4LLTA

Crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with two ipp and calcium bound in active site
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
300
structure length
300
Chain Sequence
DLGTENLYFQSMFTQRLDAAAAAVQAHFDKVLAAFEPLPIVEAMAHATSGGKRLRGFLVLETARLHDIAAGEAIWSATAIEALHAYSLVHDDLPCMDNDDMRRGQPTVHKKWDDATAVLAGDALQTLAFELVTHPGASASAEVRADLALSLARASGAQGMVLGQALDIAAETARAPLSLDEITRLQQGKTGALIGWSAQAGARLAQADTAALKRYAQALGLAFQIADDILDVTGDSAQVGKAVGKDASAGKATFVSLLGLDAARARAMSLIDEACDSLATYGAKADTLRETARFVVRRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Crystal structure of a farnesyl diphosphate synthase from Roseobacter denitrificans OCh 114, target EFI-509393, with two IPP and calcium bound in active site
rcsb
source organism Roseobacter denitrificans
total genus 127
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4lltA00
3TC1A 4E9ZA 4ZQ8A 3N1VF 1UBXA 3WEIA 3Q2ZA 3WEJA 3WCMA 3TFPA 3VJBA 3WJNA 3QQVA 1KIZA 1YHLA 4DWGA 2Q80A 1EZFA 3AQBB 3MZVA 4LLTA 5JA0F 2RAHA 2AETA 3DYGA 3CKEA 3OYRA 3QKCA 1VG2A 1UBVA 1WMWA 4OMHA 3KRPB 3P8RA 3OACB 4GA3A 3ZMCA 5A0KA 3TFVA 3OACA 1HM7A 5IK0A 2J5CA 3M01A 3TFNA 4P0XA 3CC9A 5CG5A 4NFJF 4LZ0A 3IBAA 4RYPA 4GAXA 3S4JA 2OPNA 3PKOA 3LG5A 4JXYA 3G4DA 3LK5A 5DW7A 5IMPA 4K10A 5IMIA 1V4JA 2Q9YA 3NRIA 5B0JA 5C05A 3LOMA 3M0GA 2E8VA 4LXWA 2FORA 3N1WF 3LEEA 3DYHA 4KPJA 5IM1A 2E93A 3KRFB 2DH4A 1FPSA 4LPGF 3KRFA 2Z4ZA 2Z4WA 4PVXF 1HM4A 4KVWA 2P1CA 3ACXA 5IL8A 2AZJA 3APZA 1HXGA 3N3LF 3WEKA 4MC0A 2E8WA 2ZCSA 3M9UA 3WEHA 4OGUA 5A0IA 1V4HA 5ILHA 3ZOUA 5DJVF 3WEGA 4LUUA 3RBMA 3RMGA 3WCGA 2O1OA 2OGDA 3M00A 4DHDA 3WCHA 5DIQF 2E90A 3ID0A 2J1PA 3MAVA 3NPKA 4OKZA 3V1VA 1N24A 3ZCDA 4RXEA 5ILYA 5ILIA 2ZCOA 1N23A 5ILJA 5H9DA 2F9KF 3UCAA 2I19A 2Z4VA 1HXAA 3LLWA 1KIYA 5B03A 2H8OA 1RQIA 2E8XA 2Q58A 4KFAA 1YJ4A 3G4FA 2VF6A 3N0GA 3N6KF 1YHMA 3WCLA 4NKEA 2Z52A 5AELA 3BNXA 3LGKA 4JYXA 5ERMA 4KK2A 3WCBA 4Q23A 4DXJA 2AZKA 4RXDA 4UMJA 2E95A 4L2XF 4NKFA 2F92F 1N22A 1VG7A 4OMGA 3S9VA 4LOBA 2E91A 3W7FA 4XQSF 3EGTA 3ZMBA 1RTRA 4NFKF 3Q30A 1N1ZA 4LFGA 5IK6A 2Q9ZA 5JV2F 4JVJF 5ILKA 5DGMF 2ZEUA 1HXCA 2Z50A 3WCEA 4LFEA 4KWDA 4KKMA 4E1EA 4N1ZF 2PS7A 4LZ3A 1DI1A 3ICZA 3EFQA 5IVGA 4P0WA 4EA2A 4KQSA 3N5HF 5ILDA 1WL0A 1YQ7A 5EASA 5DHKA 5E8KA 4N9UA 2QISA 2E94A 2OPMA 4LIXA 2PS6A 4QXSF 3SAEA 1VG4A 2FTZA 3ASXA 5HN7A 3ICKA 3KRAB 4KQ5A 3RYEA 1JFAA 3KRAA 5B02A 3LGZB 3Q1OA 3LVSA 3AE0A 3P5RA 3P41A 4LZCA 4XQTF 3ZL6A 3WEFA 5I1UA 3BNYA 4NFIF 3SDRA 2OA6A 4H5CF 