4HD1A

Crystal structure of squalene synthase hpnc from alicyclobacillus acidocaldarius
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
263
structure length
263
Chain Sequence
NAMGSVPVELRGDFEVCRRLTRSHYENFSVVSLFVPRHLRPHFYSVYAFCRGVDDLGDEFAGDRMAALDAYEEELRRAFAGEATTPAFRALQFTIATCNLPMEPFLRLIEANRRDQRKHTYDTWEDLRDYCRYSADPVGRLVLGIFGCLDDERARLSDATCTALQVANHMQDIDRDLALGRIYVPRADLEQFGATLDDIRARRATDGVRRCIALEVDRAQALFDEGRRLESLVPPRLARQLKLYRLGGEAILAAIRRQGYNPF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Squalene synthase HpnC
publication title Crystal structure of squalene synthase HpnC from Alicyclobacillus acidocaldarius
rcsb
source organism Alicyclobacillus acidocaldarius subsp. acidocaldarius
total genus 103
structure length 263
sequence length 263
ec nomenclature ec 2.5.1.32: 15-cis-phytoene synthase.
pdb deposition date 2012-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4hd1A00
3EFQA 4NFJF 4KPJA 4LFEA 2AEKA 4N1ZF 2PS4A 2Z50A 5CG5A 2AETA 3LVSA 2DH4A 1N20A 4LFVF 2E93A 3M00A 3SDUA 2E8XA 3TFNA 3UCAA 3LSNA 5DJVF 4KPDA 3OYRA 4KQUA 2Q80A 1DI1A 4NKEA 3WCIA 2OPMA 4P0XA 3WCEA 3LOMA 3CC9A 1WY0A 3V66A 3WCCA 3WC9A 1VG4A 2OPNA 3NPRA 5I1UA 5IMIA 3G4DA 4LLSA 3ID0A 3PDEA 5IK6A 3LJIA 3SDRA 3ZCDA 4OGUA 4E1EA 4P0VA 1JFAA 3DYFA 5B03A 4JXNA 5B0IA 3WJKA 5ERMA 3WSBA 5EAUA 3SAEA 2ZCOA 1ZW5A 3WCLA 5IMNA 3WJOA 4RYPA 2AELA 4FJQA 1FPSA 5EASA 5IVGA 3N5JF 2E90A 4UMJA 3ZMBA 3APZA 2EWGA 4H5CF 1N22A 4DWBA 2FORA 5B0LA 3ASXA 1KIZA 3ACWA 5DZ2A 2VF6A 2ONHA 3KROB 4EA2A 5CG6A 5B0JA 2F8ZF 3ACXA 5HN8A 4KWDA 4OMHA 4H5EF 4LIXA 3WEFA 3NRIA 4MC3A 3M02A 4NG6A 2Q58A 5DGMF 1YJ4A 2Z4XA 3N45F 1V4EA 4GAXA 5JV0F 3RBMA 1HXAA 4KVYA 5HN9A 3N1WF 3TFPA 3MZVA 5DJRF 5HNAA 2F8CF 3Q1OA 4KKMA 3ICKA 2E8WA 3N0FA 3VJAA 2ZCRA 3Q30A 4EA0A 2OA6A 2ZEVA 4KQSA 2PS7A 4LZ0A 5ILIA 1WKZA 2H8OA 4JVJF 5HN7A 4KVDA 3S4JA 3RMGA 2PS8A 4K10A 3VJ9A 3W7FA 3VJ8A 3WCGA 2ONGA 3WEHA 3KROA 2PS6A 5A0KA 2ZEUA 4FP4A 4RXAA 1PS1A 3LMDA 3ICZA 5AFXA 5IMPA 4JXYA 2F94F 5EROA 5ILJA 2Z7IA 5DIQF 3N1VF 3N49F 1JFGA 3MAVA 1WMWA 3B7LA 1HM7A 2Z4WA 4KUXA 4OKMA 2Z4ZA 4NFKF 4HD1A 3BNYA 4DI5A 3PYBA 2E91A 5KSXF 4PVXF 4MC8A 4LZ3A 4N9UA 4GP1A 1HXGA 1VG7A 3VJBA 5B00A 5JV2F 3LLWA 3KRAB 2QISA 1YHMA 3ICNA 2Q9ZA 3AQ0A 1V4KA 3G4FA 2Z4YA 5IL8A 2E8UA 1YHKA 1WL1A 5E8LA 3LGKA 4DWGA 2Q9YA 3P5RA 2Z4VA 2ZCQA 3WCJA 4LFGA 2F9KF 5DHKA 4DHDA 3ACYA 3AQBB 1V4JA 3VJCA 3BNXA 5ILKA 3WCFA 3M9UA 4F6VA 3WEJA 1N1ZA 1RQJA 4Q23A 1YYSA 3WEGA 5IM1A 2PS5A 4JZBA 3OACB 5IL3A 3AQCB 3WCHA 4E9ZA 3M01A 1YYTA 5H9DA 3NPKA 3EZ3A 5A0JA 4KVWA 4LA5A 3S9VA 2O1OA 4XQTF 3N3DA 3KRAA 5ILDA 1YYQA 1V4IA 2ZY1A 4JYXA 1N1BA 2Z7HA 1VG6A 4RXDA 3RYWA 1UBWA 3CP6A 5A0IA 5IK9A 3WEIA 2ZCSA 5C05A 1WL0A 3WSAA 4OMGA 3PYAA 3AE0A 3KRFB 3VJEA 5IKHA 2AZLA 4LPHF 4GP2A 3KRPB 1UBVA 4F6XA 3LEEA 3QQVA 5EATA 5B02A 2P1CA 4LPGF 3N3LF 4QPFA 5AELA 4EA1A 3OACA 3V1VA 2Z78A 3TFVA 1HX9A 1N24A 