4HD1A

Crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
263
structure length
263
Chain Sequence
NAMGSVPVELRGDFEVCRRLTRSHYENFSVVSLFVPRHLRPHFYSVYAFCRGVDDLGDEFAGDRMAALDAYEEELRRAFAGEATTPAFRALQFTIATCNLPMEPFLRLIEANRRDQRKHTYDTWEDLRDYCRYSADPVGRLVLGIFGCLDDERARLSDATCTALQVANHMQDIDRDLALGRIYVPRADLEQFGATLDDIRARRATDGVRRCIALEVDRAQALFDEGRRLESLVPPRLARQLKLYRLGGEAILAAIRRQGYNPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Squalene synthase HpnC
publication title Crystal structure of squalene synthase HpnC from Alicyclobacillus acidocaldarius
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
molecule tags Transferase
total genus 103
structure length 263
sequence length 263
ec nomenclature ec 2.5.1.32: 15-cis-phytoene synthase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4hd1A00
3KROB 2Z4VA 1VG4A 3LDWA 3OABB 4MC8A 1UBXA 4LIXA 5ILDA 3ACXA 2ONGA 1WKZA 1N21A 3ICNA 2E8VA 4DEMF 3NPRA 2OA6A 3KRAB 4E9UA 5IL3A 2Z78A 5EASA 3NRIA 5JV1F 5ILYA 5E8LA 3Q30A 3RYWA 3AQBB 3S4JA 4F6VA 3N0FA 5IKAA 5DIQF 3WSBA 2Z4YA 5I1UA 3MAVA 2E8XA 1HM7A 3WJNA 4XQSF 2PS7A 4RXCA 4KQ5A 3TFVA 1JFAA 3WJKA 4PVXF 1WL2A 2QISA 3V1VA 5HN9A 3S9VA 2F7MF 4DWGA 1ZW5A 3WCFA 4KVYA 5IK6A 4LTZA 1N23A 5IMPA 1YYSA 2AELA 4P0VA 4LZ3A 3NF2A 3ZMBA 3ACWA 3UCAA 3KRFB 4ZQ8A 3CC9A 5KSXF 3AQCB 3WEKA 3LOMA 2Z50A 4Q23A 4RXAA 5ILIA 4EA0A 4JZBA 5DJPF 5HNAA 4WK5A 2E94A 4DI5A 4LFGA 4LZ0A 5AYPA 1N1ZA 2Z4XA 3KROA 5IM1A 4KVWA 2OPMA 5AHUB 3WCHA 4DHDA 5IMNA 1VG6A 4MC3A 3LGKA 4JVJF 3WEIA 3KRAA 5DZ2A 2ONHA 3P41A 2E92A 3WCDA 4XQRF 5B00A 3WEHA 3LSNA 2FORA 5E8HA 3Q1OA 4PVYF 3KRPB 5HN7A 2E8TA 4JZXA 1YJ4A 2F8CF 4H5CF 3N0GA 2H8OA 4KPJA 3VJBA 3AQ0A 1UBWA 5IMIA 3N3LF 4LA5A 1YYQA 4N9UA 1N24A 2DH4A 2PS5A 3EGTA 4GA3A 4RXEA 4GP2A 3N5HF 3PYAA 3V66A 3WCBA 4NG6A 3TFNA 5B03A 4OKZA 5ILZA 3ID0A 3ZL6A 4NUAA 4XQTF 5DHIA 3KRFA 2E91A 3ACYA 4NKFA 3P8LA 3EZ3A 2Q58A 5DJRF 3WEGA 4H5EF 3VJAA 1V4IA 3LEEA 3VJ8A 1V4JA 3SAEA 3WCGA 3LLWA 2E93A 4LFEA 3QQVA 1UBYA 3N46F 4DXJA 4FP4A 4KUXA 1N22A 2AZJA 2Q9ZA 1N1BA 3KRCA 1RQIA 3VJCA 2ZEVA 1HM4A 3WCJA 3SDRA 3N49F 3LGZB 3KRPA 5IK0A 3WEFA 1WMWA 5A0IA 4KVDA 4F62A 3M9UA 3P5RA 4OMGA 3APZA 5ILKA 3WCAA 3VJ9A 3WEJA 2E90A 1EZFA 4KQSA 3KBKA 5IKHA 1WY0A 3MZVA 5EAUA 5CG5A 4E1EA 5B01A 1N20A 2ZCQA 5IVGA 3VJEA 3PKOA 3Q2ZA 2E95A 4NFJF 4LPHF 4NFIF 2F94F 1KIYA 3NPKA 4FJQA 3ICMA 1VG7A 2F89F 4RNQA 4KWDA 1WL1A 3ZCDA 5H9DA 3SDUA 4GAXA 2Z7HA 3KRCB 1YHMA 5HN8A 2RAHA 3TC1A 3ASXA 3SDTA 2J1OA 5B02A 3CP6A 3CKEA 1JFGA 5B0LA 3RYEA 5DW7A 5EATA 4KQUA 3DYHA 1YYRA 3P5PA 3AE0A 1WL3A 2AZLA 4P0XA 5JUZF 2Q80A 4JXNA 4LTVA 5ERMA 3ZMCA 1YQ7A 4K10A 5ERNA 5CG6A 5DJVF 4KPDA 3SDVA 5JA0F 4NFKF 3RMGA 3LJIA 4JXYA 2AETA 3IPIA 3V1XA 1HXGA 3N45F 4L2XF 5AFXA 3OYRA 5ILJA 1RQJA 5ER8A 4LUUA 3WJOA 3Q2QA 1YYUA 4RXDA 2F8ZF 2Z52A 4LA6A 5B0JA 4H5DF 3N5JF 5EROA 1YHLA 5A0KA 5DGSF 3M01A 2VF6A 2ZEUA 3TFPA 4QXSF 5B0KA 