA 5B0JA 3VJEA 4P0VA 1UBWA 3KRPB 4KVWA 1N24A 2E90A 5DIQF 1KIYA 4LLSA 4LZ3A 3WE9A 4DXJA 2F8CF 4EA2A 4H5EF 3EGTA 4DEMF 2J5CA 4LPHF 2ZY1A 4OMGA 4OMHA 5DHIA 2E8WA 1YHLA 3WCHA 2I19A 3N1VF 5E8HA 3V1VA 1YYQA 2Z4YA 4NFKF 3V1XA 4LTZA 3NPRA 3WEHA 5ILKA 3WCLA 3M00A 4P0WA 4P0XA 4FP4A 3CC9A 4GAXA 5E8LA 2RAHA 4OKMA 3N5JF 4NKEA 3NF2A 3DYHA 4XQRF 2H8OA 4LUUA 3KRPA 1WL2A 1YYUA 3NPKA 3KRCA 3RMGA 2J1OA 3N45F 3P5PA 4JYXA 5IVGA 4LTVA 5IK0A 2Z78A 1UBVA 3N3DA 2PS7A 3KRFB 5AELA 2ONHA 1JFAA 2AELA 3SDUA 3N0FA 3WEGA 4E9ZA 2PS8A 3KROB 5B03A 3ACXA 3AE0A 3ASXA 3LOMA 3WC9A 5B0MA 1N21A 3PYAA 3WEKA 5IL3A 4N1ZF 3S9VA 5DHKA 4MC8A 4OGUA 2EWGA 1HX9A 3Q2QA 2Z7HA 3VJDA 3LEEA 4KFAA 3ZMBA 2VF6A 1DGPA 3ZL6A 3BNXA 4JZXA 5HNAA 1V4IA 5DGNF 1YHKA 3WEIA 4RXCA 5B0IA 3WEFA 3KRFA 5JV0F 5ILDA 3WCIA 5AYPA 3WCFA 1WY0A 4UMJA 3OYRA 4RYPA 1WKZA 3LG5A 5IN8A 5I1UA 4QXSF 3DYGA 4XQSF 3ICNA 3M0GA 3M02A 5DJRF 3ACWA 4LLTA 1V4JA 4NUAA 5EROA 4E9UA 5IKAA 5C05A 2E91A 2AZLA 1UBXA 4KVDA 3ACYA 2F94F 3KRCB 3NRIA 3N46F 2FTZA 4RNQA 4F6XA 3AQCB 3G4FA 4LFEA 4XQTF 4RXEA 3Q30A 3WCCA 5EAUA 1HM4A 2ZCOA 3P41A 3PH7A 4LA5A 3LZ9A 2Z4VA 2Z4ZA 4QPFA 1N20A 3SDRA 3WCJA 3EZ3A 2QISA 3WJKA 2Z4XA 5B0LA 4F62A 4KQ5A 1WL0A 2ZEVA 3B7LA 3V66A 5B02A 5DJVF 4KUXA 1V4HA 3N6KF 2Z52A 5IK6A 3WCGA 4KWDA 5EASA 1N23A 3QKCA 3M01A 3ZMCA 5DJPF 5DW7A 4GP2A 2E8TA 5A0IA 4LZ0A 1YYTA 5A0JA 3EFQA 5KSXF 1HXCA 3N49F 3N1WF 3UCAA 4N9UA 4JXNA 3ADZA 3Q1OA 1RQIA 4JZBA 3AQBB 1FPSA 4MC3A 1V4EA 5B0KA 2Q80A 4LPGF 4LZCA 4E1EA 1EZFA 3DYFA 3S4JA 4DHDA 1YQ7A 3LSNA 2ONGA 3VJCA 2AETA 3LLWA 4KVYA 5DZ2A 3ZCDA 2FORA 5CG6A 4F6VA 3LMDA 1VG7A 3CKEA 3P8LA
chains in the Genus database with same CATH topology
3N3LF 4LXWA 1HM7A 2F92F 3QQVA 4KQSA 4H5CF 1YV5A 1N22A 1JFGA 3VJ9A 2PS4A 3BNYA 1WMWA 2Z50A 3LJIA 3KRAB 5B01A 4DWBA 3WCMA 4NG6A 2P1CA 1VG2A 2PS6A 3OABA 3G4DA 3TFVA 2E93A 3WSAA 3CP6A 4L2XF 2E92A 5EATA 2OA6A 3WCAA 2AEKA 2Q58A 3VJBA 4PVXF 3SDVA 5B00A 4PVYF 1V4KA 4NFIF 5A0KA 2E95A 3LVSA 5ILHA 5ILZA 2J1PA 3P8RA 4OKZA 4MC0A 3TC1A 2F89F 4FJQA 3SDQA 2F9KF 3WEJA 2ZCSA 5ERNA 2E4OA 2E8VA 4K10A 3APZA 3AQ0A 4KPJA 2Z4WA 3Q2ZA 3KRAA 4KPDA 3SDTA 4KKMA 3TFNA 2ZCRA 3ICKA 4RXAA 3ZOUA 4H5DF 3ID0A 3OACB 2Z7IA 4NKFA 5IKHA 5DGMF 4JVJF 4LIXA 1YJ4A 3WSBA 4LA6A 