3KROB 4JZXA 1WKZA 3KROA 3V66A 2ZCQA 5B0KA 3EZ3A 3VJAA 3VJ8A 3WCIA 1YYTA 4LTZA 1N21A 4KQUA 3VJDA 1DGPA 4KVDA 3V1XA 4OKMA 2F8CF 4KVIA 1N20A 4NUAA 4EA1A 3Q2QA 4LA6A 1YYQA 5DZ2A 5DHIA 3WJKA 4PVYF 5ERNA 4LTVA 5IN8A 2ZEVA 5EROA 2J1OA 3SDTA 1WL1A 2ZCRA 2Z7IA 1HX9A 4KUXA 5KSXF 5HNAA 2PS4A 3CP6A 2EWGA 3KRCB 5CG6A 3KRCA 3PDEA 3WCAA 2AEKA 4H5DF 3NF2A 4XQRF 3PYAA 2E4OA 3KBKA 1UBWA 3N0FA 4MC3A 2ONGA 1V4IA 5B0LA 5HN9A 2Z4XA 2Z4YA 2F94F 1N1BA 1WL2A 3WCCA 3VJEA 3IPIA 4QPFA 3B7LA 1RQJA 4LA5A 4RXCA 4WK5A 2ZY1A 5IMNA 3KB9A 5B00A 4F6VA 3LZ9A 4EA0A 3VJ9A 1VG3A 3ACWA 3WJOA 1VG6A 1YYUA 5B0MA 5DGSF 4F62A 4HD1A 4GP1A 4KVYA 5HN8A 4JZBA 3KRPA 4LFVF 5IL3A 5DJPF 4DZWA 3LSNA 5E8LA 3ICMA 4H5EF 3SDVA 4FP4A 4JXNA 5IKHA 3LJIA 5AHUB 1UBYA 1YYRA 5DJRF 5JV1F 3SDQA 2AELA 2E8TA 3N49F 4P0VA 1V4EA 5ER8A 2F7MF 5DGNF 3LMDA 3ACYA 1ZW5A 5B0IA 3WCDA 3WSBA 3WC9A 1PS1A 4DWBA 5EAUA 5JUZF 3P5PA 3WSAA 3ICNA 4FJQA 5A0JA 4DEMF 1WL3A 4RNQA 1YHKA 5B01A 3ADZA 3VJCA 3N45F 5IK9A 3N46F 4F6XA 2F8ZF 3AQCB 5IKAA 1JFGA 3PYBA 4GP2A 3WCJA 1YV5A 5ILZA 3M02A 1WY0A 3N5JF 3AQ0A 2PS5A 5JV0F 4RXAA 4DI5A 2PS8A 5EATA 3NPRA 3OABB 3SDUA 3N3DA 3OABA 5E8HA 2Z78A 2E92A 3WCFA 3DYFA 2ONHA 4NG6A 2F89F 2E8UA 5AYPA 3LDWA 5AFXA 3RYWA 1V4KA 3PH7A 3WE9A 2Z7HA 4MC8A 3TS7A 4E9UA 4LLSA 1YYSA 3P8LA 4KPDA 2AZLA 4LPHF
chains in the Genus database with same CATH superfamily
3TC1A 4E9ZA 4ZQ8A 3N1VF 1UBXA 3WEIA 3Q2ZA 3WEJA 3WCMA 3TFPA 3VJBA 3WJNA 3QQVA 1KIZA 1YHLA 4DWGA 2Q80A 1EZFA 3AQBB 3MZVA 4LLTA 5JA0F 2RAHA 2AETA 3DYGA 3CKEA 3OYRA 3QKCA 1VG2A 1UBVA 1WMWA 4OMHA 3KRPB 3P8RA 3OACB 4GA3A 3ZMCA 5A0KA 3TFVA 3OACA 1HM7A 5IK0A 2J5CA 3M01A 3TFNA 4P0XA 3CC9A 5CG5A 4NFJF 4LZ0A 3IBAA 4RYPA 4GAXA 3S4JA 2OPNA 3PKOA 3LG5A 4JXYA 3G4DA 3LK5A 5DW7A 5IMPA 4K10A 5IMIA 1V4JA 2Q9YA 3NRIA 5B0JA 5C05A 3LOMA 3M0GA 2E8VA 4LXWA 2FORA 3N1WF 3LEEA 3DYHA 4KPJA 5IM1A 2E93A 3KRFB 2DH4A 1FPSA 4LPGF 3KRFA 2Z4ZA 2Z4WA 4PVXF 1HM4A 4KVWA 2P1CA 3ACXA 5IL8A 2AZJA 3APZA 1HXGA 3N3LF 3WEKA 4MC0A 2E8WA 2ZCSA 3M9UA 3WEHA 4OGUA 5A0IA 1V4HA 5ILHA 3ZOUA 5DJVF 3WEGA 4LUUA 3RBMA 3RMGA 3WCGA 2O1OA 2OGDA 3M00A 4DHDA 3WCHA 5DIQF 2E90A 3ID0A 2J1PA 3MAVA 3NPKA 4OKZA 3V1VA 1N24A 3ZCDA 4RXEA 5ILYA 5ILIA 2ZCOA 1N23A 5ILJA 5H9DA 2F9KF 3UCAA 2I19A 2Z4VA 1HXAA 3LLWA 1KIYA 5B03A 2H8OA 1RQIA 2E8XA 2Q58A 4KFAA 1YJ4A 3G4FA 2VF6A 3N0GA 3N6KF 1YHMA 3WCLA 4NKEA 2Z52A 5AELA 3BNXA 3LGKA 4JYXA 5ERMA 4KK2A 3WCBA 4Q23A 4DXJA 2AZKA 4RXDA 4UMJA 2E95A 4L2XF 4NKFA 2F92F 1N22A 1VG7A 4OMGA 