5B0JA

Structure of moen5-sso7d fusion protein in complex with beta-undecyl maltoside
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
264
structure length
264
Chain Sequence
VDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, dna binding protein
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
total genus 118
structure length 264
sequence length 264
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b0jA00
1YHLA 1VG6A 5B00A 5IM1A 3N3DA 3ADZA 3WCFA 5IK9A 1YJ4A 2Z7HA 3B7LA 5DJVF 4LPHF 3WE9A 4OGUA 3TS7A 5DGSF 3WEGA 2O1OA 1EZFA 2ZCSA 4F6VA 2Z78A 4N9UA 3W7FA 3PYAA 3AQCB 4KVIA 4F62A 1YV5A 3CP6A 3WJKA 4JXYA 1WL2A 3M02A 3EFQA 2AZKA 3EZ3A 2E91A 3NRIA 2Z4YA 5AHUB 3OYRA 4XQTF 4WK5A 2AETA 2EWGA 5DGNF 5EATA 3N5HF 4F6XA 4GP2A 3WCJA 4JZBA 1YYTA 3RYEA 3G4DA 3RYWA 3WCCA 4KQSA 5AYPA 4KUXA 1VG4A 3WJNA 2ZCOA 1YHMA 3KRPB 4P0WA 3SDTA 1HXCA 4RXDA 3IPIA 3LK5A 1JFAA 5B0MA 5IK6A 4DHDA 3LGZB 3TC1A 4FJQA 3WEFA 3WEHA 5H9DA 2OA6A 3AE0A 2Q9YA 2F94F 2Z52A 4RXAA 1YYRA 3UCAA 3ICMA 3TFNA 3DYGA 2ZCQA 3OABB 4NUAA 5IL3A 3G4FA 1ZW5A 4KPJA 1YYSA 5ILHA 3WCDA 5B01A 5ERMA 1V4EA 3S9VA 1DI1A 3N49F 3SDVA 3N1VF 3VJAA 1YQ7A 1N1ZA 3KRAB 5AELA 3TFPA 5IN8A 2OGDA 4P0XA 4OMHA 5EASA 3KRFB 5IMNA 2ZY1A 2Z50A 4XQRF 2J1OA 4UMJA 3VJDA 3ZMCA 5DJRF 2ONHA 4NKFA 2OPNA 5A0KA 3OACA 3EGTA 2Z7IA 3WEIA 3IBAA 3ID0A 4NFKF 1FPSA 3PKOA 2E4OA 3P8LA 3LVSA 2AZLA 2Q58A 5ILZA 1UBXA 4NKEA 1WKZA 3KRFA 4LOBA 1V4KA 3ZMBA 5ILKA 4KK2A 2AELA 3ACWA 1N20A 1N21A 4RYPA 4RXEA 4QPFA 4JVJF 2E8TA 3M01A 3NF2A 4OMGA 2ZEUA 4KVDA 3V1XA 3VJCA 2E93A 5B0IA 3PH7A 4E9UA 4LIXA 3BNYA 3WEJA 2ZCRA 2ONGA 2FTZA 3ZOUA 5B0JA 1N1BA 1WMWA 4KVYA 2DH4A 2J1PA 1HXAA 3KBKA 5E8KA 3LMDA 3QQVA 3N46F 3MZVA 5JUZF 4MC8A 1WL0A 3BNXA 1YHKA 3M9UA 3PDEA 4OKZA 3KRCB 1KIYA 4LFVF 2AEKA 4P0VA 3SAEA 5DGMF 5AFXA 3WCAA 3P5RA 2Z4XA 3VJBA 3DYHA 1WY0A 2E8XA 4LZCA 2OPMA 2Q80A 3CKEA 3S4JA 5DIQF 3WC9A 3LLWA 5ILYA 3LOMA 4KFAA 4DZWA 4DXJA 1KIZA 1HX9A 4EA1A 1JFGA 3LJIA 3KRPA 2E94A 4GAXA 4LTZA 3Q1OA 1WL1A 3TFVA 2F8CF 5B03A 3APZA 1V4IA 4HD1A 3ZL6A 2PS4A 5IMIA 2Z4WA 4JYXA 3Q2ZA 3WCLA 2ZEVA 1UBWA 1PS1A 4PVYF 3WCMA 3OABA 2E90A 2AZJA 1V4JA 2I19A 2H8OA 4LA6A 5JV1F 1RQJA 3LGKA 5A0JA 3M00A 4JXNA 2P1CA 1N23A 1VG3A 4LFEA 3KRAA 5CG5A 2E8WA 5ILJA 4LZ3A 4KWDA 4KQUA 4LLSA 3N6KF 2E8VA 5IMPA 3ACXA 1YYUA 3N1WF 3ZCDA 4K10A 5HN7A 5IK0A 4LLTA 3WCIA 3LG5A 5JV2F 1UBYA 3MAVA 3P5PA 4LTVA 3SDUA 2PS5A 1RQIA 2F9KF 2FORA 4MC0A 4E1EA 2F7MF 5HN8A 1UBVA 3V66A 5KSXF 1VG7A 3V1VA 3WSBA 5JA0F 2F8ZF 4QXSF 3KROB 5B0LA 2F92F 3VJEA 4PVXF 4LFGA 1HM7A 1HXGA 3PYBA 4JZXA 2F89F 4EA2A 3P8RA 5IKAA 3LEEA 3DYFA 5CG6A 5ILIA 2Z4VA 1V4HA 4FP4A 4DEMF 4DWBA 3LSNA 4H5CF 4OKMA 3KROA 4N1ZF 4GA3A 3ICZA 5HNAA 3SDRA 4LPGF 3VJ8A 1DGPA 3N3LF 3ASXA 4DWGA 3Q2QA 1YYQA 4NG6A 4NFJF 3NPKA 4H5DF 4LUUA 3ICNA 3WCGA 5IVGA 2J5CA 2E8UA 4DI5A 