5AYPA 3VJDA 4KK2A 3OABA 4LLTA 3SDQA 3WCMA 4NKFA 2F7MF 2E95A 4LUUA 4DXJA 2E4OA 4WK5A 4KQ5A 4LTVA 4KFAA 1HM4A 3P41A 3P8RA 1YYRA 3WCAA 3IPIA 4LA6A 5ERNA 3ZL6A 2AZJA 3WJNA 3WCBA 3DYGA 1HXCA 2Z52A 4LZCA 5IK0A 2FTZA 4RXEA 3KB9A 1DGPA 1YYUA 4F62A 3ZMCA 4RNQA 3KRFA 3V1XA 4KVIA 4MC0A 2E8VA 2J1OA 3KRCA 5E8HA 3ICMA 3LZ9A 1EZFA 1WL3A 3KRPA 3LDWA 1KIYA 3IBAA 3M0GA 1RTRA 2E8TA 3Q2ZA 1VG2A 1WL2A 2OGDA 3SDTA 4QXSF 5DJPF 5ER8A 5B0MA 5B0KA 3NF2A 1UBXA 1VG3A 3Q2QA 2E92A 4P0WA 3EGTA 4LXWA 4OKZA 3P5PA 4DEMF 3N5HF 5IKAA 4XQSF 3ADZA 4DZWA 3N46F 3PH7A 1YV5A 5E8KA 4L2XF 3LGZB 1V4HA 3PKOA 1N23A 2I19A 3ZOUA 1RQIA 3N0GA 3WE9A 2J5CA 3LG5A 5DGSF 3SDVA 2AZKA 4ZQ8A 3OABB 4NFIF 5JUZF 5ILYA 4PVYF 5DGNF 2E94A 5ILHA 3P8LA 4H5DF 5ILZA 2F92F 1YHLA 3KBKA 1UBYA 1N21A 4JZXA 3RYEA 5JV1F 4RXCA 3TC1A 5JA0F 3WEKA 4E9UA 4NUAA 4LOBA 3N6KF 1YQ7A 3DYHA 5B01A 5DW7A 2F89F 2J1PA 4GA3A 3QKCA 3KRCB 2RAHA 3CKEA 4LTZA 5DHIA 3WCDA 5IN8A 4XQRF 3TS7A 5AHUB 3LK5A
chains in the Genus database with same CATH superfamily
3EFQA 4NFJF 4KPJA 4LFEA 2AEKA 4N1ZF 2PS4A 2Z50A 5CG5A 2AETA 3LVSA 2DH4A 1N20A 4LFVF 2E93A 3M00A 3SDUA 2E8XA 3TFNA 3UCAA 3LSNA 5DJVF 4KPDA 3OYRA 4KQUA 2Q80A 1DI1A 4NKEA 3WCIA 2OPMA 4P0XA 3WCEA 3LOMA 3CC9A 1WY0A 3V66A 3WCCA 3WC9A 1VG4A 2OPNA 3NPRA 5I1UA 5IMIA 3G4DA 4LLSA 3ID0A 3PDEA 5IK6A 3LJIA 3SDRA 3ZCDA 4OGUA 4E1EA 4P0VA 1JFAA 3DYFA 5B03A 4JXNA 5B0IA 3WJKA 5ERMA 3WSBA 5EAUA 3SAEA 2ZCOA 1ZW5A 3WCLA 5IMNA 3WJOA 4RYPA 2AELA 4FJQA 1FPSA 5EASA 5IVGA 3N5JF 2E90A 4UMJA 3ZMBA 3APZA 2EWGA 4H5CF 1N22A 4DWBA 2FORA 5B0LA 3ASXA 1KIZA 3ACWA 5DZ2A 2VF6A 2ONHA 3KROB 4EA2A 5CG6A 5B0JA 2F8ZF 3ACXA 5HN8A 4KWDA 4OMHA 4H5EF 4LIXA 3WEFA 3NRIA 4MC3A 3M02A 4NG6A 2Q58A 5DGMF 1YJ4A 2Z4XA 3N45F 1V4EA 4GAXA 5JV0F 3RBMA 1HXAA 4KVYA 5HN9A 3N1WF 3TFPA 3MZVA 5DJRF 5HNAA 2F8CF 3Q1OA 4KKMA 3ICKA 2E8WA 3N0FA 3VJAA 2ZCRA 3Q30A 4EA0A 2OA6A 2ZEVA 4KQSA 2PS7A 4LZ0A 5ILIA 1WKZA 2H8OA 4JVJF 5HN7A 4KVDA 3S4JA 3RMGA 2PS8A 4K10A 3VJ9A 3W7FA 3VJ8A 3WCGA 2ONGA 3WEHA 3KROA 2PS6A 5A0KA 2ZEUA 4FP4A 4RXAA 1PS1A 3LMDA 3ICZA 5AFXA 5IMPA 4JXYA 2F94F 5EROA 5ILJA 2Z7IA 5DIQF 3N1VF 3N49F 1JFGA 3MAVA 1WMWA 3B7LA 1HM7A 2Z4WA 4KUXA 4OKMA 2Z4ZA 4NFKF 4HD1A 3BNYA 4DI5A 3PYBA 2E91A 5KSXF 4PVXF 4MC8A 4LZ3A 4N9UA 4GP1A 1HXGA 1VG7A 3VJBA 5B00A 5JV2F 3LLWA 3KRAB 2QISA 1YHMA 3ICNA 2Q9ZA 3AQ0A 1V4KA 3G4FA 2Z4YA 5IL8A 2E8UA 1YHKA 1WL1A 5E8LA 3LGKA 4DWGA 2Q9YA 3P5RA 2Z4VA 2ZCQA 3WCJA 4LFGA 2F9KF 5DHKA 4DHDA 3ACYA 3AQBB 1V4JA 3VJCA 3BNXA 5ILKA 3WCFA 3M9UA 4F6VA 3WEJA 1N1ZA 1RQJA 4Q23A 1YYSA 3WEGA 5IM1A 2PS5A 4JZBA 3OACB 5IL3A 3AQCB 3WCHA 4E9ZA 3M01A 1YYTA 5H9DA 3NPKA 3EZ3A 5A0JA 4KVWA 4LA5A 3S9VA 2O1OA 4XQTF 3N3DA 3KRAA 5ILDA 1YYQA 1V4IA 2ZY1A 4JYXA 1N1BA 2Z7HA 1VG6A 4RXDA 3RYWA 1UBWA 3CP6A 5A0IA 5IK9A 3WEIA 2ZCSA 5C05A 1WL0A 3WSAA 4OMGA 3PYAA 3AE0A 3KRFB 3VJEA 5IKHA 2AZLA 4LPHF 4GP2A 3KRPB 1UBVA 4F6XA 3LEEA 3QQVA 5EATA 