3S9VA 4LOBA 2E91A 3W7FA 4XQSF 3EGTA 3ZMBA 1RTRA 4NFKF 3Q30A 1N1ZA 4LFGA 5IK6A 2Q9ZA 5JV2F 4JVJF 5ILKA 5DGMF 2ZEUA 1HXCA 2Z50A 3WCEA 4LFEA 4KWDA 4KKMA 4E1EA 4N1ZF 2PS7A 4LZ3A 1DI1A 3ICZA 3EFQA 5IVGA 4P0WA 4EA2A 4KQSA 3N5HF 5ILDA 1WL0A 1YQ7A 5EASA 5DHKA 5E8KA 4N9UA 2QISA 2E94A 2OPMA 4LIXA 2PS6A 4QXSF 3SAEA 1VG4A 2FTZA 3ASXA 5HN7A 3ICKA 3KRAB 4KQ5A 3RYEA 1JFAA 3KRAA 5B02A 3LGZB 3Q1OA 3LVSA 3AE0A 3P5RA 3P41A 4LZCA 4XQTF 3ZL6A 3WEFA 5I1UA 3BNYA 4NFIF 3SDRA 2OA6A 4H5CF 3KROB 4JZXA 1WKZA 3KROA 3V66A 2ZCQA 5B0KA 3EZ3A 3VJAA 3VJ8A 3WCIA 1YYTA 4LTZA 1N21A 4KQUA 3VJDA 1DGPA 4KVDA 3V1XA 4OKMA 2F8CF 4KVIA 1N20A 4NUAA 4EA1A 3Q2QA 4LA6A 1YYQA 5DZ2A 5DHIA 3WJKA 4PVYF 5ERNA 4LTVA 5IN8A 2ZEVA 5EROA 2J1OA 3SDTA 1WL1A 2ZCRA 2Z7IA 1HX9A 4KUXA 5KSXF 5HNAA 2PS4A 3CP6A 2EWGA 3KRCB 5CG6A 3KRCA 3PDEA 3WCAA 2AEKA 4H5DF 3NF2A 4XQRF 3PYAA 2E4OA 3KBKA 1UBWA 3N0FA 4MC3A 2ONGA 1V4IA 5B0LA 5HN9A 2Z4XA 2Z4YA 2F94F 1N1BA 1WL2A 3WCCA 3VJEA 3IPIA 4QPFA 3B7LA 1RQJA 4LA5A 4RXCA 4WK5A 2ZY1A 5IMNA 3KB9A 5B00A 4F6VA 3LZ9A 4EA0A 3VJ9A 1VG3A 3ACWA 3WJOA 1VG6A 1YYUA 5B0MA 5DGSF 4F62A 4HD1A 4GP1A 4KVYA 5HN8A 4JZBA 3KRPA 4LFVF 5IL3A 5DJPF 4DZWA 3LSNA 5E8LA 3ICMA 4H5EF 3SDVA 4FP4A 4JXNA 5IKHA 3LJIA 5AHUB 1UBYA 1YYRA 5DJRF 5JV1F 3SDQA 2AELA 2E8TA 3N49F 4P0VA 1V4EA 5ER8A 2F7MF 5DGNF 3LMDA 3ACYA 1ZW5A 5B0IA 3WCDA 3WSBA 3WC9A 1PS1A 4DWBA 5EAUA 5JUZF 3P5PA 3WSAA 3ICNA 4FJQA 5A0JA 4DEMF 1WL3A 4RNQA 1YHKA 5B01A 3ADZA 3VJCA 3N45F 5IK9A 3N46F 4F6XA 2F8ZF 3AQCB 5IKAA 1JFGA 3PYBA 4GP2A 3WCJA 1YV5A 5ILZA 3M02A 1WY0A 3N5JF 3AQ0A 2PS5A 5JV0F 4RXAA 4DI5A 2PS8A 5EATA 3NPRA 3OABB 3SDUA 3N3DA 3OABA 5E8HA 2Z78A 2E92A 3WCFA 3DYFA 2ONHA 4NG6A 2F89F 2E8UA 5AYPA 3LDWA 5AFXA 3RYWA 1V4KA 3PH7A 3WE9A 2Z7HA 4MC8A 3TS7A 4E9UA 4LLSA 1YYSA 3P8LA 4KPDA 2AZLA 4LPHF
chains in the Genus database with same CATH topology
3TC1A 4E9ZA 4ZQ8A 3N1VF 1UBXA 3WEIA 3Q2ZA 3WEJA 3WCMA 3TFPA 3VJBA 3WJNA 3QQVA 1KIZA 1YHLA 4DWGA 2Q80A 1EZFA 3AQBB 3MZVA 4LLTA 5JA0F 2RAHA 2AETA 3DYGA 3CKEA 3OYRA 3QKCA 1VG2A 1UBVA 1WMWA 4OMHA 3KRPB 3P8RA 3OACB 4GA3A 3ZMCA 5A0KA 3TFVA 3OACA 1HM7A 5IK0A 2J5CA 3M01A 3TFNA 4P0XA 3CC9A 5CG5A 4NFJF 4LZ0A 3IBAA 4RYPA 4GAXA 3S4JA 2OPNA 3PKOA 3LG5A 4JXYA 3G4DA 3LK5A 5DW7A 5IMPA 4K10A 5IMIA 1V4JA 2Q9YA 3NRIA 5B0JA 5C05A 3LOMA 3M0GA 2E8VA 4LXWA 2FORA 3N1WF 3LEEA 3DYHA 4KPJA 5IM1A 2E93A 3KRFB 2DH4A 1FPSA 4LPGF 3KRFA 2Z4ZA 2Z4WA 4PVXF 1HM4A 4KVWA 2P1CA 3ACXA 5IL8A 2AZJA 3APZA 1HXGA 3N3LF 3WEKA 4MC0A 