3N0GA 3RYWA 5ILJA 5H9DA 5ILYA 1VG4A 3KBKA 3VJ8A 4JXYA 5IMIA 3MZVA 4EA1A 1ZW5A 5ERMA 2ZEUA 1UBYA 3ICMA 4NFJF 4KQUA 1N1BA 4DI5A 3KB9A 2E94A 2AZJA 4HD1A 3SAEA 4LFVF 5ER8A 3WCEA 1VG6A 2AZKA 5DGSF 5JV2F 2OPMA 3RBMA 3M9UA 1HXAA 3PYBA 5E8KA 1PS1A 5HN9A 2OPNA 1WL1A 3OABB 5JV1F 3IPIA 1YHMA 3WCBA 1KIZA 5AFXA 1HXGA 2PS5A 1VG3A 3LDWA 2OGDA 3TS7A 3OACA 5HN7A 3ICZA 4DZWA 5CG5A 4GA3A 3MAVA 3P5RA 5IMNA 3WJNA 3WCDA 4DWGA 3WJOA 4RXDA 4LFGA 3RYEA 5IM1A 4EA0A 2F8ZF 3W7FA 5HN8A 2O1OA 4KK2A 5AHUB 3TFPA 3PDEA 3IBAA 1RTRA 4WK5A 4ZQ8A 4Q23A 1YYSA 3LGZB 4LOBA 2DH4A 3LGKA 2E8UA 1N1ZA 5IK9A 1DI1A 3VJAA 2Q9ZA 5JUZF 5JA0F 4GP1A 5ILIA 3N5HF 3LK5A 5IL8A 2F7MF 2Q9YA 1YYRA 3KROA 3PKOA 2ZCQA 4KVIA 1RQJA 5IMPA 1WL3A 2E8XA 5B0JA 3VJEA 4P0VA 1UBWA 3KRPB 4KVWA 1N24A 2E90A 5DIQF 1KIYA 4LLSA 4LZ3A 3WE9A 4DXJA 2F8CF 4EA2A 4H5EF 3EGTA 4DEMF 2J5CA 4LPHF 2ZY1A 4OMGA 4OMHA 5DHIA 2E8WA 1YHLA 3WCHA 2I19A 3N1VF 5E8HA 3V1VA 1YYQA 2Z4YA 4NFKF 3V1XA 4LTZA 3NPRA 3WEHA 5ILKA 3WCLA 3M00A 4P0WA 4P0XA 4FP4A 3CC9A 4GAXA 5E8LA 2RAHA 4OKMA 3N5JF 4NKEA 3NF2A 3DYHA 4XQRF 2H8OA 4LUUA 3KRPA 1WL2A 1YYUA 3NPKA 3KRCA 3RMGA 2J1OA 3N45F 3P5PA 4JYXA 5IVGA 4LTVA 5IK0A 2Z78A 1UBVA 3N3DA 2PS7A 3KRFB 5AELA 2ONHA 1JFAA 2AELA 3SDUA 3N0FA 3WEGA 4E9ZA 2PS8A 3KROB 5B03A 3ACXA 3AE0A 3ASXA 3LOMA 3WC9A 5B0MA 1N21A 3PYAA 3WEKA 5IL3A 4N1ZF 3S9VA 5DHKA 4MC8A 4OGUA 2EWGA 1HX9A 3Q2QA 2Z7HA 3VJDA 3LEEA 4KFAA 3ZMBA 2VF6A 1DGPA 3ZL6A 3BNXA 4JZXA 5HNAA 1V4IA 5DGNF 1YHKA 3WEIA 4RXCA 5B0IA 3WEFA 3KRFA 5JV0F 5ILDA 3WCIA 5AYPA 3WCFA 1WY0A 4UMJA 3OYRA 4RYPA 1WKZA 3LG5A 5IN8A 5I1UA 4QXSF 3DYGA 4XQSF 3ICNA 3M0GA 3M02A 5DJRF 3ACWA 4LLTA 1V4JA 4NUAA 5EROA 4E9UA 5IKAA 5C05A 2E91A 2AZLA 1UBXA 4KVDA 3ACYA 2F94F 3KRCB 3NRIA 3N46F 2FTZA 4RNQA 4F6XA 3AQCB 3G4FA 4LFEA 4XQTF 4RXEA 3Q30A 3WCCA 5EAUA 1HM4A 2ZCOA 3P41A 3PH7A 4LA5A 3LZ9A 2Z4VA 2Z4ZA 4QPFA 1N20A 3SDRA 3WCJA 3EZ3A 2QISA 3WJKA 2Z4XA 5B0LA 4F62A 4KQ5A 1WL0A 2ZEVA 3B7LA 3V66A 5B02A 5DJVF 4KUXA 1V4HA 3N6KF 2Z52A 5IK6A 3WCGA 4KWDA 5EASA 1N23A 3QKCA 3M01A 3ZMCA 5DJPF 5DW7A 4GP2A 2E8TA 5A0IA 4LZ0A 1YYTA 5A0JA 3EFQA 5KSXF 1HXCA 3N49F 3N1WF 3UCAA 4N9UA 4JXNA 3ADZA 3Q1OA 1RQIA 4JZBA 3AQBB 1FPSA 4MC3A 1V4EA 5B0KA 2Q80A 4LPGF 4LZCA 4E1EA 1EZFA 3DYFA 3S4JA 