5DJPF 5EROA 3RBMA 2RAHA 5EAUA 3KRCA 3QKCA 4RXCA 1WL3A 4RNQA 3WJOA 5ILDA 4KPDA 5IL8A 2PS8A 4KQ5A 5E8LA 3WCHA 2QISA 4NFIF 3WCEA 3KB9A 3N45F 4KKMA 4E9ZA 3AQ0A 5A0IA 3P41A 1VG2A 1RTRA 3RMGA 2E95A 2E92A 3LDWA 4GP1A 4KVWA 3AQBB 5B0KA 4ZQ8A 2Q9ZA 1HM4A 5DZ2A 2VF6A 3OACB 3Q30A 1N22A 5JV0F 4MC3A 5IKHA 1N24A 2PS6A 5I1UA 5C05A 4XQSF 2PS7A 5ERNA 3WCBA 3SDQA 5B02A 3LZ9A 3N0GA 5E8HA 4H5EF 4Q23A 4EA0A 4LZ0A 5HN9A 3N0FA 4L2XF 3WSAA 3VJ9A 3N5JF 3CC9A 4LXWA 3NPRA 3WEKA 4LA5A 3ACYA 3M0GA 5DHIA 5DW7A 5DHKA 5ER8A 3ICKA 2Z4ZA
chains in the Genus database with same CATH superfamily
1YHLA 1VG6A 5B00A 5IM1A 3N3DA 3ADZA 3WCFA 5IK9A 1YJ4A 2Z7HA 3B7LA 5DJVF 4LPHF 3WE9A 4OGUA 3TS7A 5DGSF 3WEGA 2O1OA 1EZFA 2ZCSA 4F6VA 2Z78A 4N9UA 3W7FA 3PYAA 3AQCB 4KVIA 4F62A 1YV5A 3CP6A 3WJKA 4JXYA 1WL2A 3M02A 3EFQA 2AZKA 3EZ3A 2E91A 3NRIA 2Z4YA 5AHUB 3OYRA 4XQTF 4WK5A 2AETA 2EWGA 5DGNF 5EATA 3N5HF 4F6XA 4GP2A 3WCJA 4JZBA 1YYTA 3RYEA 3G4DA 3RYWA 3WCCA 4KQSA 5AYPA 4KUXA 1VG4A 3WJNA 2ZCOA 1YHMA 3KRPB 4P0WA 3SDTA 1HXCA 4RXDA 3IPIA 3LK5A 1JFAA 5B0MA 5IK6A 4DHDA 3LGZB 3TC1A 4FJQA 3WEFA 3WEHA 5H9DA 2OA6A 3AE0A 2Q9YA 2F94F 2Z52A 4RXAA 1YYRA 3UCAA 3ICMA 3TFNA 3DYGA 2ZCQA 3OABB 4NUAA 5IL3A 3G4FA 1ZW5A 4KPJA 1YYSA 5ILHA 3WCDA 5B01A 5ERMA 1V4EA 3S9VA 1DI1A 3N49F 3SDVA 3N1VF 3VJAA 1YQ7A 1N1ZA 3KRAB 5AELA 3TFPA 5IN8A 2OGDA 4P0XA 4OMHA 5EASA 3KRFB 5IMNA 2ZY1A 2Z50A 4XQRF 2J1OA 4UMJA 3VJDA 3ZMCA 5DJRF 2ONHA 4NKFA 2OPNA 5A0KA 3OACA 3EGTA 2Z7IA 3WEIA 3IBAA 3ID0A 4NFKF 1FPSA 3PKOA 2E4OA 3P8LA 3LVSA 2AZLA 2Q58A 5ILZA 1UBXA 4NKEA 1WKZA 3KRFA 4LOBA 1V4KA 3ZMBA 5ILKA 4KK2A 2AELA 3ACWA 1N20A 1N21A 4RYPA 4RXEA 4QPFA 4JVJF 2E8TA 3M01A 3NF2A 4OMGA 2ZEUA 4KVDA 3V1XA 3VJCA 2E93A 5B0IA 3PH7A 4E9UA 4LIXA 3BNYA 3WEJA 2ZCRA 2ONGA 2FTZA 3ZOUA 5B0JA 1N1BA 1WMWA 4KVYA 2DH4A 2J1PA 1HXAA 3KBKA 5E8KA 3LMDA 3QQVA 3N46F 3MZVA 5JUZF 4MC8A 1WL0A 3BNXA 1YHKA 3M9UA 3PDEA 4OKZA 3KRCB 1KIYA 4LFVF 2AEKA 4P0VA 3SAEA 5DGMF 5AFXA 3WCAA 3P5RA 2Z4XA 3VJBA 3DYHA 1WY0A 2E8XA 4LZCA 2OPMA 2Q80A 3CKEA 3S4JA 5DIQF 3WC9A 3LLWA 5ILYA 3LOMA 4KFAA 4DZWA 4DXJA 1KIZA 1HX9A 4EA1A 1JFGA 3LJIA 3KRPA 2E94A 4GAXA 4LTZA 3Q1OA 1WL1A 3TFVA 2F8CF 5B03A 3APZA 1V4IA 4HD1A 3ZL6A 2PS4A 5IMIA 2Z4WA 4JYXA 3Q2ZA 3WCLA 2ZEVA 1UBWA 1PS1A 4PVYF 3WCMA 3OABA 2E90A 2AZJA 1V4JA 2I19A 2H8OA 4LA6A 5JV1F 1RQJA 3LGKA 5A0JA 3M00A 4JXNA 2P1CA 1N23A 1VG3A 4LFEA 3KRAA 5CG5A 2E8WA 5ILJA 4LZ3A 4KWDA 4KQUA 4LLSA 3N6KF 2E8VA 5IMPA 3ACXA 1YYUA 3N1WF 3ZCDA 4K10A 5HN7A 5IK0A 4LLTA 3WCIA 3LG5A 5JV2F 1UBYA 3MAVA 3P5PA 4LTVA 3SDUA 2PS5A 1RQIA 2F9KF 2FORA 4MC0A 4E1EA 2F7MF 5HN8A 1UBVA 3V66A 5KSXF 1VG7A 3V1VA 3WSBA 5JA0F 2F8ZF 4QXSF 3KROB 5B0LA 2F92F 3VJEA 4PVXF 4LFGA 1HM7A 1HXGA 3PYBA 4JZXA 2F89F 4EA2A 3P8RA 5IKAA 3LEEA 3DYFA 5CG6A 5ILIA 2Z4VA 1V4HA 4FP4A 4DEMF 4DWBA 3LSNA 4H5CF 4OKMA 3KROA 4N1ZF 