2ZCSA 1UBVA 3VJDA 5A0JA 3OACB 3RBMA 3PYBA 3N6KF 3IBAA 2ZCOA 4LLTA 4KFAA 1WL0A 3ICZA 3SDQA 5IL8A 1KIZA 5ILHA 3LZ9A 5IK9A 3ICKA 2E8WA 3WCCA 3DYFA 5JV0F 3WCEA 2E8UA 1V4EA 3BNXA 3LMDA 1DI1A 2Z7IA 2J1PA 5AELA 4KVIA 2P1CA 4UMJA 3QKCA 4OMHA 3PH7A 4HD1A 3BNYA 1HXAA 5DGNF 3LK5A 1YHKA 3LG5A 4LFVF 3ADZA 5B0IA 4GP1A 3B7LA 3TS7A 1V4KA 2Q9YA 4QPFA 4E9ZA 3WCMA 4LOBA 4P0WA 1FPSA 2OPNA 4LLSA 2Z4ZA 4DZWA 3G4DA 1VG2A 4N1ZF 2PS4A 4MC0A 4NKEA 5C05A 2E4OA 2AEKA 5DHKA 3DYGA 4DWBA 1RTRA 2O1OA 3W7FA 4F6XA 5IN8A 2OGDA 4LZCA 1YV5A 3N1WF 4OGUA 2I19A 3M0GA 5DGMF 2FTZA 3OABA 2ZCRA 4EA1A 4KKMA 3WCLA 2Z4WA 4LXWA 5E8KA 1YYTA 2AZKA 3M00A 4RYPA 3P8RA 4JYXA 3ZOUA 3EFQA 2PS6A 3WSAA 1VG3A 5JV2F 3OACA 3WC9A 3N1VF 4OKMA 1HXCA 2F92F 3WCIA 5B0MA 2PS8A 4LPGF 1V4HA 3KB9A 3M02A 2EWGA 1PS1A 3PDEA 2J5CA 3WE9A 1HX9A 3LVSA 4KK2A 2F9KF 3N3DA 2ZY1A 4EA2A 1DGPA 3G4FA
chains in the Genus database with same CATH superfamily
3KROB 2Z4VA 1VG4A 3LDWA 3OABB 4MC8A 1UBXA 4LIXA 5ILDA 3ACXA 2ONGA 1WKZA 1N21A 3ICNA 2E8VA 4DEMF 3NPRA 2OA6A 3KRAB 4E9UA 5IL3A 2Z78A 5EASA 3NRIA 5JV1F 5ILYA 5E8LA 3Q30A 3RYWA 3AQBB 3S4JA 4F6VA 3N0FA 5IKAA 5DIQF 3WSBA 2Z4YA 5I1UA 3MAVA 2E8XA 1HM7A 3WJNA 4XQSF 2PS7A 4RXCA 4KQ5A 3TFVA 1JFAA 3WJKA 4PVXF 1WL2A 2QISA 3V1VA 5HN9A 3S9VA 2F7MF 4DWGA 1ZW5A 3WCFA 4KVYA 5IK6A 4LTZA 1N23A 5IMPA 1YYSA 2AELA 4P0VA 4LZ3A 3NF2A 3ZMBA 3ACWA 3UCAA 3KRFB 4ZQ8A 3CC9A 5KSXF 3AQCB 3WEKA 3LOMA 2Z50A 4Q23A 4RXAA 5ILIA 4EA0A 4JZBA 5DJPF 5HNAA 4WK5A 2E94A 4DI5A 4LFGA 4LZ0A 5AYPA 1N1ZA 2Z4XA 3KROA 5IM1A 4KVWA 2OPMA 5AHUB 3WCHA 4DHDA 5IMNA 1VG6A 4MC3A 3LGKA 4JVJF 3WEIA 3KRAA 5DZ2A 2ONHA 3P41A 2E92A 3WCDA 4XQRF 5B00A 3WEHA 3LSNA 2FORA 5E8HA 3Q1OA 4PVYF 3KRPB 5HN7A 2E8TA 4JZXA 1YJ4A 2F8CF 4H5CF 3N0GA 2H8OA 4KPJA 3VJBA 3AQ0A 1UBWA 5IMIA 3N3LF 4LA5A 1YYQA 4N9UA 1N24A 2DH4A 2PS5A 3EGTA 4GA3A 4RXEA 4GP2A 3N5HF 3PYAA 3V66A 3WCBA 4NG6A 3TFNA 5B03A 4OKZA 5ILZA 3ID0A 3ZL6A 4NUAA 4XQTF 5DHIA 3KRFA 2E91A 3ACYA 4NKFA 3P8LA 3EZ3A 2Q58A 5DJRF 3WEGA 4H5EF 3VJAA 1V4IA 3LEEA 3VJ8A 1V4JA 3SAEA 3WCGA 3LLWA 2E93A 4LFEA 3QQVA 1UBYA 3N46F 4DXJA 4FP4A 4KUXA 1N22A 2AZJA 2Q9ZA 1N1BA 3KRCA 1RQIA 3VJCA 2ZEVA 1HM4A 3WCJA 3SDRA 3N49F 3LGZB 3KRPA 5IK0A 3WEFA 1WMWA 5A0IA 4KVDA 4F62A 3M9UA 3P5RA 4OMGA 3APZA 5ILKA 3WCAA 3VJ9A 3WEJA 2E90A 1EZFA 4KQSA 3KBKA 5IKHA 1WY0A 3MZVA 5EAUA 5CG5A 4E1EA 5B01A 1N20A 2ZCQA 5IVGA 3VJEA 3PKOA 3Q2ZA 2E95A 4NFJF 4LPHF 4NFIF 2F94F 1KIYA 3NPKA 4FJQA 3ICMA 1VG7A 2F89F 4RNQA 4KWDA 1WL1A 3ZCDA 5H9DA 3SDUA 4GAXA 2Z7HA 3KRCB 1YHMA 5HN8A 2RAHA 3TC1A 3ASXA 3SDTA 2J1OA 5B02A 3CP6A 3CKEA 1JFGA 5B0LA 3RYEA 5DW7A 5EATA 4KQUA 3DYHA 1YYRA 3P5PA 3AE0A 1WL3A 2AZLA 4P0XA 5JUZF 2Q80A 4JXNA 4LTVA 5ERMA 3ZMCA 1YQ7A 4K10A 5ERNA 5CG6A 5DJVF 4KPDA 3SDVA 5JA0F 4NFKF 3RMGA 3LJIA 4JXYA 2AETA 3IPIA 3V1XA 1HXGA 3N45F 4L2XF 5AFXA 3OYRA 5ILJA 1RQJA 5ER8A 4LUUA 3WJOA 3Q2QA 1YYUA 4RXDA 2F8ZF 