4DHDA 1YQ7A 3LSNA 2ONGA 3VJCA 2AETA 3LLWA 4KVYA 5DZ2A 3ZCDA 2FORA 5CG6A 4F6VA 3LMDA 1VG7A 3CKEA 3P8LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3L F;  4LXW A;  1HM7 A;  2F92 F;  3QQV A;  4KQS A;  4H5C F;  1YV5 A;  1N22 A;  1JFG A;  3VJ9 A;  2PS4 A;  3BNY A;  1WMW A;  2Z50 A;  3LJI A;  3KRA B;  5B01 A;  4DWB A;  3WCM A;  4NG6 A;  2P1C A;  1VG2 A;  2PS6 A;  3OAB A;  3G4D A;  3TFV A;  2E93 A;  3WSA A;  3CP6 A;  4L2X F;  2E92 A;  5EAT A;  2OA6 A;  3WCA A;  2AEK A;  2Q58 A;  3VJB A;  4PVX F;  3SDV A;  5B00 A;  4PVY F;  1V4K A;  4NFI F;  5A0K A;  2E95 A;  3LVS A;  5ILH A;  5ILZ A;  2J1P A;  3P8R A;  4OKZ A;  4MC0 A;  3TC1 A;  2F89 F;  4FJQ A;  3SDQ A;  2F9K F;  3WEJ A;  2ZCS A;  5ERN A;  2E4O A;  2E8V A;  4K10 A;  3APZ A;  3AQ0 A;  4KPJ A;  2Z4W A;  3Q2Z A;  3KRA A;  4KPD A;  3SDT A;  4KKM A;  3TFN A;  2ZCR A;  3ICK A;  4RXA A;  3ZOU A;  4H5D F;  3ID0 A;  3OAC B;  2Z7I A;  4NKF A;  5IKH A;  5DGM F;  4JVJ F;  4LIX A;  1YJ4 A;  3WSB A;  4LA6 A;  3N0G A;  3RYW A;  5ILJ A;  5H9D A;  5ILY A;  1VG4 A;  3KBK A;  3VJ8 A;  4JXY A;  5IMI A;  3MZV A;  4EA1 A;  1ZW5 A;  5ERM A;  2ZEU A;  1UBY A;  3ICM A;  4NFJ F;  4KQU A;  1N1B A;  4DI5 A;  3KB9 A;  2E94 A;  2AZJ A;  4HD1 A;  3SAE A;  4LFV F;  5ER8 A;  3WCE A;  1VG6 A;  2AZK A;  5DGS F;  5JV2 F;  2OPM A;  3RBM A;  3M9U A;  1HXA A;  3PYB A;  5E8K A;  1PS1 A;  5HN9 A;  2OPN A;  1WL1 A;  3OAB B;  5JV1 F;  3IPI A;  1YHM A;  3WCB A;  1KIZ A;  5AFX A;  1HXG A;  2PS5 A;  1VG3 A;  3LDW A;  2OGD A;  3TS7 A;  3OAC A;  5HN7 A;  3ICZ A;  4DZW A;  5CG5 A;  4GA3 A;  3MAV A;  3P5R A;  5IMN A;  3WJN A;  3WCD A;  4DWG A;  3WJO A;  4RXD A;  4LFG A;  3RYE A;  5IM1 A;  4EA0 A;  2F8Z F;  3W7F A;  5HN8 A;  2O1O A;  4KK2 A;  5AHU B;  3TFP A;  3PDE A;  3IBA A;  1RTR A;  4WK5 A;  4ZQ8 A;  4Q23 A;  1YYS A;  3LGZ B;  4LOB A;  2DH4 A;  3LGK A;  2E8U A;  1N1Z A;  5IK9 A;  1DI1 A;  3VJA A;  2Q9Z A;  5JUZ F;  5JA0 F;  4GP1 A;  5ILI A;  3N5H F;  3LK5 A;  5IL8 A;  2F7M F;  2Q9Y A;  1YYR A;  3KRO A;  3PKO A;  2ZCQ A;  4KVI A;  1RQJ A;  5IMP A;  1WL3 A;  2E8X A;  5B0J A;  3VJE A;  4P0V A;  1UBW A;  3KRP B;  4KVW A;  1N24 A;  2E90 A;  5DIQ F;  1KIY A;  4LLS A;  4LZ3 A;  3WE9 A;  4DXJ A;  2F8C