4GA3A 3ICZA 5HNAA 3SDRA 4LPGF 3VJ8A 1DGPA 3N3LF 3ASXA 4DWGA 3Q2QA 1YYQA 4NG6A 4NFJF 3NPKA 4H5DF 4LUUA 3ICNA 3WCGA 5IVGA 2J5CA 2E8UA 4DI5A 5DJPF 5EROA 3RBMA 2RAHA 5EAUA 3KRCA 3QKCA 4RXCA 1WL3A 4RNQA 3WJOA 5ILDA 4KPDA 5IL8A 2PS8A 4KQ5A 5E8LA 3WCHA 2QISA 4NFIF 3WCEA 3KB9A 3N45F 4KKMA 4E9ZA 3AQ0A 5A0IA 3P41A 1VG2A 1RTRA 3RMGA 2E95A 2E92A 3LDWA 4GP1A 4KVWA 3AQBB 5B0KA 4ZQ8A 2Q9ZA 1HM4A 5DZ2A 2VF6A 3OACB 3Q30A 1N22A 5JV0F 4MC3A 5IKHA 1N24A 2PS6A 5I1UA 5C05A 4XQSF 2PS7A 5ERNA 3WCBA 3SDQA 5B02A 3LZ9A 3N0GA 5E8HA 4H5EF 4Q23A 4EA0A 4LZ0A 5HN9A 3N0FA 4L2XF 3WSAA 3VJ9A 3N5JF 3CC9A 4LXWA 3NPRA 3WEKA 4LA5A 3ACYA 3M0GA 5DHIA 5DW7A 5DHKA 5ER8A 3ICKA 2Z4ZA
chains in the Genus database with same CATH topology
1YHLA 1VG6A 5B00A 5IM1A 3N3DA 3ADZA 3WCFA 5IK9A 1YJ4A 2Z7HA 3B7LA 5DJVF 4LPHF 3WE9A 4OGUA 3TS7A 5DGSF 3WEGA 2O1OA 1EZFA 2ZCSA 4F6VA 2Z78A 4N9UA 3W7FA 3PYAA 3AQCB 4KVIA 4F62A 1YV5A 3CP6A 3WJKA 4JXYA 1WL2A 3M02A 3EFQA 2AZKA 3EZ3A 2E91A 3NRIA 2Z4YA 5AHUB 3OYRA 4XQTF 4WK5A 2AETA 2EWGA 5DGNF 5EATA 3N5HF 4F6XA 4GP2A 3WCJA 4JZBA 1YYTA 3RYEA 3G4DA 3RYWA 3WCCA 4KQSA 5AYPA 4KUXA 1VG4A 3WJNA 2ZCOA 1YHMA 3KRPB 4P0WA 3SDTA 1HXCA 4RXDA 3IPIA 3LK5A 1JFAA 5B0MA 5IK6A 4DHDA 3LGZB 3TC1A 4FJQA 3WEFA 3WEHA 5H9DA 2OA6A 3AE0A 2Q9YA 2F94F 2Z52A 4RXAA 1YYRA 3UCAA 3ICMA 3TFNA 3DYGA 2ZCQA 3OABB 4NUAA 5IL3A 3G4FA 1ZW5A 4KPJA 1YYSA 5ILHA 3WCDA 5B01A 5ERMA 1V4EA 3S9VA 1DI1A 3N49F 3SDVA 3N1VF 3VJAA 1YQ7A 1N1ZA 3KRAB 5AELA 3TFPA 5IN8A 2OGDA 4P0XA 4OMHA 5EASA 3KRFB 5IMNA 2ZY1A 2Z50A 4XQRF 2J1OA 4UMJA 3VJDA 3ZMCA 5DJRF 2ONHA 4NKFA 2OPNA 5A0KA 3OACA 3EGTA 2Z7IA 3WEIA 3IBAA 3ID0A 4NFKF 1FPSA 3PKOA 2E4OA 3P8LA 3LVSA 2AZLA 2Q58A 5ILZA 1UBXA 4NKEA 1WKZA 3KRFA 4LOBA 1V4KA 3ZMBA 5ILKA 4KK2A 2AELA 3ACWA 1N20A 1N21A 4RYPA 4RXEA 4QPFA 4JVJF 2E8TA 3M01A 3NF2A 4OMGA 2ZEUA 4KVDA 3V1XA 3VJCA 2E93A 5B0IA 3PH7A 4E9UA 4LIXA 3BNYA 3WEJA 2ZCRA 2ONGA 2FTZA 3ZOUA 5B0JA 1N1BA 1WMWA 4KVYA 2DH4A 2J1PA 1HXAA 3KBKA 5E8KA 3LMDA 3QQVA 3N46F 3MZVA 5JUZF 4MC8A 1WL0A 3BNXA 1YHKA 3M9UA 3PDEA 4OKZA 3KRCB 1KIYA 4LFVF 2AEKA 4P0VA 3SAEA 5DGMF 5AFXA 3WCAA 3P5RA 2Z4XA 3VJBA 3DYHA 1WY0A 2E8XA 4LZCA 2OPMA 2Q80A 3CKEA 3S4JA 5DIQF 3WC9A 3LLWA 5ILYA 3LOMA 4KFAA 4DZWA 4DXJA 1KIZA 1HX9A 4EA1A 1JFGA 3LJIA 3KRPA 2E94A 4GAXA 4LTZA 3Q1OA 1WL1A 3TFVA 2F8CF 5B03A 3APZA 1V4IA 4HD1A 3ZL6A 2PS4A 5IMIA 2Z4WA 4JYXA 3Q2ZA 3WCLA 2ZEVA 1UBWA 1PS1A 4PVYF 3WCMA 3OABA 2E90A 2AZJA 1V4JA 2I19A 2H8OA 4LA6A 5JV1F 1RQJA 3LGKA 5A0JA 3M00A 4JXNA 2P1CA 1N23A 1VG3A 4LFEA 3KRAA 5CG5A 2E8WA 5ILJA 4LZ3A 4KWDA 4KQUA 4LLSA 3N6KF 2E8VA 5IMPA 3ACXA 1YYUA 3N1WF 3ZCDA 4K10A 5HN7A 5IK0A 4LLTA 3WCIA 3LG5A 5JV2F 1UBYA 3MAVA 3P5PA 4LTVA 3SDUA 2PS5A 1RQIA 2F9KF 2FORA 4MC0A 4E1EA 2F7MF 5HN8A 1UBVA 3V66A 5KSXF 1VG7A 3V1VA 3WSBA 5JA0F 2F8ZF 4QXSF 3KROB 5B0LA 2F92F 3VJEA 4PVXF 4LFGA 