2Z52A 4LA6A 5B0JA 4H5DF 3N5JF 5EROA 1YHLA 5A0KA 5DGSF 3M01A 2VF6A 2ZEUA 3TFPA 4QXSF 5B0KA 2ZCSA 1UBVA 3VJDA 5A0JA 3OACB 3RBMA 3PYBA 3N6KF 3IBAA 2ZCOA 4LLTA 4KFAA 1WL0A 3ICZA 3SDQA 5IL8A 1KIZA 5ILHA 3LZ9A 5IK9A 3ICKA 2E8WA 3WCCA 3DYFA 5JV0F 3WCEA 2E8UA 1V4EA 3BNXA 3LMDA 1DI1A 2Z7IA 2J1PA 5AELA 4KVIA 2P1CA 4UMJA 3QKCA 4OMHA 3PH7A 4HD1A 3BNYA 1HXAA 5DGNF 3LK5A 1YHKA 3LG5A 4LFVF 3ADZA 5B0IA 4GP1A 3B7LA 3TS7A 1V4KA 2Q9YA 4QPFA 4E9ZA 3WCMA 4LOBA 4P0WA 1FPSA 2OPNA 4LLSA 2Z4ZA 4DZWA 3G4DA 1VG2A 4N1ZF 2PS4A 4MC0A 4NKEA 5C05A 2E4OA 2AEKA 5DHKA 3DYGA 4DWBA 1RTRA 2O1OA 3W7FA 4F6XA 5IN8A 2OGDA 4LZCA 1YV5A 3N1WF 4OGUA 2I19A 3M0GA 5DGMF 2FTZA 3OABA 2ZCRA 4EA1A 4KKMA 3WCLA 2Z4WA 4LXWA 5E8KA 1YYTA 2AZKA 3M00A 4RYPA 3P8RA 4JYXA 3ZOUA 3EFQA 2PS6A 3WSAA 1VG3A 5JV2F 3OACA 3WC9A 3N1VF 4OKMA 1HXCA 2F92F 3WCIA 5B0MA 2PS8A 4LPGF 1V4HA 3KB9A 3M02A 2EWGA 1PS1A 3PDEA 2J5CA 3WE9A 1HX9A 3LVSA 4KK2A 2F9KF 3N3DA 2ZY1A 4EA2A 1DGPA 3G4FA
chains in the Genus database with same CATH topology
3KROB 2Z4VA 1VG4A 3LDWA 3OABB 4MC8A 1UBXA 4LIXA 5ILDA 3ACXA 2ONGA 1WKZA 1N21A 3ICNA 2E8VA 4DEMF 3NPRA 2OA6A 3KRAB 4E9UA 5IL3A 2Z78A 5EASA 3NRIA 5JV1F 5ILYA 5E8LA 3Q30A 3RYWA 3AQBB 3S4JA 4F6VA 3N0FA 5IKAA 5DIQF 3WSBA 2Z4YA 5I1UA 3MAVA 2E8XA 1HM7A 3WJNA 4XQSF 2PS7A 4RXCA 4KQ5A 3TFVA 1JFAA 3WJKA 4PVXF 1WL2A 2QISA 3V1VA 5HN9A 3S9VA 2F7MF 4DWGA 1ZW5A 3WCFA 4KVYA 5IK6A 4LTZA 1N23A 5IMPA 1YYSA 2AELA 4P0VA 4LZ3A 3NF2A 3ZMBA 3ACWA 3UCAA 3KRFB 4ZQ8A 3CC9A 5KSXF 3AQCB 3WEKA 3LOMA 2Z50A 4Q23A 4RXAA 5ILIA 4EA0A 4JZBA 5DJPF 5HNAA 4WK5A 2E94A 4DI5A 4LFGA 4LZ0A 5AYPA 1N1ZA 2Z4XA 3KROA 5IM1A 4KVWA 2OPMA 5AHUB 3WCHA 4DHDA 5IMNA 1VG6A 4MC3A 3LGKA 4JVJF 3WEIA 3KRAA 5DZ2A 2ONHA 3P41A 2E92A 3WCDA 4XQRF 5B00A 3WEHA 3LSNA 2FORA 5E8HA 3Q1OA 4PVYF 3KRPB 5HN7A 2E8TA 4JZXA 1YJ4A 2F8CF 4H5CF 3N0GA 2H8OA 4KPJA 3VJBA 3AQ0A 1UBWA 5IMIA 3N3LF 4LA5A 1YYQA 4N9UA 1N24A 2DH4A 2PS5A 3EGTA 4GA3A 4RXEA 4GP2A 3N5HF 3PYAA 3V66A 3WCBA 4NG6A 3TFNA 5B03A 4OKZA 5ILZA 3ID0A 3ZL6A 4NUAA 4XQTF 5DHIA 3KRFA 2E91A 3ACYA 4NKFA 3P8LA 3EZ3A 2Q58A 5DJRF 3WEGA 4H5EF 3VJAA 1V4IA 3LEEA 3VJ8A 1V4JA 3SAEA 3WCGA 3LLWA 2E93A 4LFEA 3QQVA 1UBYA 3N46F 4DXJA 4FP4A 4KUXA 1N22A 2AZJA 2Q9ZA 1N1BA 3KRCA 1RQIA 3VJCA 2ZEVA 1HM4A 3WCJA 3SDRA 3N49F 3LGZB 3KRPA 5IK0A 3WEFA 1WMWA 5A0IA 4KVDA 4F62A 3M9UA 3P5RA 4OMGA 3APZA 5ILKA 3WCAA 3VJ9A 3WEJA 2E90A 1EZFA 4KQSA 3KBKA 5IKHA 1WY0A 3MZVA 5EAUA 5CG5A 4E1EA 5B01A 1N20A 2ZCQA 5IVGA 3VJEA 3PKOA 3Q2ZA 2E95A 4NFJF 4LPHF 4NFIF 2F94F 1KIYA 3NPKA 4FJQA 3ICMA 1VG7A 2F89F 4RNQA 4KWDA 1WL1A 3ZCDA 5H9DA 3SDUA 4GAXA 2Z7HA 3KRCB 1YHMA 5HN8A 2RAHA 3TC1A 3ASXA 3SDTA 2J1OA 5B02A 3CP6A 3CKEA 1JFGA 5B0LA 3RYEA 5DW7A 5EATA 4KQUA 3DYHA 1YYRA 3P5PA 3AE0A 1WL3A 2AZLA 4P0XA 5JUZF 2Q80A 4JXNA 4LTVA 5ERMA 3ZMCA 1YQ7A 4K10A 5ERNA 5CG6A 5DJVF 4KPDA 3SDVA 5JA0F 4NFKF 3RMGA 3LJIA 4JXYA 2AETA 3IPIA 3V1XA 