2E8WA 2ZCSA 3M9UA 3WEHA 4OGUA 5A0IA 1V4HA 5ILHA 3ZOUA 5DJVF 3WEGA 4LUUA 3RBMA 3RMGA 3WCGA 2O1OA 2OGDA 3M00A 4DHDA 3WCHA 5DIQF 2E90A 3ID0A 2J1PA 3MAVA 3NPKA 4OKZA 3V1VA 1N24A 3ZCDA 4RXEA 5ILYA 5ILIA 2ZCOA 1N23A 5ILJA 5H9DA 2F9KF 3UCAA 2I19A 2Z4VA 1HXAA 3LLWA 1KIYA 5B03A 2H8OA 1RQIA 2E8XA 2Q58A 4KFAA 1YJ4A 3G4FA 2VF6A 3N0GA 3N6KF 1YHMA 3WCLA 4NKEA 2Z52A 5AELA 3BNXA 3LGKA 4JYXA 5ERMA 4KK2A 3WCBA 4Q23A 4DXJA 2AZKA 4RXDA 4UMJA 2E95A 4L2XF 4NKFA 2F92F 1N22A 1VG7A 4OMGA 3S9VA 4LOBA 2E91A 3W7FA 4XQSF 3EGTA 3ZMBA 1RTRA 4NFKF 3Q30A 1N1ZA 4LFGA 5IK6A 2Q9ZA 5JV2F 4JVJF 5ILKA 5DGMF 2ZEUA 1HXCA 2Z50A 3WCEA 4LFEA 4KWDA 4KKMA 4E1EA 4N1ZF 2PS7A 4LZ3A 1DI1A 3ICZA 3EFQA 5IVGA 4P0WA 4EA2A 4KQSA 3N5HF 5ILDA 1WL0A 1YQ7A 5EASA 5DHKA 5E8KA 4N9UA 2QISA 2E94A 2OPMA 4LIXA 2PS6A 4QXSF 3SAEA 1VG4A 2FTZA 3ASXA 5HN7A 3ICKA 3KRAB 4KQ5A 3RYEA 1JFAA 3KRAA 5B02A 3LGZB 3Q1OA 3LVSA 3AE0A 3P5RA 3P41A 4LZCA 4XQTF 3ZL6A 3WEFA 5I1UA 3BNYA 4NFIF 3SDRA 2OA6A 4H5CF 3KROB 4JZXA 1WKZA 3KROA 3V66A 2ZCQA 5B0KA 3EZ3A 3VJAA 3VJ8A 3WCIA 1YYTA 4LTZA 1N21A 4KQUA 3VJDA 1DGPA 4KVDA 3V1XA 4OKMA 2F8CF 4KVIA 1N20A 4NUAA 4EA1A 3Q2QA 4LA6A 1YYQA 5DZ2A 5DHIA 3WJKA 4PVYF 5ERNA 4LTVA 5IN8A 2ZEVA 5EROA 2J1OA 3SDTA 1WL1A 2ZCRA 2Z7IA 1HX9A 4KUXA 5KSXF 5HNAA 2PS4A 3CP6A 2EWGA 3KRCB 5CG6A 3KRCA 3PDEA 3WCAA 2AEKA 4H5DF 3NF2A 4XQRF 3PYAA 2E4OA 3KBKA 1UBWA 3N0FA 4MC3A 2ONGA 1V4IA 5B0LA 5HN9A 2Z4XA 2Z4YA 2F94F 1N1BA 1WL2A 3WCCA 3VJEA 3IPIA 4QPFA 3B7LA 1RQJA 4LA5A 4RXCA 4WK5A 2ZY1A 5IMNA 3KB9A 5B00A 4F6VA 3LZ9A 4EA0A 3VJ9A 1VG3A 3ACWA 3WJOA 1VG6A 1YYUA 5B0MA 5DGSF 4F62A 4HD1A 4GP1A 4KVYA 5HN8A 4JZBA 3KRPA 4LFVF 5IL3A 5DJPF 4DZWA 3LSNA 5E8LA 3ICMA 4H5EF 3SDVA 4FP4A 4JXNA 5IKHA 3LJIA 5AHUB 1UBYA 1YYRA 5DJRF 5JV1F 3SDQA 2AELA 2E8TA 3N49F 4P0VA 1V4EA 5ER8A 2F7MF 5DGNF 3LMDA 3ACYA 1ZW5A 5B0IA 3WCDA 3WSBA 3WC9A 1PS1A 4DWBA 5EAUA 5JUZF 3P5PA 3WSAA 3ICNA 4FJQA 5A0JA 4DEMF 1WL3A 4RNQA 1YHKA 5B01A 3ADZA 3VJCA 3N45F 5IK9A 3N46F 4F6XA 2F8ZF 3AQCB 5IKAA 1JFGA 3PYBA 4GP2A 3WCJA 1YV5A 5ILZA 3M02A 1WY0A 3N5JF 3AQ0A 2PS5A 5JV0F 4RXAA 4DI5A 2PS8A 5EATA 3NPRA 3OABB 3SDUA 3N3DA 3OABA 5E8HA 2Z78A 2E92A 3WCFA 3DYFA 2ONHA 4NG6A 2F89F 2E8UA 5AYPA 3LDWA 5AFXA 3RYWA 1V4KA 3PH7A 3WE9A 2Z7HA 4MC8A 3TS7A 4E9UA 4LLSA 1YYSA 3P8LA 4KPDA 2AZLA 4LPHF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TC1 A;  4E9Z A;  4ZQ8 A;  3N1V F;  1UBX A;  3WEI A;  3Q2Z A;  3WEJ A;  3WCM A;  3TFP A;  3VJB A;  3WJN A;  3QQV A;  1KIZ A;  1YHL