F;  4EA2 A;  4H5E F;  3EGT A;  4DEM F;  2J5C A;  4LPH F;  2ZY1 A;  4OMG A;  4OMH A;  5DHI A;  2E8W A;  1YHL A;  3WCH A;  2I19 A;  3N1V F;  5E8H A;  3V1V A;  1YYQ A;  2Z4Y A;  4NFK F;  3V1X A;  4LTZ A;  3NPR A;  3WEH A;  5ILK A;  3WCL A;  3M00 A;  4P0W A;  4P0X A;  4FP4 A;  3CC9 A;  4GAX A;  5E8L A;  2RAH A;  4OKM A;  3N5J F;  4NKE A;  3NF2 A;  3DYH A;  4XQR F;  2H8O A;  4LUU A;  3KRP A;  1WL2 A;  1YYU A;  3NPK A;  3KRC A;  3RMG A;  2J1O A;  3N45 F;  3P5P A;  4JYX A;  5IVG A;  4LTV A;  5IK0 A;  2Z78 A;  1UBV A;  3N3D A;  2PS7 A;  3KRF B;  5AEL A;  2ONH A;  1JFA A;  2AEL A;  3SDU A;  3N0F A;  3WEG A;  4E9Z A;  2PS8 A;  3KRO B;  5B03 A;  3ACX A;  3AE0 A;  3ASX A;  3LOM A;  3WC9 A;  5B0M A;  1N21 A;  3PYA A;  3WEK A;  5IL3 A;  4N1Z F;  3S9V A;  5DHK A;  4MC8 A;  4OGU A;  2EWG A;  1HX9 A;  3Q2Q A;  2Z7H A;  3VJD A;  3LEE A;  4KFA A;  3ZMB A;  2VF6 A;  1DGP A;  3ZL6 A;  3BNX A;  4JZX A;  5HNA A;  1V4I A;  5DGN F;  1YHK A;  3WEI A;  4RXC A;  5B0I A;  3WEF A;  3KRF A;  5JV0 F;  5ILD A;  3WCI A;  5AYP A;  3WCF A;  1WY0 A;  4UMJ A;  3OYR A;  4RYP A;  1WKZ A;  3LG5 A;  5IN8 A;  5I1U A;  4QXS F;  3DYG A;  4XQS F;  3ICN A;  3M0G A;  3M02 A;  5DJR F;  3ACW A;  4LLT A;  1V4J A;  4NUA A;  5ERO A;  4E9U A;  5IKA A;  5C05 A;  2E91 A;  2AZL A;  1UBX A;  4KVD A;  3ACY A;  2F94 F;  3KRC B;  3NRI A;  3N46 F;  2FTZ A;  4RNQ A;  4F6X A;  3AQC B;  3G4F A;  4LFE A;  4XQT F;  4RXE A;  3Q30 A;  3WCC A;  5EAU A;  1HM4 A;  2ZCO A;  3P41 A;  3PH7 A;  4LA5 A;  3LZ9 A;  2Z4V A;  2Z4Z A;  4QPF A;  1N20 A;  3SDR A;  3WCJ A;  3EZ3 A;  2QIS A;  3WJK A;  2Z4X A;  5B0L A;  4F62 A;  4KQ5 A;  1WL0 A;  2ZEV A;  3B7L A;  3V66 A;  5B02 A;  5DJV F;  4KUX A;  1V4H A;  3N6K F;  2Z52 A;  5IK6 A;  3WCG A;  4KWD A;  5EAS A;  1N23 A;  3QKC A;  3M01 A;  3ZMC A;  5DJP F;  5DW7 A;  4GP2 A;  2E8T A;  5A0I A;  4LZ0 A;  1YYT A;  5A0J A;  3EFQ A;  5KSX F;  1HXC A;  3N49 F;  3N1W F;  3UCA A;  4N9U A;  4JXN A;  3ADZ A;  3Q1O A;  1RQI A;  4JZB A;  3AQB B;  1FPS A;  4MC3 A;  1V4E A;  5B0K A;  2Q80 A;  4LPG F;  4LZC A;  4E1E A;  1EZF A;  3DYF A;  3S4J A;  4DHD A;  1YQ7 A;  3LSN A;  2ONG A;  3VJC A;  2AET A;  3LLW A;  4KVY A;  5DZ2 A;  3ZCD A;  2FOR A;  5CG6 A;  4F6V A;  3LMD A;  1VG7 A;  3CKE A;  3P8L A; 