1HXGA 3N45F 4L2XF 5AFXA 3OYRA 5ILJA 1RQJA 5ER8A 4LUUA 3WJOA 3Q2QA 1YYUA 4RXDA 2F8ZF 2Z52A 4LA6A 5B0JA 4H5DF 3N5JF 5EROA 1YHLA 5A0KA 5DGSF 3M01A 2VF6A 2ZEUA 3TFPA 4QXSF 5B0KA 2ZCSA 1UBVA 3VJDA 5A0JA 3OACB 3RBMA 3PYBA 3N6KF 3IBAA 2ZCOA 4LLTA 4KFAA 1WL0A 3ICZA 3SDQA 5IL8A 1KIZA 5ILHA 3LZ9A 5IK9A 3ICKA 2E8WA 3WCCA 3DYFA 5JV0F 3WCEA 2E8UA 1V4EA 3BNXA 3LMDA 1DI1A 2Z7IA 2J1PA 5AELA 4KVIA 2P1CA 4UMJA 3QKCA 4OMHA 3PH7A 4HD1A 3BNYA 1HXAA 5DGNF 3LK5A 1YHKA 3LG5A 4LFVF 3ADZA 5B0IA 4GP1A 3B7LA 3TS7A 1V4KA 2Q9YA 4QPFA 4E9ZA 3WCMA 4LOBA 4P0WA 1FPSA 2OPNA 4LLSA 2Z4ZA 4DZWA 3G4DA 1VG2A 4N1ZF 2PS4A 4MC0A 4NKEA 5C05A 2E4OA 2AEKA 5DHKA 3DYGA 4DWBA 1RTRA 2O1OA 3W7FA 4F6XA 5IN8A 2OGDA 4LZCA 1YV5A 3N1WF 4OGUA 2I19A 3M0GA 5DGMF 2FTZA 3OABA 2ZCRA 4EA1A 4KKMA 3WCLA 2Z4WA 4LXWA 5E8KA 1YYTA 2AZKA 3M00A 4RYPA 3P8RA 4JYXA 3ZOUA 3EFQA 2PS6A 3WSAA 1VG3A 5JV2F 3OACA 3WC9A 3N1VF 4OKMA 1HXCA 2F92F 3WCIA 5B0MA 2PS8A 4LPGF 1V4HA 3KB9A 3M02A 2EWGA 1PS1A 3PDEA 2J5CA 3WE9A 1HX9A 3LVSA 4KK2A 2F9KF 3N3DA 2ZY1A 4EA2A 1DGPA 3G4FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRO B;  2Z4V A;  1VG4 A;  3LDW A;  3OAB B;  4MC8 A;  1UBX A;  4LIX A;  5ILD A;  3ACX A;  2ONG A;  1WKZ A;  1N21 A;  3ICN A;  2E8V A;  4DEM F;  3NPR A;  2OA6 A;  3KRA B;  4E9U A;  5IL3 A;  2Z78 A;  5EAS A;  3NRI A;  5JV1 F;  5ILY A;  5E8L A;  3Q30 A;  3RYW A;  3AQB B;  3S4J A;  4F6V A;  3N0F A;  5IKA A;  5DIQ F;  3WSB A;  2Z4Y A;  5I1U A;  3MAV A;  2E8X A;  1HM7 A;  3WJN A;  4XQS F;  2PS7 A;  4RXC A;  4KQ5 A;  3TFV A;  1JFA A;  3WJK A;  4PVX F;  1WL2 A;  2QIS A;  3V1V A;  5HN9 A;  3S9V A;  2F7M F;  4DWG A;  1ZW5 A;  3WCF A;  4KVY A;  5IK6 A;  4LTZ A;  1N23 A;  5IMP A;  1YYS A;  2AEL A;  4P0V A;  4LZ3 A;  3NF2 A;  3ZMB A;  3ACW A;  3UCA A;  3KRF B;  4ZQ8 A;  3CC9 A;  5KSX F;  3AQC B;  3WEK A;  3LOM A;  2Z50 A;  4Q23 A;  4RXA A;  5ILI A;  4EA0 A;  4JZB A;  5DJP F;  5HNA A;  4WK5 A;  2E94 A;  4DI5 A;  4LFG A;  4LZ0 A;  5AYP A;  1N1Z A;  2Z4X A;  3KRO A;  5IM1 A;  4KVW A;  2OPM A;  5AHU B;  3WCH A;  4DHD A;  5IMN A;  1VG6 A;  4MC3 A;  3LGK A;  4JVJ F;  3WEI A;  3KRA A;  5DZ2 A;  2ONH A;  3P41 A;  2E92 A;  3WCD A;  4XQR F;  5B00 A;  3WEH A;  3LSN A;  2FOR A;  5E8H A;  3Q1O A;  4PVY F;  3KRP B;  5HN7 A;  2E8T A;  4JZX A;  1YJ4 A;  2F8C F;  4H5C F;  3N0G A;  2H8O A;  4KPJ A;  3VJB A;  3AQ0 A;  1UBW A;  5IMI A;  3N3L F;  4LA5 A;  1YYQ A;  4N9U A;  1N24 A;  2DH4 A;  2PS5 A;  3EGT A;  4GA3 A;  4RXE A;  4GP2 A;  3N5H F;  3PYA A;  3V66 A;  3WCB A;  4NG6 A;  3TFN A;  5B03 A;  4OKZ A;  5ILZ A;  3ID0 A;  3ZL6 A;  4NUA A;  4XQT F;  5DHI A;  3KRF A;  2E91 A;  3ACY A;  4NKF A;  3P8L A;  3EZ3 A;  2Q58 A;  5DJR F;  3WEG A;  4H5E F;  3VJA A;  1V4I A;  3LEE A;  3VJ8 A;  1V4J A;  3SAE A;  3WCG A;  3LLW A;  2E93 A;  4LFE A;  3QQV A;  1UBY A;  3N46 F;  4DXJ A;  4FP4 A;  4KUX A;  1N22 