A;  4DWG A;  2Q80 A;  1EZF A;  3AQB B;  3MZV A;  4LLT A;  5JA0 F;  2RAH A;  2AET A;  3DYG A;  3CKE A;  3OYR A;  3QKC A;  1VG2 A;  1UBV A;  1WMW A;  4OMH A;  3KRP B;  3P8R A;  3OAC B;  4GA3 A;  3ZMC A;  5A0K A;  3TFV A;  3OAC A;  1HM7 A;  5IK0 A;  2J5C A;  3M01 A;  3TFN A;  4P0X A;  3CC9 A;  5CG5 A;  4NFJ F;  4LZ0 A;  3IBA A;  4RYP A;  4GAX A;  3S4J A;  2OPN A;  3PKO A;  3LG5 A;  4JXY A;  3G4D A;  3LK5 A;  5DW7 A;  5IMP A;  4K10 A;  5IMI A;  1V4J A;  2Q9Y A;  3NRI A;  5B0J A;  5C05 A;  3LOM A;  3M0G A;  2E8V A;  4LXW A;  2FOR A;  3N1W F;  3LEE A;  3DYH A;  4KPJ A;  5IM1 A;  2E93 A;  3KRF B;  2DH4 A;  1FPS A;  4LPG F;  3KRF A;  2Z4Z A;  2Z4W A;  4PVX F;  1HM4 A;  4KVW A;  2P1C A;  3ACX A;  5IL8 A;  2AZJ A;  3APZ A;  1HXG A;  3N3L F;  3WEK A;  4MC0 A;  2E8W A;  2ZCS A;  3M9U A;  3WEH A;  4OGU A;  5A0I A;  1V4H A;  5ILH A;  3ZOU A;  5DJV F;  3WEG A;  4LUU A;  3RBM A;  3RMG A;  3WCG A;  2O1O A;  2OGD A;  3M00 A;  4DHD A;  3WCH A;  5DIQ F;  2E90 A;  3ID0 A;  2J1P A;  3MAV A;  3NPK A;  4OKZ A;  3V1V A;  1N24 A;  3ZCD A;  4RXE A;  5ILY A;  5ILI A;  2ZCO A;  1N23 A;  5ILJ A;  5H9D A;  2F9K F;  3UCA A;  2I19 A;  2Z4V A;  1HXA A;  3LLW A;  1KIY A;  5B03 A;  2H8O A;  1RQI A;  2E8X A;  2Q58 A;  4KFA A;  1YJ4 A;  3G4F A;  2VF6 A;  3N0G A;  3N6K F;  1YHM A;  3WCL A;  4NKE A;  2Z52 A;  5AEL A;  3BNX A;  3LGK A;  4JYX A;  5ERM A;  4KK2 A;  3WCB A;  4Q23 A;  4DXJ A;  2AZK A;  4RXD A;  4UMJ A;  2E95 A;  4L2X F;  4NKF A;  2F92 F;  1N22 A;  1VG7 A;  4OMG A;  3S9V A;  4LOB A;  2E91 A;  3W7F A;  4XQS F;  3EGT A;  3ZMB A;  1RTR A;  4NFK F;  3Q30 A;  1N1Z A;  4LFG A;  5IK6 A;  2Q9Z A;  5JV2 F;  4JVJ F;  5ILK A;  5DGM F;  2ZEU A;  1HXC A;  2Z50 A;  3WCE A;  4LFE A;  4KWD A;  4KKM A;  4E1E A;  4N1Z F;  2PS7 A;  4LZ3 A;  1DI1 A;  3ICZ A;  3EFQ A;  5IVG A;  4P0W A;  4EA2 A;  4KQS A;  3N5H F;  5ILD A;  1WL0 A;  1YQ7 A;  5EAS A;  5DHK A;  5E8K A;  4N9U A;  2QIS A;  2E94 A;  2OPM A;  4LIX A;  2PS6 A;  4QXS F;  3SAE A;  1VG4 A;  2FTZ A;  3ASX A;  5HN7 A;  3ICK A;  3KRA B;  4KQ5 A;  3RYE A;  1JFA A;  3KRA A;  5B02 A;  3LGZ B;  3Q1O A;  3LVS A;  3AE0 A;  3P5R A;  3P41 A;  4LZC A;  4XQT F;  3ZL6 A;  3WEF A;  5I1U A;  3BNY A;  4NFI F;  3SDR A;  2OA6 A;  4H5C F;  3KRO B;  4JZX A;  1WKZ A;  3KRO A;  3V66 A;  2ZCQ A;  5B0K A;  3EZ3 A;  3VJA A;  3VJ8 A;  3WCI A;  1YYT A;  4LTZ A;  1N21 A;  4KQU A;  3VJD A;  1DGP A;  4KVD A;  3V1X A;  4OKM A;  2F8C F;  4KVI A;  