5B02A 2P1CA 4LPGF 3N3LF 4QPFA 5AELA 4EA1A 3OACA 3V1VA 2Z78A 3TFVA 1HX9A 1N24A 5AYPA 3VJDA 4KK2A 3OABA 4LLTA 3SDQA 3WCMA 4NKFA 2F7MF 2E95A 4LUUA 4DXJA 2E4OA 4WK5A 4KQ5A 4LTVA 4KFAA 1HM4A 3P41A 3P8RA 1YYRA 3WCAA 3IPIA 4LA6A 5ERNA 3ZL6A 2AZJA 3WJNA 3WCBA 3DYGA 1HXCA 2Z52A 4LZCA 5IK0A 2FTZA 4RXEA 3KB9A 1DGPA 1YYUA 4F62A 3ZMCA 4RNQA 3KRFA 3V1XA 4KVIA 4MC0A 2E8VA 2J1OA 3KRCA 5E8HA 3ICMA 3LZ9A 1EZFA 1WL3A 3KRPA 3LDWA 1KIYA 3IBAA 3M0GA 1RTRA 2E8TA 3Q2ZA 1VG2A 1WL2A 2OGDA 3SDTA 4QXSF 5DJPF 5ER8A 5B0MA 5B0KA 3NF2A 1UBXA 1VG3A 3Q2QA 2E92A 4P0WA 3EGTA 4LXWA 4OKZA 3P5PA 4DEMF 3N5HF 5IKAA 4XQSF 3ADZA 4DZWA 3N46F 3PH7A 1YV5A 5E8KA 4L2XF 3LGZB 1V4HA 3PKOA 1N23A 2I19A 3ZOUA 1RQIA 3N0GA 3WE9A 2J5CA 3LG5A 5DGSF 3SDVA 2AZKA 4ZQ8A 3OABB 4NFIF 5JUZF 5ILYA 4PVYF 5DGNF 2E94A 5ILHA 3P8LA 4H5DF 5ILZA 2F92F 1YHLA 3KBKA 1UBYA 1N21A 4JZXA 3RYEA 5JV1F 4RXCA 3TC1A 5JA0F 3WEKA 4E9UA 4NUAA 4LOBA 3N6KF 1YQ7A 3DYHA 5B01A 5DW7A 2F89F 2J1PA 4GA3A 3QKCA 3KRCB 2RAHA 3CKEA 4LTZA 5DHIA 3WCDA 5IN8A 4XQRF 3TS7A 5AHUB 3LK5A
chains in the Genus database with same CATH topology
3EFQA 4NFJF 4KPJA 4LFEA 2AEKA 4N1ZF 2PS4A 2Z50A 5CG5A 2AETA 3LVSA 2DH4A 1N20A 4LFVF 2E93A 3M00A 3SDUA 2E8XA 3TFNA 3UCAA 3LSNA 5DJVF 4KPDA 3OYRA 4KQUA 2Q80A 1DI1A 4NKEA 3WCIA 2OPMA 4P0XA 3WCEA 3LOMA 3CC9A 1WY0A 3V66A 3WCCA 3WC9A 1VG4A 2OPNA 3NPRA 5I1UA 5IMIA 3G4DA 4LLSA 3ID0A 3PDEA 5IK6A 3LJIA 3SDRA 3ZCDA 4OGUA 4E1EA 4P0VA 1JFAA 3DYFA 5B03A 4JXNA 5B0IA 3WJKA 5ERMA 3WSBA 5EAUA 3SAEA 2ZCOA 1ZW5A 3WCLA 5IMNA 3WJOA 4RYPA 2AELA 4FJQA 1FPSA 5EASA 5IVGA 3N5JF 2E90A 4UMJA 3ZMBA 3APZA 2EWGA 4H5CF 1N22A 4DWBA 2FORA 5B0LA 3ASXA 1KIZA 3ACWA 5DZ2A 2VF6A 2ONHA 3KROB 4EA2A 5CG6A 5B0JA 2F8ZF 3ACXA 5HN8A 4KWDA 4OMHA 4H5EF 4LIXA 3WEFA 3NRIA 4MC3A 3M02A 4NG6A 2Q58A 5DGMF 1YJ4A 2Z4XA 3N45F 1V4EA 4GAXA 5JV0F 3RBMA 1HXAA 4KVYA 5HN9A 3N1WF 3TFPA 3MZVA 5DJRF 5HNAA 2F8CF 3Q1OA 4KKMA 3ICKA 2E8WA 3N0FA 3VJAA 2ZCRA 3Q30A 4EA0A 2OA6A 2ZEVA 4KQSA 2PS7A 4LZ0A 5ILIA 1WKZA 2H8OA 4JVJF 5HN7A 4KVDA 3S4JA 3RMGA 2PS8A 4K10A 3VJ9A 3W7FA 3VJ8A 3WCGA 2ONGA 3WEHA 3KROA 2PS6A 5A0KA 2ZEUA 4FP4A 4RXAA 1PS1A 3LMDA 3ICZA 5AFXA 5IMPA 4JXYA 2F94F 5EROA 5ILJA 2Z7IA 5DIQF 3N1VF 3N49F 1JFGA 3MAVA 1WMWA 3B7LA 1HM7A 2Z4WA 4KUXA 4OKMA 2Z4ZA 4NFKF 4HD1A 3BNYA 4DI5A 3PYBA 2E91A 5KSXF 4PVXF 4MC8A 4LZ3A 4N9UA 4GP1A 1HXGA 1VG7A 3VJBA 5B00A 5JV2F 3LLWA 3KRAB 2QISA 1YHMA 3ICNA 2Q9ZA 3AQ0A 1V4KA 3G4FA 2Z4YA 5IL8A 2E8UA 1YHKA 1WL1A 5E8LA 3LGKA 4DWGA 2Q9YA 3P5RA 2Z4VA 2ZCQA 3WCJA 4LFGA 2F9KF 5DHKA 4DHDA 3ACYA 3AQBB 1V4JA 3VJCA 3BNXA 5ILKA 3WCFA 3M9UA 4F6VA 3WEJA 1N1ZA 1RQJA 4Q23A 1YYSA 3WEGA 5IM1A 2PS5A 4JZBA 3OACB 5IL3A 3AQCB 3WCHA 4E9ZA 3M01A 1YYTA 5H9DA 3NPKA 3EZ3A 5A0JA 4KVWA 4LA5A 3S9VA 2O1OA 4XQTF 3N3DA 3KRAA 5ILDA 1YYQA 1V4IA 2ZY1A 4JYXA 1N1BA 2Z7HA 1VG6A 4RXDA 3RYWA 1UBWA 3CP6A 5A0IA 5IK9A 3WEIA 2ZCSA 5C05A 1WL0A 3WSAA 4OMGA 3PYAA 3AE0A 