#chains in the Genus database with same CATH topology
 3N3L F;  4LXW A;  1HM7 A;  2F92 F;  3QQV A;  4KQS A;  4H5C F;  1YV5 A;  1N22 A;  1JFG A;  3VJ9 A;  2PS4 A;  3BNY A;  1WMW A;  2Z50 A;  3LJI A;  3KRA B;  5B01 A;  4DWB A;  3WCM A;  4NG6 A;  2P1C A;  1VG2 A;  2PS6 A;  3OAB A;  3G4D A;  3TFV A;  2E93 A;  3WSA A;  3CP6 A;  4L2X F;  2E92 A;  5EAT A;  2OA6 A;  3WCA A;  2AEK A;  2Q58 A;  3VJB A;  4PVX F;  3SDV A;  5B00 A;  4PVY F;  1V4K A;  4NFI F;  5A0K A;  2E95 A;  3LVS A;  5ILH A;  5ILZ A;  2J1P A;  3P8R A;  4OKZ A;  4MC0 A;  3TC1 A;  2F89 F;  4FJQ A;  3SDQ A;  2F9K F;  3WEJ A;  2ZCS A;  5ERN A;  2E4O A;  2E8V A;  4K10 A;  3APZ A;  3AQ0 A;  4KPJ A;  2Z4W A;  3Q2Z A;  3KRA A;  4KPD A;  3SDT A;  4KKM A;  3TFN A;  2ZCR A;  3ICK A;  4RXA A;  3ZOU A;  4H5D F;  3ID0 A;  3OAC B;  2Z7I A;  4NKF A;  5IKH A;  5DGM F;  4JVJ F;  4LIX A;  1YJ4 A;  3WSB A;  4LA6 A;  3N0G A;  3RYW A;  5ILJ A;  5H9D A;  5ILY A;  1VG4 A;  3KBK A;  3VJ8 A;  4JXY A;  5IMI A;  3MZV A;  4EA1 A;  1ZW5 A;  5ERM A;  2ZEU A;  1UBY A;  3ICM A;  4NFJ F;  4KQU A;  1N1B A;  4DI5 A;  3KB9 A;  2E94 A;  2AZJ A;  4HD1 A;  3SAE A;  4LFV F;  5ER8 A;  3WCE A;  1VG6 A;  2AZK A;  5DGS F;  5JV2 F;  2OPM A;  3RBM A;  3M9U A;  1HXA A;  3PYB A;  5E8K A;  1PS1 A;  5HN9 A;  2OPN A;  1WL1 A;  3OAB B;  5JV1 F;  3IPI A;  1YHM A;  3WCB A;  1KIZ A;  5AFX A;  1HXG A;  2PS5 A;  1VG3 A;  3LDW A;  2OGD A;  3TS7 A;  3OAC A;  5HN7 A;  3ICZ A;  4DZW A;  5CG5 A;  4GA3 A;  3MAV A;  3P5R A;  5IMN A;  3WJN A;  3WCD A;  4DWG A;  3WJO A;  4RXD A;  4LFG A;  3RYE A;  5IM1 A;  4EA0 A;  2F8Z F;  3W7F A;  5HN8 A;  2O1O A;  4KK2 A;  5AHU B;  3TFP A;  3PDE A;  3IBA A;  1RTR A;  4WK5 A;  4ZQ8 A;  4Q23 A;  1YYS A;  3LGZ B;  4LOB A;  2DH4 A;  3LGK A;  2E8U A;  1N1Z A;  5IK9 A;  1DI1 A;  3VJA A;  2Q9Z A;  5JUZ F;  5JA0 F;  4GP1 A;  5ILI A;  3N5H F;  3LK5 A;  5IL8 A;  2F7M F;  2Q9Y A;  1YYR A;  3KRO A;  3PKO A;  2ZCQ A;  4KVI A;  1RQJ A;  5IMP A;  1WL3 A;  2E8X A;  5B0J A;  3VJE A;  4P0V A;  1UBW A;  3KRP B;  4KVW A;  1N24 A;  2E90 A;  5DIQ F;  1KIY A;  4LLS A;  4LZ3 A;  3WE9 A;  4DXJ A;  2F8C F;  4EA2 A;  4H5E F;  3EGT A;  4DEM F;  2J5C A;  4LPH F;  2ZY1 A;  4OMG A;  4OMH A;  5DHI A;  2E8W A;  1YHL A;  3WCH A;  2I19 A;  3N1V F;  5E8H A;  3V1V A;  1YYQ A;  2Z4Y A;  4NFK F;  3V1X A;  4LTZ A;  3NPR A;  3WEH A;  5ILK A;  3WCL A;  3M00 A;  4P0W A;  4P0X A;  4FP4 A;  3CC9 A;  4GAX A;  5E8L A;  2RAH A;  4OKM A;  3N5J F;  4NKE A;  3NF2 A;  3DYH A;  4XQR F;  2H8O A;  4LUU A;  3KRP A;  1WL2 A;  1YYU A;  3NPK A;  3KRC A;  3RMG A;  2J1O A;  3N45 F;  3P5P A;  4JYX A;  5IVG A;  4LTV A;  5IK0 A;  2Z78 A;  1UBV A;  3N3D A;  2PS7 A;  3KRF B;  5AEL A;  2ONH A;  1JFA A;  2AEL A;  3SDU A;  3N0F A;  3WEG A;  4E9Z A;  2PS8 A;  3KRO B;  5B03 A;  3ACX A;  3AE0 A;  3ASX A;  3LOM A;  3WC9 A;  5B0M A;  1N21 A;  3PYA A;  3WEK A;  5IL3 A;  4N1Z F;  3S9V A;  5DHK A;  4MC8 A;  4OGU A;  2EWG A;  1HX9 A;  3Q2Q A;  2Z7H A;  3VJD A;  3LEE A;  4KFA A;  3ZMB A;  2VF6 A;  1DGP A;  3ZL6 A;  3BNX A;  4JZX A;  5HNA A;  1V4I A;  5DGN F;  1YHK A;  3WEI A;  4RXC A;  5B0I A;  3WEF A;  3KRF A;  5JV0 F;  5ILD A;  3WCI A;  5AYP A;  3WCF A;  1WY0 A;  4UMJ A;  3OYR A;  4RYP A;  1WKZ A;  3LG5 A;  5IN8 A;  5I1U A;  4QXS F;  3DYG A;  4XQS F;  3ICN A;  3M0G A;  3M02 A;  5DJR F;  3ACW A;  4LLT A;  1V4J A;  4NUA A;  5ERO A;  4E9U A;  5IKA A;  5C05 A;  2E91 A;  2AZL A;  1UBX A;  4KVD A;  3ACY A;  2F94 F;  3KRC B;  3NRI A;  3N46 F;  2FTZ A;  4RNQ A;  4F6X A;  3AQC B;  3G4F A;  4LFE A;  4XQT F;  4RXE A;  3Q30 A;  3WCC A;  5EAU A;  1HM4 A;  2ZCO A;  3P41 A;  3PH7 A;  4LA5 A;  3LZ9 A;  2Z4V A;  2Z4Z A;  4QPF A;  1N20 A;  3SDR A;  3WCJ A;  3EZ3 A;  2QIS A;  3WJK A;  2Z4X A;  5B0L A;  4F62 A;  4KQ5 A;  1WL0 A;  2ZEV A;  3B7L A;  3V66 A;  5B02 A;  5DJV F;  4KUX A;  1V4H A;  3N6K F;  2Z52 A;  5IK6 A;  3WCG A;  4KWD A;  5EAS A;  1N23 A;  3QKC A;  3M01 A;  3ZMC A;  5DJP F;  5DW7 A;  4GP2 A;  2E8T A;  5A0I A;  4LZ0 A;  1YYT A;  5A0J A;  3EFQ A;  5KSX F;  1HXC A;  3N49 F;  3N1W F;  3UCA A;  4N9U A;  4JXN A;  3ADZ A;  3Q1O A;  1RQI A;  4JZB A;  3AQB B;  1FPS A;  4MC3 A;  1V4E A;  5B0K A;  2Q80 A;  4LPG F;  4LZC A;  4E1E A;  1EZF A;  3DYF A;  3S4J A;  4DHD A;  1YQ7 A;  3LSN A;  2ONG A;  3VJC A;  2AET A;  3LLW A;  4KVY A;  5DZ2 A;  3ZCD A;  2FOR A;  5CG6 A;  4F6V A;  3LMD A;  1VG7 A;  3CKE A;  3P8L A; 