1N20 A;  4NUA A;  4EA1 A;  3Q2Q A;  4LA6 A;  1YYQ A;  5DZ2 A;  5DHI A;  3WJK A;  4PVY F;  5ERN A;  4LTV A;  5IN8 A;  2ZEV A;  5ERO A;  2J1O A;  3SDT A;  1WL1 A;  2ZCR A;  2Z7I A;  1HX9 A;  4KUX A;  5KSX F;  5HNA A;  2PS4 A;  3CP6 A;  2EWG A;  3KRC B;  5CG6 A;  3KRC A;  3PDE A;  3WCA A;  2AEK A;  4H5D F;  3NF2 A;  4XQR F;  3PYA A;  2E4O A;  3KBK A;  1UBW A;  3N0F A;  4MC3 A;  2ONG A;  1V4I A;  5B0L A;  5HN9 A;  2Z4X A;  2Z4Y A;  2F94 F;  1N1B A;  1WL2 A;  3WCC A;  3VJE A;  3IPI A;  4QPF A;  3B7L A;  1RQJ A;  4LA5 A;  4RXC A;  4WK5 A;  2ZY1 A;  5IMN A;  3KB9 A;  5B00 A;  4F6V A;  3LZ9 A;  4EA0 A;  3VJ9 A;  1VG3 A;  3ACW A;  3WJO A;  1VG6 A;  1YYU A;  5B0M A;  5DGS F;  4F62 A;  4HD1 A;  4GP1 A;  4KVY A;  5HN8 A;  4JZB A;  3KRP A;  4LFV F;  5IL3 A;  5DJP F;  4DZW A;  3LSN A;  5E8L A;  3ICM A;  4H5E F;  3SDV A;  4FP4 A;  4JXN A;  5IKH A;  3LJI A;  5AHU B;  1UBY A;  1YYR A;  5DJR F;  5JV1 F;  3SDQ A;  2AEL A;  2E8T A;  3N49 F;  4P0V A;  1V4E A;  5ER8 A;  2F7M F;  5DGN F;  3LMD A;  3ACY A;  1ZW5 A;  5B0I A;  3WCD A;  3WSB A;  3WC9 A;  1PS1 A;  4DWB A;  5EAU A;  5JUZ F;  3P5P A;  3WSA A;  3ICN A;  4FJQ A;  5A0J A;  4DEM F;  1WL3 A;  4RNQ A;  1YHK A;  5B01 A;  3ADZ A;  3VJC A;  3N45 F;  5IK9 A;  3N46 F;  4F6X A;  2F8Z F;  3AQC B;  5IKA A;  1JFG A;  3PYB A;  4GP2 A;  3WCJ A;  1YV5 A;  5ILZ A;  3M02 A;  1WY0 A;  3N5J F;  3AQ0 A;  2PS5 A;  5JV0 F;  4RXA A;  4DI5 A;  2PS8 A;  5EAT A;  3NPR A;  3OAB B;  3SDU A;  3N3D A;  3OAB A;  5E8H A;  2Z78 A;  2E92 A;  3WCF A;  3DYF A;  2ONH A;  4NG6 A;  2F89 F;  2E8U A;  5AYP A;  3LDW A;  5AFX A;  3RYW A;  1V4K A;  3PH7 A;  3WE9 A;  2Z7H A;  4MC8 A;  3TS7 A;  4E9U A;  4LLS A;  1YYS A;  3P8L A;  4KPD A;  2AZL A;  4LPH F; 
#chains in the Genus database with same CATH topology
 3TC1 A;  4E9Z A;  4ZQ8 A;  3N1V F;  1UBX A;  3WEI A;  3Q2Z A;  3WEJ A;  3WCM A;  3TFP A;  3VJB A;  3WJN A;  3QQV A;  1KIZ A;  1YHL A;  4DWG A;  2Q80 A;  1EZF A;  3AQB B;  3MZV A;  4LLT A;  5JA0 F;  2RAH A;  2AET A;  3DYG A;  3CKE A;  3OYR A;  3QKC A;  1VG2 A;  1UBV A;  1WMW A;  4OMH A;  3KRP B;  3P8R A;  3OAC B;  4GA3 A;  3ZMC A;  5A0K A;  3TFV A;  3OAC A;  1HM7 A;  5IK0 A;  2J5C A;  3M01 A;  3TFN A;  4P0X A;  3CC9 A;  5CG5 A;  4NFJ F;  4LZ0 A;  3IBA A;  4RYP A;  4GAX A;  3S4J A;  2OPN A;  3PKO A;  3LG5 A;  4JXY A;  3G4D A;  3LK5 A;  5DW7 A;  5IMP A;  4K10 A;  5IMI A;  1V4J A;  2Q9Y A;  3NRI A;  5B0J A;  5C05 A;  3LOM A;  3M0G