1HM7A 1HXGA 3PYBA 4JZXA 2F89F 4EA2A 3P8RA 5IKAA 3LEEA 3DYFA 5CG6A 5ILIA 2Z4VA 1V4HA 4FP4A 4DEMF 4DWBA 3LSNA 4H5CF 4OKMA 3KROA 4N1ZF 4GA3A 3ICZA 5HNAA 3SDRA 4LPGF 3VJ8A 1DGPA 3N3LF 3ASXA 4DWGA 3Q2QA 1YYQA 4NG6A 4NFJF 3NPKA 4H5DF 4LUUA 3ICNA 3WCGA 5IVGA 2J5CA 2E8UA 4DI5A 5DJPF 5EROA 3RBMA 2RAHA 5EAUA 3KRCA 3QKCA 4RXCA 1WL3A 4RNQA 3WJOA 5ILDA 4KPDA 5IL8A 2PS8A 4KQ5A 5E8LA 3WCHA 2QISA 4NFIF 3WCEA 3KB9A 3N45F 4KKMA 4E9ZA 3AQ0A 5A0IA 3P41A 1VG2A 1RTRA 3RMGA 2E95A 2E92A 3LDWA 4GP1A 4KVWA 3AQBB 5B0KA 4ZQ8A 2Q9ZA 1HM4A 5DZ2A 2VF6A 3OACB 3Q30A 1N22A 5JV0F 4MC3A 5IKHA 1N24A 2PS6A 5I1UA 5C05A 4XQSF 2PS7A 5ERNA 3WCBA 3SDQA 5B02A 3LZ9A 3N0GA 5E8HA 4H5EF 4Q23A 4EA0A 4LZ0A 5HN9A 3N0FA 4L2XF 3WSAA 3VJ9A 3N5JF 3CC9A 4LXWA 3NPRA 3WEKA 4LA5A 3ACYA 3M0GA 5DHIA 5DW7A 5DHKA 5ER8A 3ICKA 2Z4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHL A;  1VG6 A;  5B00 A;  5IM1 A;  3N3D A;  3ADZ A;  3WCF A;  5IK9 A;  1YJ4 A;  2Z7H A;  3B7L A;  5DJV F;  4LPH F;  3WE9 A;  4OGU A;  3TS7 A;  5DGS F;  3WEG A;  2O1O A;  1EZF A;  2ZCS A;  4F6V A;  2Z78 A;  4N9U A;  3W7F A;  3PYA A;  3AQC B;  4KVI A;  4F62 A;  1YV5 A;  3CP6 A;  3WJK A;  4JXY A;  1WL2 A;  3M02 A;  3EFQ A;  2AZK A;  3EZ3 A;  2E91 A;  3NRI A;  2Z4Y A;  5AHU B;  3OYR A;  4XQT F;  4WK5 A;  2AET A;  2EWG A;  5DGN F;  5EAT A;  3N5H F;  4F6X A;  4GP2 A;  3WCJ A;  4JZB A;  1YYT A;  3RYE A;  3G4D A;  3RYW A;  3WCC A;  4KQS A;  5AYP A;  4KUX A;  1VG4 A;  3WJN A;  2ZCO A;  1YHM A;  3KRP B;  4P0W A;  3SDT A;  1HXC A;  4RXD A;  3IPI A;  3LK5 A;  1JFA A;  5B0M A;  5IK6 A;  4DHD A;  3LGZ B;  3TC1 A;  4FJQ A;  3WEF A;  3WEH A;  5H9D A;  2OA6 A;  3AE0 A;  2Q9Y A;  2F94 F;  2Z52 A;  4RXA A;  1YYR A;  3UCA A;  3ICM A;  3TFN A;  3DYG A;  2ZCQ A;  3OAB B;  4NUA A;  5IL3 A;  3G4F A;  1ZW5 A;  4KPJ A;  1YYS A;  5ILH A;  3WCD A;  5B01 A;  5ERM A;  1V4E A;  3S9V A;  1DI1 A;  3N49 F;  3SDV A;  3N1V F;  3VJA A;  1YQ7 A;  1N1Z A;  3KRA B;  5AEL A;  3TFP A;  5IN8 A;  2OGD A;  4P0X A;  4OMH A;  5EAS A;  3KRF B;  5IMN A;  2ZY1 A;  2Z50 A;  4XQR F;  2J1O A;  4UMJ A;  3VJD A;  3ZMC A;  5DJR F;  2ONH A;  4NKF A;  2OPN A;  5A0K A;  3OAC A;  3EGT A;  2Z7I A;  3WEI A;  3IBA A;  3ID0 A;  4NFK F;  1FPS A;  3PKO A;  2E4O A;  3P8L A;  3LVS A;  2AZL A;  2Q58 A;  5ILZ A;  1UBX A;  4NKE A;  1WKZ A;  3KRF A;  4LOB A;  1V4K A;  3ZMB A;  5ILK A;  4KK2 A;  2AEL A;  3ACW A;  1N20 A;  1N21 A;  4RYP A;  4RXE A;  4QPF A;  4JVJ F;  2E8T A;  3M01 A;  3NF2 A;  4OMG A;  2ZEU A;  4KVD A;  3V1X A;  3VJC A;  2E93 A;  5B0I A;  3PH7 A;  4E9U A;  4LIX A;  3BNY A;  3WEJ A;  2ZCR A;  2ONG A;  2FTZ A;  3ZOU A;  5B0J A;  1N1B A;  1WMW A;  4KVY A;  2DH4 A;  2J1P A;  1HXA A;  3KBK A;  5E8K A;  3LMD A;  3QQV A;  3N46 F;  3MZV A;  5JUZ F;  4MC8 A;  1WL0 A;  3BNX A;  1YHK A;  3M9U A;  3PDE A;  