A;  2AZJ A;  2Q9Z A;  1N1B A;  3KRC A;  1RQI A;  3VJC A;  2ZEV A;  1HM4 A;  3WCJ A;  3SDR A;  3N49 F;  3LGZ B;  3KRP A;  5IK0 A;  3WEF A;  1WMW A;  5A0I A;  4KVD A;  4F62 A;  3M9U A;  3P5R A;  4OMG A;  3APZ A;  5ILK A;  3WCA A;  3VJ9 A;  3WEJ A;  2E90 A;  1EZF A;  4KQS A;  3KBK A;  5IKH A;  1WY0 A;  3MZV A;  5EAU A;  5CG5 A;  4E1E A;  5B01 A;  1N20 A;  2ZCQ A;  5IVG A;  3VJE A;  3PKO A;  3Q2Z A;  2E95 A;  4NFJ F;  4LPH F;  4NFI F;  2F94 F;  1KIY A;  3NPK A;  4FJQ A;  3ICM A;  1VG7 A;  2F89 F;  4RNQ A;  4KWD A;  1WL1 A;  3ZCD A;  5H9D A;  3SDU A;  4GAX A;  2Z7H A;  3KRC B;  1YHM A;  5HN8 A;  2RAH A;  3TC1 A;  3ASX A;  3SDT A;  2J1O A;  5B02 A;  3CP6 A;  3CKE A;  1JFG A;  5B0L A;  3RYE A;  5DW7 A;  5EAT A;  4KQU A;  3DYH A;  1YYR A;  3P5P A;  3AE0 A;  1WL3 A;  2AZL A;  4P0X A;  5JUZ F;  2Q80 A;  4JXN A;  4LTV A;  5ERM A;  3ZMC A;  1YQ7 A;  4K10 A;  5ERN A;  5CG6 A;  5DJV F;  4KPD A;  3SDV A;  5JA0 F;  4NFK F;  3RMG A;  3LJI A;  4JXY A;  2AET A;  3IPI A;  3V1X A;  1HXG A;  3N45 F;  4L2X F;  5AFX A;  3OYR A;  5ILJ A;  1RQJ A;  5ER8 A;  4LUU A;  3WJO A;  3Q2Q A;  1YYU A;  4RXD A;  2F8Z F;  2Z52 A;  4LA6 A;  5B0J A;  4H5D F;  3N5J F;  5ERO A;  1YHL A;  5A0K A;  5DGS F;  3M01 A;  2VF6 A;  2ZEU A;  3TFP A;  4QXS F;  5B0K A;  2ZCS A;  1UBV A;  3VJD A;  5A0J A;  3OAC B;  3RBM A;  3PYB A;  3N6K F;  3IBA A;  2ZCO A;  4LLT A;  4KFA A;  1WL0 A;  3ICZ A;  3SDQ A;  5IL8 A;  1KIZ A;  5ILH A;  3LZ9 A;  5IK9 A;  3ICK A;  2E8W A;  3WCC A;  3DYF A;  5JV0 F;  3WCE A;  2E8U A;  1V4E A;  3BNX A;  3LMD A;  1DI1 A;  2Z7I A;  2J1P A;  5AEL A;  4KVI A;  2P1C A;  4UMJ A;  3QKC A;  4OMH A;  3PH7 A;  4HD1 A;  3BNY A;  1HXA A;  5DGN F;  3LK5 A;  1YHK A;  3LG5 A;  4LFV F;  3ADZ A;  5B0I A;  4GP1 A;  3B7L A;  3TS7 A;  1V4K A;  2Q9Y A;  4QPF A;  4E9Z A;  3WCM A;  4LOB A;  4P0W A;  1FPS A;  2OPN A;  4LLS A;  2Z4Z A;  4DZW A;  3G4D A;  1VG2 A;  4N1Z F;  2PS4 A;  4MC0 A;  4NKE A;  5C05 A;  2E4O A;  2AEK A;  5DHK A;  3DYG A;  4DWB A;  1RTR A;  2O1O A;  3W7F A;  4F6X A;  5IN8 A;  2OGD A;  4LZC A;  1YV5 A;  3N1W F;  4OGU A;  2I19 A;  3M0G A;  5DGM F;  2FTZ A;  3OAB A;  2ZCR A;  4EA1 A;  4KKM A;  3WCL A;  2Z4W A;  4LXW A;  5E8K A;  1YYT A;  2AZK A;  3M00 A;  4RYP A;  3P8R A;  4JYX A;  3ZOU A;  3EFQ A;  2PS6 A;  3WSA A;  1VG3 A;  5JV2 F;  3OAC A;  3WC9 A;  3N1V F;  4OKM A;  1HXC A;  2F92 F;  3WCI A;  5B0M A;  2PS8 A;  4LPG F;  1V4H A;  3KB9 A;  3M02 A;  2EWG A;  1PS1 A;  3PDE A;  2J5C A;  3WE9 A;  1HX9 A;  3LVS A;  4KK2 A;  2F9K F;  3N3D A;  2ZY1 A;  4EA2 A;  1DGP A;  3G4F A; 
#chains in the Genus database with same CATH topology