3KRFB 3VJEA 5IKHA 2AZLA 4LPHF 4GP2A 3KRPB 1UBVA 4F6XA 3LEEA 3QQVA 5EATA 5B02A 2P1CA 4LPGF 3N3LF 4QPFA 5AELA 4EA1A 3OACA 3V1VA 2Z78A 3TFVA 1HX9A 1N24A 5AYPA 3VJDA 4KK2A 3OABA 4LLTA 3SDQA 3WCMA 4NKFA 2F7MF 2E95A 4LUUA 4DXJA 2E4OA 4WK5A 4KQ5A 4LTVA 4KFAA 1HM4A 3P41A 3P8RA 1YYRA 3WCAA 3IPIA 4LA6A 5ERNA 3ZL6A 2AZJA 3WJNA 3WCBA 3DYGA 1HXCA 2Z52A 4LZCA 5IK0A 2FTZA 4RXEA 3KB9A 1DGPA 1YYUA 4F62A 3ZMCA 4RNQA 3KRFA 3V1XA 4KVIA 4MC0A 2E8VA 2J1OA 3KRCA 5E8HA 3ICMA 3LZ9A 1EZFA 1WL3A 3KRPA 3LDWA 1KIYA 3IBAA 3M0GA 1RTRA 2E8TA 3Q2ZA 1VG2A 1WL2A 2OGDA 3SDTA 4QXSF 5DJPF 5ER8A 5B0MA 5B0KA 3NF2A 1UBXA 1VG3A 3Q2QA 2E92A 4P0WA 3EGTA 4LXWA 4OKZA 3P5PA 4DEMF 3N5HF 5IKAA 4XQSF 3ADZA 4DZWA 3N46F 3PH7A 1YV5A 5E8KA 4L2XF 3LGZB 1V4HA 3PKOA 1N23A 2I19A 3ZOUA 1RQIA 3N0GA 3WE9A 2J5CA 3LG5A 5DGSF 3SDVA 2AZKA 4ZQ8A 3OABB 4NFIF 5JUZF 5ILYA 4PVYF 5DGNF 2E94A 5ILHA 3P8LA 4H5DF 5ILZA 2F92F 1YHLA 3KBKA 1UBYA 1N21A 4JZXA 3RYEA 5JV1F 4RXCA 3TC1A 5JA0F 3WEKA 4E9UA 4NUAA 4LOBA 3N6KF 1YQ7A 3DYHA 5B01A 5DW7A 2F89F 2J1PA 4GA3A 3QKCA 3KRCB 2RAHA 3CKEA 4LTZA 5DHIA 3WCDA 5IN8A 4XQRF 3TS7A 5AHUB 3LK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFQ A;  4NFJ F;  4KPJ A;  4LFE A;  2AEK A;  4N1Z F;  2PS4 A;  2Z50 A;  5CG5 A;  2AET A;  3LVS A;  2DH4 A;  1N20 A;  4LFV F;  2E93 A;  3M00 A;  3SDU A;  2E8X A;  3TFN A;  3UCA A;  3LSN A;  5DJV F;  4KPD A;  3OYR A;  4KQU A;  2Q80 A;  1DI1 A;  4NKE A;  3WCI A;  2OPM A;  4P0X A;  3WCE A;  3LOM A;  3CC9 A;  1WY0 A;  3V66 A;  3WCC A;  3WC9 A;  1VG4 A;  2OPN A;  3NPR A;  5I1U A;  5IMI A;  3G4D A;  4LLS A;  3ID0 A;  3PDE A;  5IK6 A;  3LJI A;  3SDR A;  3ZCD A;  4OGU A;  4E1E A;  4P0V A;  1JFA A;  3DYF A;  5B03 A;  4JXN A;  5B0I A;  3WJK A;  5ERM A;  3WSB A;  5EAU A;  3SAE A;  2ZCO A;  1ZW5 A;  3WCL A;  5IMN A;  3WJO A;  4RYP A;  2AEL A;  4FJQ A;  1FPS A;  5EAS A;  5IVG A;  3N5J F;  2E90 A;  4UMJ A;  3ZMB A;  3APZ A;  2EWG A;  4H5C F;  1N22 A;  4DWB A;  2FOR A;  5B0L A;  3ASX A;  1KIZ A;  3ACW A;  5DZ2 A;  2VF6 A;  2ONH A;  3KRO B;  4EA2 A;  5CG6 A;  5B0J A;  2F8Z F;  3ACX A;  5HN8 A;  4KWD A;  4OMH A;  4H5E F;  4LIX A;  3WEF A;  3NRI A;  4MC3 A;  3M02 A;  4NG6 A;  2Q58 A;  5DGM F;  1YJ4 A;  2Z4X A;  3N45 F;  1V4E A;  4GAX A;  5JV0 F;  3RBM A;  1HXA A;  4KVY A;  5HN9 A;  3N1W F;  3TFP A;  3MZV A;  5DJR F;  5HNA A;  2F8C F;  3Q1O A;  4KKM A;  3ICK A;  2E8W A;  3N0F A;  3VJA A;  2ZCR A;  3Q30 A;  4EA0 A;  2OA6 A;  2ZEV A;  4KQS A;  2PS7 A;  4LZ0 A;  5ILI A;  1WKZ A;  2H8O A;  4JVJ F;  5HN7 A;  4KVD A;  3S4J A;  3RMG A;  2PS8 A;  4K10 A;  3VJ9 A;  3W7F A;  3VJ8 A;  3WCG A;  2ONG A;  3WEH A;  3KRO A;  2PS6 A;  5A0K A;  2ZEU A;  4FP4 A;  4RXA A;  1PS1 A;  3LMD A;  3ICZ A;  5AFX A;  5IMP A;  4JXY A;  2F94 F;  5ERO A;  5ILJ A;  2Z7I A;  5DIQ F;  3N1V F;  3N49 F;  1JFG A;  3MAV A;  1WMW A;  3B7L A;  1HM7 A;  2Z4W A;  4KUX A;  