4OKZ A;  3KRC B;  1KIY A;  4LFV F;  2AEK A;  4P0V A;  3SAE A;  5DGM F;  5AFX A;  3WCA A;  3P5R A;  2Z4X A;  3VJB A;  3DYH A;  1WY0 A;  2E8X A;  4LZC A;  2OPM A;  2Q80 A;  3CKE A;  3S4J A;  5DIQ F;  3WC9 A;  3LLW A;  5ILY A;  3LOM A;  4KFA A;  4DZW A;  4DXJ A;  1KIZ A;  1HX9 A;  4EA1 A;  1JFG A;  3LJI A;  3KRP A;  2E94 A;  4GAX A;  4LTZ A;  3Q1O A;  1WL1 A;  3TFV A;  2F8C F;  5B03 A;  3APZ A;  1V4I A;  4HD1 A;  3ZL6 A;  2PS4 A;  5IMI A;  2Z4W A;  4JYX A;  3Q2Z A;  3WCL A;  2ZEV A;  1UBW A;  1PS1 A;  4PVY F;  3WCM A;  3OAB A;  2E90 A;  2AZJ A;  1V4J A;  2I19 A;  2H8O A;  4LA6 A;  5JV1 F;  1RQJ A;  3LGK A;  5A0J A;  3M00 A;  4JXN A;  2P1C A;  1N23 A;  1VG3 A;  4LFE A;  3KRA A;  5CG5 A;  2E8W A;  5ILJ A;  4LZ3 A;  4KWD A;  4KQU A;  4LLS A;  3N6K F;  2E8V A;  5IMP A;  3ACX A;  1YYU A;  3N1W F;  3ZCD A;  4K10 A;  5HN7 A;  5IK0 A;  4LLT A;  3WCI A;  3LG5 A;  5JV2 F;  1UBY A;  3MAV A;  3P5P A;  4LTV A;  3SDU A;  2PS5 A;  1RQI A;  2F9K F;  2FOR A;  4MC0 A;  4E1E A;  2F7M F;  5HN8 A;  1UBV A;  3V66 A;  5KSX F;  1VG7 A;  3V1V A;  3WSB A;  5JA0 F;  2F8Z F;  4QXS F;  3KRO B;  5B0L A;  2F92 F;  3VJE A;  4PVX F;  4LFG A;  1HM7 A;  1HXG A;  3PYB A;  4JZX A;  2F89 F;  4EA2 A;  3P8R A;  5IKA A;  3LEE A;  3DYF A;  5CG6 A;  5ILI A;  2Z4V A;  1V4H A;  4FP4 A;  4DEM F;  4DWB A;  3LSN A;  4H5C F;  4OKM A;  3KRO A;  4N1Z F;  4GA3 A;  3ICZ A;  5HNA A;  3SDR A;  4LPG F;  3VJ8 A;  1DGP A;  3N3L F;  3ASX A;  4DWG A;  3Q2Q A;  1YYQ A;  4NG6 A;  4NFJ F;  3NPK A;  4H5D F;  4LUU A;  3ICN A;  3WCG A;  5IVG A;  2J5C A;  2E8U A;  4DI5 A;  5DJP F;  5ERO A;  3RBM A;  2RAH A;  5EAU A;  3KRC A;  3QKC A;  4RXC A;  1WL3 A;  4RNQ A;  3WJO A;  5ILD A;  4KPD A;  5IL8 A;  2PS8 A;  4KQ5 A;  5E8L A;  3WCH A;  2QIS A;  4NFI F;  3WCE A;  3KB9 A;  3N45 F;  4KKM A;  4E9Z A;  3AQ0 A;  5A0I A;  3P41 A;  1VG2 A;  1RTR A;  3RMG A;  2E95 A;  2E92 A;  3LDW A;  4GP1 A;  4KVW A;  3AQB B;  5B0K A;  4ZQ8 A;  2Q9Z A;  1HM4 A;  5DZ2 A;  2VF6 A;  3OAC B;  3Q30 A;  1N22 A;  5JV0 F;  4MC3 A;  5IKH A;  1N24 A;  2PS6 A;  5I1U A;  5C05 A;  4XQS F;  2PS7 A;  5ERN A;  3WCB A;  3SDQ A;  5B02 A;  3LZ9 A;  3N0G A;  5E8H A;  4H5E F;  4Q23 A;  4EA0 A;  4LZ0 A;  5HN9 A;  3N0F A;  4L2X F;  3WSA A;  3VJ9 A;  3N5J F;  3CC9 A;  4LXW A;  3NPR A;  3WEK A;  4LA5 A;  3ACY A;  3M0G A;  5DHI A;  5DW7 A;  5DHK A;  5ER8 A;  3ICK A;  2Z4Z A; 
#chains in the Genus database with same CATH topology