 3KRO B;  2Z4V A;  1VG4 A;  3LDW A;  3OAB B;  4MC8 A;  1UBX A;  4LIX A;  5ILD A;  3ACX A;  2ONG A;  1WKZ A;  1N21 A;  3ICN A;  2E8V A;  4DEM F;  3NPR A;  2OA6 A;  3KRA B;  4E9U A;  5IL3 A;  2Z78 A;  5EAS A;  3NRI A;  5JV1 F;  5ILY A;  5E8L A;  3Q30 A;  3RYW A;  3AQB B;  3S4J A;  4F6V A;  3N0F A;  5IKA A;  5DIQ F;  3WSB A;  2Z4Y A;  5I1U A;  3MAV A;  2E8X A;  1HM7 A;  3WJN A;  4XQS F;  2PS7 A;  4RXC A;  4KQ5 A;  3TFV A;  1JFA A;  3WJK A;  4PVX F;  1WL2 A;  2QIS A;  3V1V A;  5HN9 A;  3S9V A;  2F7M F;  4DWG A;  1ZW5 A;  3WCF A;  4KVY A;  5IK6 A;  4LTZ A;  1N23 A;  5IMP A;  1YYS A;  2AEL A;  4P0V A;  4LZ3 A;  3NF2 A;  3ZMB A;  3ACW A;  3UCA A;  3KRF B;  4ZQ8 A;  3CC9 A;  5KSX F;  3AQC B;  3WEK A;  3LOM A;  2Z50 A;  4Q23 A;  4RXA A;  5ILI A;  4EA0 A;  4JZB A;  5DJP F;  5HNA A;  4WK5 A;  2E94 A;  4DI5 A;  4LFG A;  4LZ0 A;  5AYP A;  1N1Z A;  2Z4X A;  3KRO A;  5IM1 A;  4KVW A;  2OPM A;  5AHU B;  3WCH A;  4DHD A;  5IMN A;  1VG6 A;  4MC3 A;  3LGK A;  4JVJ F;  3WEI A;  3KRA A;  5DZ2 A;  2ONH A;  3P41 A;  2E92 A;  3WCD A;  4XQR F;  5B00 A;  3WEH A;  3LSN A;  2FOR A;  5E8H A;  3Q1O A;  4PVY F;  3KRP B;  5HN7 A;  2E8T A;  4JZX A;  1YJ4 A;  2F8C F;  4H5C F;  3N0G A;  2H8O A;  4KPJ A;  3VJB A;  3AQ0 A;  1UBW A;  5IMI A;  3N3L F;  4LA5 A;  1YYQ A;  4N9U A;  1N24 A;  2DH4 A;  2PS5 A;  3EGT A;  4GA3 A;  4RXE A;  4GP2 A;  3N5H F;  3PYA A;  3V66 A;  3WCB A;  4NG6 A;  3TFN A;  5B03 A;  4OKZ A;  5ILZ A;  3ID0 A;  3ZL6 A;  4NUA A;  4XQT F;  5DHI A;  3KRF A;  2E91 A;  3ACY A;  4NKF A;  3P8L A;  3EZ3 A;  2Q58 A;  5DJR F;  3WEG A;  4H5E F;  3VJA A;  1V4I A;  3LEE A;  3VJ8 A;  1V4J A;  3SAE A;  3WCG A;  3LLW A;  2E93 A;  4LFE A;  3QQV A;  1UBY A;  3N46 F;  4DXJ A;  4FP4 A;  4KUX A;  1N22 A;  2AZJ A;  2Q9Z A;  1N1B A;  3KRC A;  1RQI A;  3VJC A;  2ZEV A;  1HM4 A;  3WCJ A;  3SDR A;  3N49 F;  3LGZ B;  3KRP A;  5IK0 A;  3WEF A;  1WMW A;  5A0I A;  4KVD A;  4F62 A;  3M9U A;  3P5R A;  4OMG A;  3APZ A;  5ILK A;  3WCA A;  3VJ9 A;  3WEJ A;  2E90 A;  1EZF A;  4KQS A;  3KBK A;  5IKH A;  1WY0 A;  3MZV A;  5EAU A;  5CG5 A;  4E1E A;  5B01 A;  1N20 A;  2ZCQ A;  5IVG A;  3VJE A;  3PKO A;  3Q2Z A;  2E95 A;  4NFJ F;  4LPH F;  4NFI F;  2F94 F;  1KIY A;  3NPK A;  4FJQ A;  3ICM A;  1VG7 A;  2F89 F;  4RNQ A;  4KWD A;  1WL1 A;  3ZCD A;  5H9D A;  3SDU A;  4GAX A;  2Z7H A;  3KRC B;  1YHM A;  5HN8 A;  2RAH A;  3TC1 A;  3ASX A;  3SDT A;  2J1O A;  5B02 A;  3CP6 A;  3CKE A;  1JFG A;  5B0L A;  3RYE A;  5DW7 A;  5EAT A;  4KQU A;  3DYH A;  1YYR A;  3P5P A;  3AE0 A;  1WL3 A;  2AZL A;  4P0X A;  5JUZ F;  2Q80 A;  4JXN A;  4LTV A;  5ERM A;  3ZMC A;  1YQ7 A;  4K10 A;  5ERN A;  5CG6 A;  5DJV F;  4KPD A;  3SDV A;  5JA0 F;  4NFK F;  3RMG A;  3LJI A;  4JXY A;  2AET A;  3IPI A;  3V1X A;  1HXG A;  3N45 F;  4L2X F;  5AFX A;  3OYR A;  5ILJ A;  1RQJ A;  5ER8 A;  4LUU A;  3WJO A;  3Q2Q A;  1YYU A;  4RXD A;  2F8Z F;  2Z52 A;  4LA6 A;  5B0J A;  4H5D F;  3N5J F;  5ERO A;  1YHL A;  5A0K A;  5DGS F;  3M01 A;  2VF6 A;  2ZEU A;  3TFP A;  4QXS F;  5B0K A;  2ZCS A;  1UBV A;  3VJD A;  