4OKM A;  2Z4Z A;  4NFK F;  4HD1 A;  3BNY A;  4DI5 A;  3PYB A;  2E91 A;  5KSX F;  4PVX F;  4MC8 A;  4LZ3 A;  4N9U A;  4GP1 A;  1HXG A;  1VG7 A;  3VJB A;  5B00 A;  5JV2 F;  3LLW A;  3KRA B;  2QIS A;  1YHM A;  3ICN A;  2Q9Z A;  3AQ0 A;  1V4K A;  3G4F A;  2Z4Y A;  5IL8 A;  2E8U A;  1YHK A;  1WL1 A;  5E8L A;  3LGK A;  4DWG A;  2Q9Y A;  3P5R A;  2Z4V A;  2ZCQ A;  3WCJ A;  4LFG A;  2F9K F;  5DHK A;  4DHD A;  3ACY A;  3AQB B;  1V4J A;  3VJC A;  3BNX A;  5ILK A;  3WCF A;  3M9U A;  4F6V A;  3WEJ A;  1N1Z A;  1RQJ A;  4Q23 A;  1YYS A;  3WEG A;  5IM1 A;  2PS5 A;  4JZB A;  3OAC B;  5IL3 A;  3AQC B;  3WCH A;  4E9Z A;  3M01 A;  1YYT A;  5H9D A;  3NPK A;  3EZ3 A;  5A0J A;  4KVW A;  4LA5 A;  3S9V A;  2O1O A;  4XQT F;  3N3D A;  3KRA A;  5ILD A;  1YYQ A;  1V4I A;  2ZY1 A;  4JYX A;  1N1B A;  2Z7H A;  1VG6 A;  4RXD A;  3RYW A;  1UBW A;  3CP6 A;  5A0I A;  5IK9 A;  3WEI A;  2ZCS A;  5C05 A;  1WL0 A;  3WSA A;  4OMG A;  3PYA A;  3AE0 A;  3KRF B;  3VJE A;  5IKH A;  2AZL A;  4LPH F;  4GP2 A;  3KRP B;  1UBV A;  4F6X A;  3LEE A;  3QQV A;  5EAT A;  5B02 A;  2P1C A;  4LPG F;  3N3L F;  4QPF A;  5AEL A;  4EA1 A;  3OAC A;  3V1V A;  2Z78 A;  3TFV A;  1HX9 A;  1N24 A;  5AYP A;  3VJD A;  4KK2 A;  3OAB A;  4LLT A;  3SDQ A;  3WCM A;  4NKF A;  2F7M F;  2E95 A;  4LUU A;  4DXJ A;  2E4O A;  4WK5 A;  4KQ5 A;  4LTV A;  4KFA A;  1HM4 A;  3P41 A;  3P8R A;  1YYR A;  3WCA A;  3IPI A;  4LA6 A;  5ERN A;  3ZL6 A;  2AZJ A;  3WJN A;  3WCB A;  3DYG A;  1HXC A;  2Z52 A;  4LZC A;  5IK0 A;  2FTZ A;  4RXE A;  3KB9 A;  1DGP A;  1YYU A;  4F62 A;  3ZMC A;  4RNQ A;  3KRF A;  3V1X A;  4KVI A;  4MC0 A;  2E8V A;  2J1O A;  3KRC A;  5E8H A;  3ICM A;  3LZ9 A;  1EZF A;  1WL3 A;  3KRP A;  3LDW A;  1KIY A;  3IBA A;  3M0G A;  1RTR A;  2E8T A;  3Q2Z A;  1VG2 A;  1WL2 A;  2OGD A;  3SDT A;  4QXS F;  5DJP F;  5ER8 A;  5B0M A;  5B0K A;  3NF2 A;  1UBX A;  1VG3 A;  3Q2Q A;  2E92 A;  4P0W A;  3EGT A;  4LXW A;  4OKZ A;  3P5P A;  4DEM F;  3N5H F;  5IKA A;  4XQS F;  3ADZ A;  4DZW A;  3N46 F;  3PH7 A;  1YV5 A;  5E8K A;  4L2X F;  3LGZ B;  1V4H A;  3PKO A;  1N23 A;  2I19 A;  3ZOU A;  1RQI A;  3N0G A;  3WE9 A;  2J5C A;  3LG5 A;  5DGS F;  3SDV A;  2AZK A;  4ZQ8 A;  3OAB B;  4NFI F;  5JUZ F;  5ILY A;  4PVY F;  5DGN F;  2E94 A;  5ILH A;  3P8L A;  4H5D F;  5ILZ A;  2F92 F;  1YHL A;  3KBK A;  1UBY A;  1N21 A;  4JZX A;  3RYE A;  5JV1 F;  4RXC A;  3TC1 A;  5JA0 F;  3WEK A;  4E9U A;  4NUA A;  4LOB A;  3N6K F;  1YQ7 A;  3DYH A;  5B01 A;  5DW7 A;  2F89 F;  2J1P A;  4GA3 A;  3QKC A;  3KRC B;  2RAH A;  3CKE A;  4LTZ A;  5DHI A;  3WCD A;  5IN8 A;  4XQR F;  3TS7 A;  5AHU B;  3LK5 A; 
#chains in the Genus database with same CATH topology