 1YHL A;  1VG6 A;  5B00 A;  5IM1 A;  3N3D A;  3ADZ A;  3WCF A;  5IK9 A;  1YJ4 A;  2Z7H A;  3B7L A;  5DJV F;  4LPH F;  3WE9 A;  4OGU A;  3TS7 A;  5DGS F;  3WEG A;  2O1O A;  1EZF A;  2ZCS A;  4F6V A;  2Z78 A;  4N9U A;  3W7F A;  3PYA A;  3AQC B;  4KVI A;  4F62 A;  1YV5 A;  3CP6 A;  3WJK A;  4JXY A;  1WL2 A;  3M02 A;  3EFQ A;  2AZK A;  3EZ3 A;  2E91 A;  3NRI A;  2Z4Y A;  5AHU B;  3OYR A;  4XQT F;  4WK5 A;  2AET A;  2EWG A;  5DGN F;  5EAT A;  3N5H F;  4F6X A;  4GP2 A;  3WCJ A;  4JZB A;  1YYT A;  3RYE A;  3G4D A;  3RYW A;  3WCC A;  4KQS A;  5AYP A;  4KUX A;  1VG4 A;  3WJN A;  2ZCO A;  1YHM A;  3KRP B;  4P0W A;  3SDT A;  1HXC A;  4RXD A;  3IPI A;  3LK5 A;  1JFA A;  5B0M A;  5IK6 A;  4DHD A;  3LGZ B;  3TC1 A;  4FJQ A;  3WEF A;  3WEH A;  5H9D A;  2OA6 A;  3AE0 A;  2Q9Y A;  2F94 F;  2Z52 A;  4RXA A;  1YYR A;  3UCA A;  3ICM A;  3TFN A;  3DYG A;  2ZCQ A;  3OAB B;  4NUA A;  5IL3 A;  3G4F A;  1ZW5 A;  4KPJ A;  1YYS A;  5ILH A;  3WCD A;  5B01 A;  5ERM A;  1V4E A;  3S9V A;  1DI1 A;  3N49 F;  3SDV A;  3N1V F;  3VJA A;  1YQ7 A;  1N1Z A;  3KRA B;  5AEL A;  3TFP A;  5IN8 A;  2OGD A;  4P0X A;  4OMH A;  5EAS A;  3KRF B;  5IMN A;  2ZY1 A;  2Z50 A;  4XQR F;  2J1O A;  4UMJ A;  3VJD A;  3ZMC A;  5DJR F;  2ONH A;  4NKF A;  2OPN A;  5A0K A;  3OAC A;  3EGT A;  2Z7I A;  3WEI A;  3IBA A;  3ID0 A;  4NFK F;  1FPS A;  3PKO A;  2E4O A;  3P8L A;  3LVS A;  2AZL A;  2Q58 A;  5ILZ A;  1UBX A;  4NKE A;  1WKZ A;  3KRF A;  4LOB A;  1V4K A;  3ZMB A;  5ILK A;  4KK2 A;  2AEL A;  3ACW A;  1N20 A;  1N21 A;  4RYP A;  4RXE A;  4QPF A;  4JVJ F;  2E8T A;  3M01 A;  3NF2 A;  4OMG A;  2ZEU A;  4KVD A;  3V1X A;  3VJC A;  2E93 A;  5B0I A;  3PH7 A;  4E9U A;  4LIX A;  3BNY A;  3WEJ A;  2ZCR A;  2ONG A;  2FTZ A;  3ZOU A;  5B0J A;  1N1B A;  1WMW A;  4KVY A;  2DH4 A;  2J1P A;  1HXA A;  3KBK A;  5E8K A;  3LMD A;  3QQV A;  3N46 F;  3MZV A;  5JUZ F;  4MC8 A;  1WL0 A;  3BNX A;  1YHK A;  3M9U A;  3PDE A;  4OKZ A;  3KRC B;  1KIY A;  4LFV F;  2AEK A;  4P0V A;  3SAE A;  5DGM F;  5AFX A;  3WCA A;  3P5R A;  2Z4X A;  3VJB A;  3DYH A;  1WY0 A;  2E8X A;  4LZC A;  2OPM A;  2Q80 A;  3CKE A;  3S4J A;  5DIQ F;  3WC9 A;  3LLW A;  5ILY A;  3LOM A;  4KFA A;  4DZW A;  4DXJ A;  1KIZ A;  1HX9 A;  4EA1 A;  1JFG A;  3LJI A;  3KRP A;  2E94 A;  4GAX A;  4LTZ A;  3Q1O A;  1WL1 A;  3TFV A;  2F8C F;  5B03 A;  3APZ A;  1V4I A;  4HD1 A;  3ZL6 A;  2PS4 A;  5IMI A;  2Z4W A;  4JYX A;  3Q2Z A;  3WCL A;  2ZEV A;  1UBW A;  1PS1 A;  4PVY F;  3WCM A;  3OAB A;  2E90 A;  2AZJ A;  1V4J A;  2I19 A;  2H8O A;  4LA6 A;  5JV1 F;  1RQJ A;  3LGK A;  5A0J A;  3M00 A;  4JXN A;  2P1C A;  1N23 A;  1VG3 A;  4LFE A;  3KRA A;  5CG5 A;  2E8W A;  5ILJ A;  4LZ3 A;  4KWD A;  4KQU A;  4LLS A;  3N6K F;  2E8V A;  5IMP A;  3ACX A;  1YYU A;  3N1W F;  3ZCD A;  4K10 A;  5HN7 A;  5IK0 A;  4LLT A;  3WCI A;  3LG5 A;  5JV2 F;  1UBY A;  3MAV A;  3P5P A;  4LTV A;  3SDU A;  2PS5 A;  1RQI A;  2F9K F;  2FOR A;  4MC0 A;  4E1E A;  2F7M F;  5HN8 A;  1UBV A;  3V66 A;  5KSX F;  1VG7 A;  3V1V A;  3WSB A;  5JA0 F;  2F8Z F;  4QXS F;  3KRO B;  5B0L A;  2F92 F;  3VJE A;  4PVX F;  4LFG A;  1HM7 A;  1HXG A;  3PYB A;  4JZX A;  2F89 F;  