5A0J A;  3OAC B;  3RBM A;  3PYB A;  3N6K F;  3IBA A;  2ZCO A;  4LLT A;  4KFA A;  1WL0 A;  3ICZ A;  3SDQ A;  5IL8 A;  1KIZ A;  5ILH A;  3LZ9 A;  5IK9 A;  3ICK A;  2E8W A;  3WCC A;  3DYF A;  5JV0 F;  3WCE A;  2E8U A;  1V4E A;  3BNX A;  3LMD A;  1DI1 A;  2Z7I A;  2J1P A;  5AEL A;  4KVI A;  2P1C A;  4UMJ A;  3QKC A;  4OMH A;  3PH7 A;  4HD1 A;  3BNY A;  1HXA A;  5DGN F;  3LK5 A;  1YHK A;  3LG5 A;  4LFV F;  3ADZ A;  5B0I A;  4GP1 A;  3B7L A;  3TS7 A;  1V4K A;  2Q9Y A;  4QPF A;  4E9Z A;  3WCM A;  4LOB A;  4P0W A;  1FPS A;  2OPN A;  4LLS A;  2Z4Z A;  4DZW A;  3G4D A;  1VG2 A;  4N1Z F;  2PS4 A;  4MC0 A;  4NKE A;  5C05 A;  2E4O A;  2AEK A;  5DHK A;  3DYG A;  4DWB A;  1RTR A;  2O1O A;  3W7F A;  4F6X A;  5IN8 A;  2OGD A;  4LZC A;  1YV5 A;  3N1W F;  4OGU A;  2I19 A;  3M0G A;  5DGM F;  2FTZ A;  3OAB A;  2ZCR A;  4EA1 A;  4KKM A;  3WCL A;  2Z4W A;  4LXW A;  5E8K A;  1YYT A;  2AZK A;  3M00 A;  4RYP A;  3P8R A;  4JYX A;  3ZOU A;  3EFQ A;  2PS6 A;  3WSA A;  1VG3 A;  5JV2 F;  3OAC A;  3WC9 A;  3N1V F;  4OKM A;  1HXC A;  2F92 F;  3WCI A;  5B0M A;  2PS8 A;  4LPG F;  1V4H A;  3KB9 A;  3M02 A;  2EWG A;  1PS1 A;  3PDE A;  2J5C A;  3WE9 A;  1HX9 A;  3LVS A;  4KK2 A;  2F9K F;  3N3D A;  2ZY1 A;  4EA2 A;  1DGP A;  3G4F A; 
#chains in the Genus database with same CATH homology
 3KRO B;  2Z4V A;  1VG4 A;  3LDW A;  3OAB B;  4MC8 A;  1UBX A;  4LIX A;  5ILD A;  3ACX A;  2ONG A;  1WKZ A;  1N21 A;  3ICN A;  2E8V A;  4DEM F;  3NPR A;  2OA6 A;  3KRA B;  4E9U A;  5IL3 A;  2Z78 A;  5EAS A;  3NRI A;  5JV1 F;  5ILY A;  5E8L A;  3Q30 A;  3RYW A;  3AQB B;  3S4J A;  4F6V A;  3N0F A;  5IKA A;  5DIQ F;  3WSB A;  2Z4Y A;  5I1U A;  3MAV A;  2E8X A;  1HM7 A;  3WJN A;  4XQS F;  2PS7 A;  4RXC A;  4KQ5 A;  3TFV A;  1JFA A;  3WJK A;  4PVX F;  1WL2 A;  2QIS A;  3V1V A;  5HN9 A;  3S9V A;  2F7M F;  4DWG A;  1ZW5 A;  3WCF A;  4KVY A;  5IK6 A;  4LTZ A;  1N23 A;  5IMP A;  1YYS A;  2AEL A;  4P0V A;  4LZ3 A;  3NF2 A;  3ZMB A;  3ACW A;  3UCA A;  3KRF B;  4ZQ8 A;  3CC9 A;  5KSX F;  3AQC B;  3WEK A;  3LOM A;  2Z50 A;  4Q23 A;  4RXA A;  5ILI A;  4EA0 A;  4JZB A;  5DJP F;  5HNA A;  4WK5 A;  2E94 A;  4DI5 A;  4LFG A;  4LZ0 A;  5AYP A;  1N1Z A;  2Z4X A;  3KRO A;  5IM1 A;  4KVW A;  2OPM A;  5AHU B;  3WCH A;  4DHD A;  5IMN A;  1VG6 A;  4MC3 A;  3LGK A;  4JVJ F;  3WEI A;  3KRA A;  5DZ2 A;  2ONH A;  3P41 A;  2E92 A;  3WCD A;  4XQR F;  5B00 A;  3WEH A;  3LSN A;  2FOR A;  5E8H A;  3Q1O A;  4PVY F;  3KRP B;  5HN7 A;  2E8T A;  4JZX A;  1YJ4 A;  2F8C F;  4H5C F;  3N0G A;  2H8O A;  4KPJ A;  3VJB A;  3AQ0 A;  1UBW A;  5IMI A;  3N3L F;  4LA5 A;  1YYQ A;  4N9U A;  1N24 A;  2DH4 A;  2PS5 A;  3EGT A;  4GA3 A;  4RXE A;  4GP2 A;  3N5H F;  3PYA A;  3V66 A;  3WCB A;  4NG6 A;  3TFN A;  5B03 A;  4OKZ A;  5ILZ A;  3ID0 A;  3ZL6 A;  4NUA A;  4XQT F;  5DHI A;  3KRF A;  2E91 A;  3ACY A;  