 3EFQ A;  4NFJ F;  4KPJ A;  4LFE A;  2AEK A;  4N1Z F;  2PS4 A;  2Z50 A;  5CG5 A;  2AET A;  3LVS A;  2DH4 A;  1N20 A;  4LFV F;  2E93 A;  3M00 A;  3SDU A;  2E8X A;  3TFN A;  3UCA A;  3LSN A;  5DJV F;  4KPD A;  3OYR A;  4KQU A;  2Q80 A;  1DI1 A;  4NKE A;  3WCI A;  2OPM A;  4P0X A;  3WCE A;  3LOM A;  3CC9 A;  1WY0 A;  3V66 A;  3WCC A;  3WC9 A;  1VG4 A;  2OPN A;  3NPR A;  5I1U A;  5IMI A;  3G4D A;  4LLS A;  3ID0 A;  3PDE A;  5IK6 A;  3LJI A;  3SDR A;  3ZCD A;  4OGU A;  4E1E A;  4P0V A;  1JFA A;  3DYF A;  5B03 A;  4JXN A;  5B0I A;  3WJK A;  5ERM A;  3WSB A;  5EAU A;  3SAE A;  2ZCO A;  1ZW5 A;  3WCL A;  5IMN A;  3WJO A;  4RYP A;  2AEL A;  4FJQ A;  1FPS A;  5EAS A;  5IVG A;  3N5J F;  2E90 A;  4UMJ A;  3ZMB A;  3APZ A;  2EWG A;  4H5C F;  1N22 A;  4DWB A;  2FOR A;  5B0L A;  3ASX A;  1KIZ A;  3ACW A;  5DZ2 A;  2VF6 A;  2ONH A;  3KRO B;  4EA2 A;  5CG6 A;  5B0J A;  2F8Z F;  3ACX A;  5HN8 A;  4KWD A;  4OMH A;  4H5E F;  4LIX A;  3WEF A;  3NRI A;  4MC3 A;  3M02 A;  4NG6 A;  2Q58 A;  5DGM F;  1YJ4 A;  2Z4X A;  3N45 F;  1V4E A;  4GAX A;  5JV0 F;  3RBM A;  1HXA A;  4KVY A;  5HN9 A;  3N1W F;  3TFP A;  3MZV A;  5DJR F;  5HNA A;  2F8C F;  3Q1O A;  4KKM A;  3ICK A;  2E8W A;  3N0F A;  3VJA A;  2ZCR A;  3Q30 A;  4EA0 A;  2OA6 A;  2ZEV A;  4KQS A;  2PS7 A;  4LZ0 A;  5ILI A;  1WKZ A;  2H8O A;  4JVJ F;  5HN7 A;  4KVD A;  3S4J A;  3RMG A;  2PS8 A;  4K10 A;  3VJ9 A;  3W7F A;  3VJ8 A;  3WCG A;  2ONG A;  3WEH A;  3KRO A;  2PS6 A;  5A0K A;  2ZEU A;  4FP4 A;  4RXA A;  1PS1 A;  3LMD A;  3ICZ A;  5AFX A;  5IMP A;  4JXY A;  2F94 F;  5ERO A;  5ILJ A;  2Z7I A;  5DIQ F;  3N1V F;  3N49 F;  1JFG A;  3MAV A;  1WMW A;  3B7L A;  1HM7 A;  2Z4W A;  4KUX A;  4OKM A;  2Z4Z A;  4NFK F;  4HD1 A;  3BNY A;  4DI5 A;  3PYB A;  2E91 A;  5KSX F;  4PVX F;  4MC8 A;  4LZ3 A;  4N9U A;  4GP1 A;  1HXG A;  1VG7 A;  3VJB A;  5B00 A;  5JV2 F;  3LLW A;  3KRA B;  2QIS A;  1YHM A;  3ICN A;  2Q9Z A;  3AQ0 A;  1V4K A;  3G4F A;  2Z4Y A;  5IL8 A;  2E8U A;  1YHK A;  1WL1 A;  5E8L A;  3LGK A;  4DWG A;  2Q9Y A;  3P5R A;  2Z4V A;  2ZCQ A;  3WCJ A;  4LFG A;  2F9K F;  5DHK A;  4DHD A;  3ACY A;  3AQB B;  1V4J A;  3VJC A;  3BNX A;  5ILK A;  3WCF A;  3M9U A;  4F6V A;  3WEJ A;  1N1Z A;  1RQJ A;  4Q23 A;  1YYS A;  3WEG A;  5IM1 A;  2PS5 A;  4JZB A;  3OAC B;  5IL3 A;  3AQC B;  3WCH A;  4E9Z A;  3M01 A;  1YYT A;  5H9D A;  3NPK A;  3EZ3 A;  5A0J A;  4KVW A;  4LA5 A;  3S9V A;  2O1O A;  4XQT F;  3N3D A;  3KRA A;  5ILD A;  1YYQ A;  1V4I A;  2ZY1 A;  4JYX A;  1N1B A;  2Z7H A;  1VG6 A;  4RXD A;  3RYW A;  1UBW A;  3CP6 A;  5A0I A;  5IK9 A;  3WEI A;  2ZCS A;  5C05 A;  1WL0 A;  3WSA A;  4OMG A;  3PYA A;  3AE0 A;  3KRF B;  3VJE A;  5IKH A;  2AZL A;  4LPH F;  4GP2 A;  3KRP B;  1UBV A;  4F6X A;  3LEE A;  3QQV A;  5EAT A;  5B02 A;  2P1C A;  4LPG F;  3N3L F;  4QPF A;  5AEL A;  4EA1 A;  3OAC A;  3V1V A;  2Z78 A;  3TFV A;  1HX9 A;  1N24 A;  5AYP A;  3VJD A;  4KK2 A;  3OAB A;  4LLT A;  3SDQ A;  3WCM A;  4NKF A;  2F7M F;  2E95 A;  4LUU A;  4DXJ A;  2E4O A;  4WK5 A;  4KQ5 A;  4LTV