#chains in the Genus database with same CATH homology
 3N3L F;  4LXW A;  1HM7 A;  2F92 F;  3QQV A;  4KQS A;  4H5C F;  1YV5 A;  1N22 A;  1JFG A;  3VJ9 A;  2PS4 A;  3BNY A;  1WMW A;  2Z50 A;  3LJI A;  3KRA B;  5B01 A;  4DWB A;  3WCM A;  4NG6 A;  2P1C A;  1VG2 A;  2PS6 A;  3OAB A;  3G4D A;  3TFV A;  2E93 A;  3WSA A;  3CP6 A;  4L2X F;  2E92 A;  5EAT A;  2OA6 A;  3WCA A;  2AEK A;  2Q58 A;  3VJB A;  4PVX F;  3SDV A;  5B00 A;  4PVY F;  1V4K A;  4NFI F;  5A0K A;  2E95 A;  3LVS A;  5ILH A;  5ILZ A;  2J1P A;  3P8R A;  4OKZ A;  4MC0 A;  3TC1 A;  2F89 F;  4FJQ A;  3SDQ A;  2F9K F;  3WEJ A;  2ZCS A;  5ERN A;  2E4O A;  2E8V A;  4K10 A;  3APZ A;  3AQ0 A;  4KPJ A;  2Z4W A;  3Q2Z A;  3KRA A;  4KPD A;  3SDT A;  4KKM A;  3TFN A;  2ZCR A;  3ICK A;  4RXA A;  3ZOU A;  4H5D F;  3ID0 A;  3OAC B;  2Z7I A;  4NKF A;  5IKH A;  5DGM F;  4JVJ F;  4LIX A;  1YJ4 A;  3WSB A;  4LA6 A;  3N0G A;  3RYW A;  5ILJ A;  5H9D A;  5ILY A;  1VG4 A;  3KBK A;  3VJ8 A;  4JXY A;  5IMI A;  3MZV A;  4EA1 A;  1ZW5 A;  5ERM A;  2ZEU A;  1UBY A;  3ICM A;  4NFJ F;  4KQU A;  1N1B A;  4DI5 A;  3KB9 A;  2E94 A;  2AZJ A;  4HD1 A;  3SAE A;  4LFV F;  5ER8 A;  3WCE A;  1VG6 A;  2AZK A;  5DGS F;  5JV2 F;  2OPM A;  3RBM A;  3M9U A;  1HXA A;  3PYB A;  5E8K A;  1PS1 A;  5HN9 A;  2OPN A;  1WL1 A;  3OAB B;  5JV1 F;  3IPI A;  1YHM A;  3WCB A;  1KIZ A;  5AFX A;  1HXG A;  2PS5 A;  1VG3 A;  3LDW A;  2OGD A;  3TS7 A;  3OAC A;  5HN7 A;  3ICZ A;  4DZW A;  5CG5 A;  4GA3 A;  3MAV A;  3P5R A;  5IMN A;  3WJN A;  3WCD A;  4DWG A;  3WJO A;  4RXD A;  4LFG A;  3RYE A;  5IM1 A;  4EA0 A;  2F8Z F;  3W7F A;  5HN8 A;  2O1O A;  4KK2 A;  5AHU B;  3TFP A;  3PDE A;  3IBA A;  1RTR A;  4WK5 A;  4ZQ8 A;  4Q23 A;  1YYS A;  3LGZ B;  4LOB A;  2DH4 A;  3LGK A;  2E8U A;  1N1Z A;  5IK9 A;  1DI1 A;  3VJA A;  2Q9Z A;  5JUZ F;  5JA0 F;  4GP1 A;  5ILI A;  3N5H F;  3LK5 A;  5IL8 A;  2F7M F;  2Q9Y A;  1YYR A;  3KRO A;  3PKO A;  2ZCQ A;  4KVI A;  1RQJ A;  5IMP A;  1WL3 A;  2E8X A;  5B0J A;  3VJE A;  4P0V A;  1UBW A;  3KRP B;  4KVW A;  1N24 A;  2E90 A;  5DIQ F;  1KIY A;  4LLS A;  4LZ3 A;  3WE9 A;  4DXJ A;  2F8C F;  4EA2 A;  4H5E F;  3EGT A;  4DEM F;  2J5C A;  4LPH F;  2ZY1 A;  4OMG A;  4OMH A;  5DHI A;  2E8W