4EA2 A;  3P8R A;  5IKA A;  3LEE A;  3DYF A;  5CG6 A;  5ILI A;  2Z4V A;  1V4H A;  4FP4 A;  4DEM F;  4DWB A;  3LSN A;  4H5C F;  4OKM A;  3KRO A;  4N1Z F;  4GA3 A;  3ICZ A;  5HNA A;  3SDR A;  4LPG F;  3VJ8 A;  1DGP A;  3N3L F;  3ASX A;  4DWG A;  3Q2Q A;  1YYQ A;  4NG6 A;  4NFJ F;  3NPK A;  4H5D F;  4LUU A;  3ICN A;  3WCG A;  5IVG A;  2J5C A;  2E8U A;  4DI5 A;  5DJP F;  5ERO A;  3RBM A;  2RAH A;  5EAU A;  3KRC A;  3QKC A;  4RXC A;  1WL3 A;  4RNQ A;  3WJO A;  5ILD A;  4KPD A;  5IL8 A;  2PS8 A;  4KQ5 A;  5E8L A;  3WCH A;  2QIS A;  4NFI F;  3WCE A;  3KB9 A;  3N45 F;  4KKM A;  4E9Z A;  3AQ0 A;  5A0I A;  3P41 A;  1VG2 A;  1RTR A;  3RMG A;  2E95 A;  2E92 A;  3LDW A;  4GP1 A;  4KVW A;  3AQB B;  5B0K A;  4ZQ8 A;  2Q9Z A;  1HM4 A;  5DZ2 A;  2VF6 A;  3OAC B;  3Q30 A;  1N22 A;  5JV0 F;  4MC3 A;  5IKH A;  1N24 A;  2PS6 A;  5I1U A;  5C05 A;  4XQS F;  2PS7 A;  5ERN A;  3WCB A;  3SDQ A;  5B02 A;  3LZ9 A;  3N0G A;  5E8H A;  4H5E F;  4Q23 A;  4EA0 A;  4LZ0 A;  5HN9 A;  3N0F A;  4L2X F;  3WSA A;  3VJ9 A;  3N5J F;  3CC9 A;  4LXW A;  3NPR A;  3WEK A;  4LA5 A;  3ACY A;  3M0G A;  5DHI A;  5DW7 A;  5DHK A;  5ER8 A;  3ICK A;  2Z4Z A; 
#chains in the Genus database with same CATH homology
 1YHL A;  1VG6 A;  5B00 A;  5IM1 A;  3N3D A;  3ADZ A;  3WCF A;  5IK9 A;  1YJ4 A;  2Z7H A;  3B7L A;  5DJV F;  4LPH F;  3WE9 A;  4OGU A;  3TS7 A;  5DGS F;  3WEG A;  2O1O A;  1EZF A;  2ZCS A;  4F6V A;  2Z78 A;  4N9U A;  3W7F A;  3PYA A;  3AQC B;  4KVI A;  4F62 A;  1YV5 A;  3CP6 A;  3WJK A;  4JXY A;  1WL2 A;  3M02 A;  3EFQ A;  2AZK A;  3EZ3 A;  2E91 A;  3NRI A;  2Z4Y A;  5AHU B;  3OYR A;  4XQT F;  4WK5 A;  2AET A;  2EWG A;  5DGN F;  5EAT A;  3N5H F;  4F6X A;  4GP2 A;  3WCJ A;  4JZB A;  1YYT A;  3RYE A;  3G4D A;  3RYW A;  3WCC A;  4KQS A;  5AYP A;  4KUX A;  1VG4 A;  3WJN A;  2ZCO A;  1YHM A;  3KRP B;  4P0W A;  3SDT A;  1HXC A;  4RXD A;  3IPI A;  3LK5 A;  1JFA A;  5B0M A;  5IK6 A;  4DHD A;  3LGZ B;  3TC1 A;  4FJQ A;  3WEF A;  3WEH A;  5H9D A;  2OA6 A;  3AE0 A;  2Q9Y A;  2F94 F;  2Z52 A;  4RXA A;  1YYR A;  3UCA A;  3ICM A;  3TFN A;  3DYG A;  2ZCQ A;  3OAB B;  4NUA A;  5IL3 A;  3G4F A;  1ZW5 A;  4KPJ A;  1YYS A;  5ILH A;  3WCD A;  5B01 A;  5ERM A;  1V4E A;  3S9V A;  1DI1 A;  3N49 F;  3SDV A;  3N1V F;  3VJA A;  1YQ7 A;  1N1Z A;  3KRA B;  5AEL A;  3TFP A;  5IN8 A;  2OGD A;  4P0X A;  4OMH A;  5EAS A;  3KRF B;  5IMN A;  2ZY1 A;  2Z50 A;  4XQR F;  2J1O A;  4UMJ A;  3VJD A;  3ZMC A;  5DJR F;  2ONH A;  4NKF A;  2OPN A;  5A0K A;  3OAC A;  3EGT A;  2Z7I A;  3WEI A;  3IBA A;  3ID0 A;  4NFK F;  1FPS A;  3PKO A;  2E4O A;  3P8L A;  3LVS A;  2AZL A;  2Q58 A;  5ILZ A;  1UBX A;  4NKE A;  1WKZ A;  3KRF A;  4LOB A;  1V4K A;  3ZMB A;  5ILK A;  4KK2 A;  2AEL A;  3ACW A;  1N20 A;  1N21 A;  4RYP A;  4RXE A;  4QPF A;  4JVJ F;  