A;  4KFA A;  1HM4 A;  3P41 A;  3P8R A;  1YYR A;  3WCA A;  3IPI A;  4LA6 A;  5ERN A;  3ZL6 A;  2AZJ A;  3WJN A;  3WCB A;  3DYG A;  1HXC A;  2Z52 A;  4LZC A;  5IK0 A;  2FTZ A;  4RXE A;  3KB9 A;  1DGP A;  1YYU A;  4F62 A;  3ZMC A;  4RNQ A;  3KRF A;  3V1X A;  4KVI A;  4MC0 A;  2E8V A;  2J1O A;  3KRC A;  5E8H A;  3ICM A;  3LZ9 A;  1EZF A;  1WL3 A;  3KRP A;  3LDW A;  1KIY A;  3IBA A;  3M0G A;  1RTR A;  2E8T A;  3Q2Z A;  1VG2 A;  1WL2 A;  2OGD A;  3SDT A;  4QXS F;  5DJP F;  5ER8 A;  5B0M A;  5B0K A;  3NF2 A;  1UBX A;  1VG3 A;  3Q2Q A;  2E92 A;  4P0W A;  3EGT A;  4LXW A;  4OKZ A;  3P5P A;  4DEM F;  3N5H F;  5IKA A;  4XQS F;  3ADZ A;  4DZW A;  3N46 F;  3PH7 A;  1YV5 A;  5E8K A;  4L2X F;  3LGZ B;  1V4H A;  3PKO A;  1N23 A;  2I19 A;  3ZOU A;  1RQI A;  3N0G A;  3WE9 A;  2J5C A;  3LG5 A;  5DGS F;  3SDV A;  2AZK A;  4ZQ8 A;  3OAB B;  4NFI F;  5JUZ F;  5ILY A;  4PVY F;  5DGN F;  2E94 A;  5ILH A;  3P8L A;  4H5D F;  5ILZ A;  2F92 F;  1YHL A;  3KBK A;  1UBY A;  1N21 A;  4JZX A;  3RYE A;  5JV1 F;  4RXC A;  3TC1 A;  5JA0 F;  3WEK A;  4E9U A;  4NUA A;  4LOB A;  3N6K F;  1YQ7 A;  3DYH A;  5B01 A;  5DW7 A;  2F89 F;  2J1P A;  4GA3 A;  3QKC A;  3KRC B;  2RAH A;  3CKE A;  4LTZ A;  5DHI A;  3WCD A;  5IN8 A;  4XQR F;  3TS7 A;  5AHU B;  3LK5 A; 
#chains in the Genus database with same CATH homology
 3EFQ A;  4NFJ F;  4KPJ A;  4LFE A;  2AEK A;  4N1Z F;  2PS4 A;  2Z50 A;  5CG5 A;  2AET A;  3LVS A;  2DH4 A;  1N20 A;  4LFV F;  2E93 A;  3M00 A;  3SDU A;  2E8X A;  3TFN A;  3UCA A;  3LSN A;  5DJV F;  4KPD A;  3OYR A;  4KQU A;  2Q80 A;  1DI1 A;  4NKE A;  3WCI A;  2OPM A;  4P0X A;  3WCE A;  3LOM A;  3CC9 A;  1WY0 A;  3V66 A;  3WCC A;  3WC9 A;  1VG4 A;  2OPN A;  3NPR A;  5I1U A;  5IMI A;  3G4D A;  4LLS A;  3ID0 A;  3PDE A;  5IK6 A;  3LJI A;  3SDR A;  3ZCD A;  4OGU A;  4E1E A;  4P0V A;  1JFA A;  3DYF A;  5B03 A;  4JXN A;  5B0I A;  3WJK A;  5ERM A;  3WSB A;  5EAU A;  3SAE A;  2ZCO A;  1ZW5 A;  3WCL A;  5IMN A;  3WJO A;  4RYP A;  2AEL A;  4FJQ A;  1FPS A;  5EAS A;  5IVG A;  3N5J F;  2E90 A;  4UMJ A;  3ZMB A;  3APZ A;  2EWG A;  4H5C F;  1N22 A;  4DWB A;  2FOR A;  5B0L A;  3ASX A;  1KIZ A;  3ACW A;  5DZ2 A;  2VF6 A;  2ONH A;  3KRO B;  4EA2 A;  5CG6 A;  5B0J A;  2F8Z F;  3ACX A;  5HN8 A;  4KWD A;  4OMH A;  4H5E F;  4LIX A;  3WEF A;  3NRI A;  4MC3 A;  3M02 A;  4NG6 A;  2Q58 A;  5DGM F;  1YJ4 A;  2Z4X A;  3N45 F;  1V4E A;  4GAX A;  5JV0 F;  3RBM A;  1HXA A;  4KVY A;  5HN9 A;  3N1W F;  3TFP A;  3MZV A;  5DJR F;  5HNA A;  2F8C F;  3Q1O A;  4KKM A;  3ICK A;  2E8W A;  3N0F A;  3VJA A;  2ZCR A;  3Q30 A;  4EA0 A;  2OA6 A;  2ZEV A;  4KQS A;  2PS7 A;  4LZ0 A;  5ILI A;  1WKZ A;  2H8O A;  4JVJ F;  5HN7 A;  4KVD A;  3S4J A;  3RMG A;  2PS8 A;  4K10 A;  3VJ9 A;  3W7F A;  3VJ8 A;  3WCG A;  2ONG A;  3WEH A;  3KRO A;  2PS6 A;  5A0K A;  2ZEU A;  4FP4 A;  4RXA A;  1PS1 