4NKF A;  3P8L A;  3EZ3 A;  2Q58 A;  5DJR F;  3WEG A;  4H5E F;  3VJA A;  1V4I A;  3LEE A;  3VJ8 A;  1V4J A;  3SAE A;  3WCG A;  3LLW A;  2E93 A;  4LFE A;  3QQV A;  1UBY A;  3N46 F;  4DXJ A;  4FP4 A;  4KUX A;  1N22 A;  2AZJ A;  2Q9Z A;  1N1B A;  3KRC A;  1RQI A;  3VJC A;  2ZEV A;  1HM4 A;  3WCJ A;  3SDR A;  3N49 F;  3LGZ B;  3KRP A;  5IK0 A;  3WEF A;  1WMW A;  5A0I A;  4KVD A;  4F62 A;  3M9U A;  3P5R A;  4OMG A;  3APZ A;  5ILK A;  3WCA A;  3VJ9 A;  3WEJ A;  2E90 A;  1EZF A;  4KQS A;  3KBK A;  5IKH A;  1WY0 A;  3MZV A;  5EAU A;  5CG5 A;  4E1E A;  5B01 A;  1N20 A;  2ZCQ A;  5IVG A;  3VJE A;  3PKO A;  3Q2Z A;  2E95 A;  4NFJ F;  4LPH F;  4NFI F;  2F94 F;  1KIY A;  3NPK A;  4FJQ A;  3ICM A;  1VG7 A;  2F89 F;  4RNQ A;  4KWD A;  1WL1 A;  3ZCD A;  5H9D A;  3SDU A;  4GAX A;  2Z7H A;  3KRC B;  1YHM A;  5HN8 A;  2RAH A;  3TC1 A;  3ASX A;  3SDT A;  2J1O A;  5B02 A;  3CP6 A;  3CKE A;  1JFG A;  5B0L A;  3RYE A;  5DW7 A;  5EAT A;  4KQU A;  3DYH A;  1YYR A;  3P5P A;  3AE0 A;  1WL3 A;  2AZL A;  4P0X A;  5JUZ F;  2Q80 A;  4JXN A;  4LTV A;  5ERM A;  3ZMC A;  1YQ7 A;  4K10 A;  5ERN A;  5CG6 A;  5DJV F;  4KPD A;  3SDV A;  5JA0 F;  4NFK F;  3RMG A;  3LJI A;  4JXY A;  2AET A;  3IPI A;  3V1X A;  1HXG A;  3N45 F;  4L2X F;  5AFX A;  3OYR A;  5ILJ A;  1RQJ A;  5ER8 A;  4LUU A;  3WJO A;  3Q2Q A;  1YYU A;  4RXD A;  2F8Z F;  2Z52 A;  4LA6 A;  5B0J A;  4H5D F;  3N5J F;  5ERO A;  1YHL A;  5A0K A;  5DGS F;  3M01 A;  2VF6 A;  2ZEU A;  3TFP A;  4QXS F;  5B0K A;  2ZCS A;  1UBV A;  3VJD A;  5A0J A;  3OAC B;  3RBM A;  3PYB A;  3N6K F;  3IBA A;  2ZCO A;  4LLT A;  4KFA A;  1WL0 A;  3ICZ A;  3SDQ A;  5IL8 A;  1KIZ A;  5ILH A;  3LZ9 A;  5IK9 A;  3ICK A;  2E8W A;  3WCC A;  3DYF A;  5JV0 F;  3WCE A;  2E8U A;  1V4E A;  3BNX A;  3LMD A;  1DI1 A;  2Z7I A;  2J1P A;  5AEL A;  4KVI A;  2P1C A;  4UMJ A;  3QKC A;  4OMH A;  3PH7 A;  4HD1 A;  3BNY A;  1HXA A;  5DGN F;  3LK5 A;  1YHK A;  3LG5 A;  4LFV F;  3ADZ A;  5B0I A;  4GP1 A;  3B7L A;  3TS7 A;  1V4K A;  2Q9Y A;  4QPF A;  4E9Z A;  3WCM A;  4LOB A;  4P0W A;  1FPS A;  2OPN A;  4LLS A;  2Z4Z A;  4DZW A;  3G4D A;  1VG2 A;  4N1Z F;  2PS4 A;  4MC0 A;  4NKE A;  5C05 A;  2E4O A;  2AEK A;  5DHK A;  3DYG A;  4DWB A;  1RTR A;  2O1O A;  3W7F A;  4F6X A;  5IN8 A;  2OGD A;  4LZC A;  1YV5 A;  3N1W F;  4OGU A;  2I19 A;  3M0G A;  5DGM F;  2FTZ A;  3OAB A;  2ZCR A;  4EA1 A;  4KKM A;  3WCL A;  2Z4W A;  4LXW A;  5E8K A;  1YYT A;  2AZK A;  3M00 A;  4RYP A;  3P8R A;  4JYX A;  3ZOU A;  3EFQ A;  2PS6 A;  3WSA A;  1VG3 A;  5JV2 F;  3OAC A;  3WC9 A;  3N1V F;  4OKM A;  1HXC A;  2F92 F;  3WCI A;  5B0M A;  2PS8 A;  4LPG F;  1V4H A;  3KB9 A;  3M02 A;  2EWG A;  1PS1 A;  3PDE A;  2J5C A;  3WE9 A;  1HX9 A;  3LVS A;  4KK2 A;  2F9K F;  3N3D A;  2ZY1 A;  4EA2 A;  1DGP A;  3G4F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...