2E8T A;  3M01 A;  3NF2 A;  4OMG A;  2ZEU A;  4KVD A;  3V1X A;  3VJC A;  2E93 A;  5B0I A;  3PH7 A;  4E9U A;  4LIX A;  3BNY A;  3WEJ A;  2ZCR A;  2ONG A;  2FTZ A;  3ZOU A;  5B0J A;  1N1B A;  1WMW A;  4KVY A;  2DH4 A;  2J1P A;  1HXA A;  3KBK A;  5E8K A;  3LMD A;  3QQV A;  3N46 F;  3MZV A;  5JUZ F;  4MC8 A;  1WL0 A;  3BNX A;  1YHK A;  3M9U A;  3PDE A;  4OKZ A;  3KRC B;  1KIY A;  4LFV F;  2AEK A;  4P0V A;  3SAE A;  5DGM F;  5AFX A;  3WCA A;  3P5R A;  2Z4X A;  3VJB A;  3DYH A;  1WY0 A;  2E8X A;  4LZC A;  2OPM A;  2Q80 A;  3CKE A;  3S4J A;  5DIQ F;  3WC9 A;  3LLW A;  5ILY A;  3LOM A;  4KFA A;  4DZW A;  4DXJ A;  1KIZ A;  1HX9 A;  4EA1 A;  1JFG A;  3LJI A;  3KRP A;  2E94 A;  4GAX A;  4LTZ A;  3Q1O A;  1WL1 A;  3TFV A;  2F8C F;  5B03 A;  3APZ A;  1V4I A;  4HD1 A;  3ZL6 A;  2PS4 A;  5IMI A;  2Z4W A;  4JYX A;  3Q2Z A;  3WCL A;  2ZEV A;  1UBW A;  1PS1 A;  4PVY F;  3WCM A;  3OAB A;  2E90 A;  2AZJ A;  1V4J A;  2I19 A;  2H8O A;  4LA6 A;  5JV1 F;  1RQJ A;  3LGK A;  5A0J A;  3M00 A;  4JXN A;  2P1C A;  1N23 A;  1VG3 A;  4LFE A;  3KRA A;  5CG5 A;  2E8W A;  5ILJ A;  4LZ3 A;  4KWD A;  4KQU A;  4LLS A;  3N6K F;  2E8V A;  5IMP A;  3ACX A;  1YYU A;  3N1W F;  3ZCD A;  4K10 A;  5HN7 A;  5IK0 A;  4LLT A;  3WCI A;  3LG5 A;  5JV2 F;  1UBY A;  3MAV A;  3P5P A;  4LTV A;  3SDU A;  2PS5 A;  1RQI A;  2F9K F;  2FOR A;  4MC0 A;  4E1E A;  2F7M F;  5HN8 A;  1UBV A;  3V66 A;  5KSX F;  1VG7 A;  3V1V A;  3WSB A;  5JA0 F;  2F8Z F;  4QXS F;  3KRO B;  5B0L A;  2F92 F;  3VJE A;  4PVX F;  4LFG A;  1HM7 A;  1HXG A;  3PYB A;  4JZX A;  2F89 F;  4EA2 A;  3P8R A;  5IKA A;  3LEE A;  3DYF A;  5CG6 A;  5ILI A;  2Z4V A;  1V4H A;  4FP4 A;  4DEM F;  4DWB A;  3LSN A;  4H5C F;  4OKM A;  3KRO A;  4N1Z F;  4GA3 A;  3ICZ A;  5HNA A;  3SDR A;  4LPG F;  3VJ8 A;  1DGP A;  3N3L F;  3ASX A;  4DWG A;  3Q2Q A;  1YYQ A;  4NG6 A;  4NFJ F;  3NPK A;  4H5D F;  4LUU A;  3ICN A;  3WCG A;  5IVG A;  2J5C A;  2E8U A;  4DI5 A;  5DJP F;  5ERO A;  3RBM A;  2RAH A;  5EAU A;  3KRC A;  3QKC A;  4RXC A;  1WL3 A;  4RNQ A;  3WJO A;  5ILD A;  4KPD A;  5IL8 A;  2PS8 A;  4KQ5 A;  5E8L A;  3WCH A;  2QIS A;  4NFI F;  3WCE A;  3KB9 A;  3N45 F;  4KKM A;  4E9Z A;  3AQ0 A;  5A0I A;  3P41 A;  1VG2 A;  1RTR A;  3RMG A;  2E95 A;  2E92 A;  3LDW A;  4GP1 A;  4KVW A;  3AQB B;  5B0K A;  4ZQ8 A;  2Q9Z A;  1HM4 A;  5DZ2 A;  2VF6 A;  3OAC B;  3Q30 A;  1N22 A;  5JV0 F;  4MC3 A;  5IKH A;  1N24 A;  2PS6 A;  5I1U A;  5C05 A;  4XQS F;  2PS7 A;  5ERN A;  3WCB A;  3SDQ A;  5B02 A;  3LZ9 A;  3N0G A;  5E8H A;  4H5E F;  4Q23 A;  4EA0 A;  4LZ0 A;  5HN9 A;  3N0F A;  4L2X F;  3WSA A;  3VJ9 A;  3N5J F;  3CC9 A;  4LXW A;  3NPR A;  3WEK A;  4LA5 A;  3ACY A;  3M0G A;  5DHI A;  5DW7 A;  5DHK A;  5ER8 A;  3ICK A;  2Z4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...