A;  3LMD A;  3ICZ A;  5AFX A;  5IMP A;  4JXY A;  2F94 F;  5ERO A;  5ILJ A;  2Z7I A;  5DIQ F;  3N1V F;  3N49 F;  1JFG A;  3MAV A;  1WMW A;  3B7L A;  1HM7 A;  2Z4W A;  4KUX A;  4OKM A;  2Z4Z A;  4NFK F;  4HD1 A;  3BNY A;  4DI5 A;  3PYB A;  2E91 A;  5KSX F;  4PVX F;  4MC8 A;  4LZ3 A;  4N9U A;  4GP1 A;  1HXG A;  1VG7 A;  3VJB A;  5B00 A;  5JV2 F;  3LLW A;  3KRA B;  2QIS A;  1YHM A;  3ICN A;  2Q9Z A;  3AQ0 A;  1V4K A;  3G4F A;  2Z4Y A;  5IL8 A;  2E8U A;  1YHK A;  1WL1 A;  5E8L A;  3LGK A;  4DWG A;  2Q9Y A;  3P5R A;  2Z4V A;  2ZCQ A;  3WCJ A;  4LFG A;  2F9K F;  5DHK A;  4DHD A;  3ACY A;  3AQB B;  1V4J A;  3VJC A;  3BNX A;  5ILK A;  3WCF A;  3M9U A;  4F6V A;  3WEJ A;  1N1Z A;  1RQJ A;  4Q23 A;  1YYS A;  3WEG A;  5IM1 A;  2PS5 A;  4JZB A;  3OAC B;  5IL3 A;  3AQC B;  3WCH A;  4E9Z A;  3M01 A;  1YYT A;  5H9D A;  3NPK A;  3EZ3 A;  5A0J A;  4KVW A;  4LA5 A;  3S9V A;  2O1O A;  4XQT F;  3N3D A;  3KRA A;  5ILD A;  1YYQ A;  1V4I A;  2ZY1 A;  4JYX A;  1N1B A;  2Z7H A;  1VG6 A;  4RXD A;  3RYW A;  1UBW A;  3CP6 A;  5A0I A;  5IK9 A;  3WEI A;  2ZCS A;  5C05 A;  1WL0 A;  3WSA A;  4OMG A;  3PYA A;  3AE0 A;  3KRF B;  3VJE A;  5IKH A;  2AZL A;  4LPH F;  4GP2 A;  3KRP B;  1UBV A;  4F6X A;  3LEE A;  3QQV A;  5EAT A;  5B02 A;  2P1C A;  4LPG F;  3N3L F;  4QPF A;  5AEL A;  4EA1 A;  3OAC A;  3V1V A;  2Z78 A;  3TFV A;  1HX9 A;  1N24 A;  5AYP A;  3VJD A;  4KK2 A;  3OAB A;  4LLT A;  3SDQ A;  3WCM A;  4NKF A;  2F7M F;  2E95 A;  4LUU A;  4DXJ A;  2E4O A;  4WK5 A;  4KQ5 A;  4LTV A;  4KFA A;  1HM4 A;  3P41 A;  3P8R A;  1YYR A;  3WCA A;  3IPI A;  4LA6 A;  5ERN A;  3ZL6 A;  2AZJ A;  3WJN A;  3WCB A;  3DYG A;  1HXC A;  2Z52 A;  4LZC A;  5IK0 A;  2FTZ A;  4RXE A;  3KB9 A;  1DGP A;  1YYU A;  4F62 A;  3ZMC A;  4RNQ A;  3KRF A;  3V1X A;  4KVI A;  4MC0 A;  2E8V A;  2J1O A;  3KRC A;  5E8H A;  3ICM A;  3LZ9 A;  1EZF A;  1WL3 A;  3KRP A;  3LDW A;  1KIY A;  3IBA A;  3M0G A;  1RTR A;  2E8T A;  3Q2Z A;  1VG2 A;  1WL2 A;  2OGD A;  3SDT A;  4QXS F;  5DJP F;  5ER8 A;  5B0M A;  5B0K A;  3NF2 A;  1UBX A;  1VG3 A;  3Q2Q A;  2E92 A;  4P0W A;  3EGT A;  4LXW A;  4OKZ A;  3P5P A;  4DEM F;  3N5H F;  5IKA A;  4XQS F;  3ADZ A;  4DZW A;  3N46 F;  3PH7 A;  1YV5 A;  5E8K A;  4L2X F;  3LGZ B;  1V4H A;  3PKO A;  1N23 A;  2I19 A;  3ZOU A;  1RQI A;  3N0G A;  3WE9 A;  2J5C A;  3LG5 A;  5DGS F;  3SDV A;  2AZK A;  4ZQ8 A;  3OAB B;  4NFI F;  5JUZ F;  5ILY A;  4PVY F;  5DGN F;  2E94 A;  5ILH A;  3P8L A;  4H5D F;  5ILZ A;  2F92 F;  1YHL A;  3KBK A;  1UBY A;  1N21 A;  4JZX A;  3RYE A;  5JV1 F;  4RXC A;  3TC1 A;  5JA0 F;  3WEK A;  4E9U A;  4NUA A;  4LOB A;  3N6K F;  1YQ7 A;  3DYH A;  5B01 A;  5DW7 A;  2F89 F;  2J1P A;  4GA3 A;  3QKC A;  3KRC B;  2RAH A;  3CKE A;  4LTZ A;  5DHI A;  3WCD A;  5IN8 A;  4XQR F;  3TS7 A;  5AHU B;  3LK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...