A;  1YHL A;  3WCH A;  2I19 A;  3N1V F;  5E8H A;  3V1V A;  1YYQ A;  2Z4Y A;  4NFK F;  3V1X A;  4LTZ A;  3NPR A;  3WEH A;  5ILK A;  3WCL A;  3M00 A;  4P0W A;  4P0X A;  4FP4 A;  3CC9 A;  4GAX A;  5E8L A;  2RAH A;  4OKM A;  3N5J F;  4NKE A;  3NF2 A;  3DYH A;  4XQR F;  2H8O A;  4LUU A;  3KRP A;  1WL2 A;  1YYU A;  3NPK A;  3KRC A;  3RMG A;  2J1O A;  3N45 F;  3P5P A;  4JYX A;  5IVG A;  4LTV A;  5IK0 A;  2Z78 A;  1UBV A;  3N3D A;  2PS7 A;  3KRF B;  5AEL A;  2ONH A;  1JFA A;  2AEL A;  3SDU A;  3N0F A;  3WEG A;  4E9Z A;  2PS8 A;  3KRO B;  5B03 A;  3ACX A;  3AE0 A;  3ASX A;  3LOM A;  3WC9 A;  5B0M A;  1N21 A;  3PYA A;  3WEK A;  5IL3 A;  4N1Z F;  3S9V A;  5DHK A;  4MC8 A;  4OGU A;  2EWG A;  1HX9 A;  3Q2Q A;  2Z7H A;  3VJD A;  3LEE A;  4KFA A;  3ZMB A;  2VF6 A;  1DGP A;  3ZL6 A;  3BNX A;  4JZX A;  5HNA A;  1V4I A;  5DGN F;  1YHK A;  3WEI A;  4RXC A;  5B0I A;  3WEF A;  3KRF A;  5JV0 F;  5ILD A;  3WCI A;  5AYP A;  3WCF A;  1WY0 A;  4UMJ A;  3OYR A;  4RYP A;  1WKZ A;  3LG5 A;  5IN8 A;  5I1U A;  4QXS F;  3DYG A;  4XQS F;  3ICN A;  3M0G A;  3M02 A;  5DJR F;  3ACW A;  4LLT A;  1V4J A;  4NUA A;  5ERO A;  4E9U A;  5IKA A;  5C05 A;  2E91 A;  2AZL A;  1UBX A;  4KVD A;  3ACY A;  2F94 F;  3KRC B;  3NRI A;  3N46 F;  2FTZ A;  4RNQ A;  4F6X A;  3AQC B;  3G4F A;  4LFE A;  4XQT F;  4RXE A;  3Q30 A;  3WCC A;  5EAU A;  1HM4 A;  2ZCO A;  3P41 A;  3PH7 A;  4LA5 A;  3LZ9 A;  2Z4V A;  2Z4Z A;  4QPF A;  1N20 A;  3SDR A;  3WCJ A;  3EZ3 A;  2QIS A;  3WJK A;  2Z4X A;  5B0L A;  4F62 A;  4KQ5 A;  1WL0 A;  2ZEV A;  3B7L A;  3V66 A;  5B02 A;  5DJV F;  4KUX A;  1V4H A;  3N6K F;  2Z52 A;  5IK6 A;  3WCG A;  4KWD A;  5EAS A;  1N23 A;  3QKC A;  3M01 A;  3ZMC A;  5DJP F;  5DW7 A;  4GP2 A;  2E8T A;  5A0I A;  4LZ0 A;  1YYT A;  5A0J A;  3EFQ A;  5KSX F;  1HXC A;  3N49 F;  3N1W F;  3UCA A;  4N9U A;  4JXN A;  3ADZ A;  3Q1O A;  1RQI A;  4JZB A;  3AQB B;  1FPS A;  4MC3 A;  1V4E A;  5B0K A;  2Q80 A;  4LPG F;  4LZC A;  4E1E A;  1EZF A;  3DYF A;  3S4J A;  4DHD A;  1YQ7 A;  3LSN A;  2ONG A;  3VJC A;  2AET A;  3LLW A;  4KVY A;  5DZ2 A;  3ZCD A;  2FOR A;  5CG6 A;  4F6V A;  3LMD A;  1VG7 A;  3CKE A;  3P8L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...