A;  2E8V A;  4LXW A;  2FOR A;  3N1W F;  3LEE A;  3DYH A;  4KPJ A;  5IM1 A;  2E93 A;  3KRF B;  2DH4 A;  1FPS A;  4LPG F;  3KRF A;  2Z4Z A;  2Z4W A;  4PVX F;  1HM4 A;  4KVW A;  2P1C A;  3ACX A;  5IL8 A;  2AZJ A;  3APZ A;  1HXG A;  3N3L F;  3WEK A;  4MC0 A;  2E8W A;  2ZCS A;  3M9U A;  3WEH A;  4OGU A;  5A0I A;  1V4H A;  5ILH A;  3ZOU A;  5DJV F;  3WEG A;  4LUU A;  3RBM A;  3RMG A;  3WCG A;  2O1O A;  2OGD A;  3M00 A;  4DHD A;  3WCH A;  5DIQ F;  2E90 A;  3ID0 A;  2J1P A;  3MAV A;  3NPK A;  4OKZ A;  3V1V A;  1N24 A;  3ZCD A;  4RXE A;  5ILY A;  5ILI A;  2ZCO A;  1N23 A;  5ILJ A;  5H9D A;  2F9K F;  3UCA A;  2I19 A;  2Z4V A;  1HXA A;  3LLW A;  1KIY A;  5B03 A;  2H8O A;  1RQI A;  2E8X A;  2Q58 A;  4KFA A;  1YJ4 A;  3G4F A;  2VF6 A;  3N0G A;  3N6K F;  1YHM A;  3WCL A;  4NKE A;  2Z52 A;  5AEL A;  3BNX A;  3LGK A;  4JYX A;  5ERM A;  4KK2 A;  3WCB A;  4Q23 A;  4DXJ A;  2AZK A;  4RXD A;  4UMJ A;  2E95 A;  4L2X F;  4NKF A;  2F92 F;  1N22 A;  1VG7 A;  4OMG A;  3S9V A;  4LOB A;  2E91 A;  3W7F A;  4XQS F;  3EGT A;  3ZMB A;  1RTR A;  4NFK F;  3Q30 A;  1N1Z A;  4LFG A;  5IK6 A;  2Q9Z A;  5JV2 F;  4JVJ F;  5ILK A;  5DGM F;  2ZEU A;  1HXC A;  2Z50 A;  3WCE A;  4LFE A;  4KWD A;  4KKM A;  4E1E A;  4N1Z F;  2PS7 A;  4LZ3 A;  1DI1 A;  3ICZ A;  3EFQ A;  5IVG A;  4P0W A;  4EA2 A;  4KQS A;  3N5H F;  5ILD A;  1WL0 A;  1YQ7 A;  5EAS A;  5DHK A;  5E8K A;  4N9U A;  2QIS A;  2E94 A;  2OPM A;  4LIX A;  2PS6 A;  4QXS F;  3SAE A;  1VG4 A;  2FTZ A;  3ASX A;  5HN7 A;  3ICK A;  3KRA B;  4KQ5 A;  3RYE A;  1JFA A;  3KRA A;  5B02 A;  3LGZ B;  3Q1O A;  3LVS A;  3AE0 A;  3P5R A;  3P41 A;  4LZC A;  4XQT F;  3ZL6 A;  3WEF A;  5I1U A;  3BNY A;  4NFI F;  3SDR A;  2OA6 A;  4H5C F;  3KRO B;  4JZX A;  1WKZ A;  3KRO A;  3V66 A;  2ZCQ A;  5B0K A;  3EZ3 A;  3VJA A;  3VJ8 A;  3WCI A;  1YYT A;  4LTZ A;  1N21 A;  4KQU A;  3VJD A;  1DGP A;  4KVD A;  3V1X A;  4OKM A;  2F8C F;  4KVI A;  1N20 A;  4NUA A;  4EA1 A;  3Q2Q A;  4LA6 A;  1YYQ A;  5DZ2 A;  5DHI A;  3WJK A;  4PVY F;  5ERN A;  4LTV A;  5IN8 A;  2ZEV A;  5ERO A;  2J1O A;  3SDT A;  1WL1 A;  2ZCR A;  2Z7I A;  1HX9 A;  4KUX A;  5KSX F;  5HNA A;  2PS4 A;  3CP6 A;  2EWG A;  3KRC B;  5CG6 A;  3KRC A;  3PDE A;  3WCA A;  2AEK A;  4H5D F;  3NF2 A;  4XQR F;  3PYA A;  2E4O A;  3KBK A;  1UBW A;  3N0F A;  4MC3 A;  2ONG A;  1V4I A;  5B0L A;  5HN9 A;  2Z4X A;  2Z4Y A;  2F94 F;  1N1B A;  1WL2 A;  3WCC A;  3VJE A;  3IPI A;  4QPF A;  3B7L A;  1RQJ A;  4LA5 A;  4RXC A;  4WK5 A;  2ZY1 A;  5IMN A;  3KB9 A;  5B00 A;  4F6V A;  3LZ9 A;  4EA0 A;  3VJ9 A;  1VG3 A;  3ACW A;  3WJO A;  1VG6 A;  1YYU A;  5B0M A;  5DGS F;  4F62 A;  4HD1 A;  4GP1 A;  4KVY A;  5HN8 A;  4JZB A;  3KRP A;  4LFV F;  5IL3 A;  5DJP F;  4DZW A;  3LSN A;  5E8L A;  3ICM A;  4H5E F;  3SDV A;  4FP4 A;  4JXN A;  5IKH A;  3LJI A;  5AHU B;  1UBY A;  1YYR A;  5DJR F;  5JV1 F;  3SDQ A;  2AEL A;  2E8T A;  3N49 F;  4P0V A;  1V4E A;  5ER8 A;  2F7M F;  5DGN F;  3LMD A;  3ACY A;  1ZW5 A;  5B0I A;  3WCD A;  3WSB A;  3WC9 A;  1PS1 A;  4DWB A;  5EAU A;  5JUZ F;  3P5P A;  3WSA A;  3ICN A;  4FJQ A;  5A0J A;  4DEM F;  1WL3 A;  4RNQ A;  1YHK A;  5B01 A;  3ADZ A;  3VJC A;  3N45 F;  5IK9 A;  3N46 F;  4F6X A;  2F8Z F;  3AQC B;  5IKA A;  1JFG A;  3PYB A;  4GP2 A;  3WCJ A;  1YV5 A;  5ILZ A;  3M02 A;  1WY0 A;  3N5J F;  3AQ0 A;  2PS5 A;  5JV0 F;  4RXA A;  4DI5 A;  2PS8 A;  5EAT A;  3NPR A;  3OAB B;  3SDU A;  3N3D A;  3OAB A;  5E8H A;  2Z78 A;  2E92 A;  3WCF A;  3DYF A;  2ONH A;  4NG6 A;  2F89 F;  2E8U A;  5AYP A;  3LDW A;  5AFX A;  3RYW A;  1V4K A;  3PH7 A;  3WE9 A;  2Z7H A;  4MC8 A;  3TS7 A;  4E9U A;  4LLS A;  1YYS A;  3P8L A;  4KPD A;  2AZL A;  4LPH F; 
#chains in the Genus database with same CATH homology
 3TC1 A;  4E9Z A;  4ZQ8 A;  3N1V F;  1UBX A;  3WEI A;  3Q2Z A;  3WEJ A;  3WCM A;  3TFP A;  3VJB A;  3WJN A;  3QQV A;  1KIZ A;  1YHL A;  4DWG A;  2Q80 A;  1EZF A;  3AQB B;  3MZV A;  4LLT A;  5JA0 F;  2RAH A;  2AET A;  3DYG A;  3CKE A;  3OYR A;  3QKC A;  1VG2 A;  1UBV A;  1WMW A;  4OMH A;  3KRP B;  3P8R A;  3OAC B;  4GA3 A;  3ZMC A;  5A0K A;  3TFV A;  3OAC A;  1HM7 A;  5IK0 A;  2J5C A;  3M01 A;  3TFN A;  4P0X A;  3CC9 A;  5CG5 A;  4NFJ F;  4LZ0 A;  3IBA A;  4RYP A;  4GAX A;  3S4J A;  2OPN A;  3PKO A;  3LG5 A;  4JXY A;  3G4D A;  3LK5 A;  5DW7 A;  5IMP A;  4K10 A;  5IMI A;  1V4J A;  2Q9Y A;  3NRI A;  5B0J A;  5C05 A;  3LOM A;  3M0G A;  2E8V A;  4LXW A;  2FOR A;  3N1W F;  3LEE A;  3DYH A;  4KPJ A;  5IM1 A;  2E93 A;  3KRF B;  2DH4 A;  1FPS A;  4LPG F;  3KRF A;  2Z4Z A;  2Z4W A;  4PVX F;  1HM4 A;  4KVW A;  2P1C A;  3ACX A;  5IL8 A;  2AZJ A;  3APZ A;  1HXG A;  3N3L F;  3WEK A;  4MC0 A;  2E8W A;  2ZCS A;  3M9U A;  3WEH A;  4OGU A;  5A0I A;  1V4H A;  5ILH A;  3ZOU A;  5DJV F;  3WEG A;  4LUU A;  3RBM A;  3RMG A;  3WCG A;  2O1O A;  2OGD A;  3M00 A;  4DHD A;  3WCH A;  5DIQ F;  2E90 A;  3ID0 A;  2J1P A;  3MAV A;  3NPK A;  4OKZ A;  3V1V A;  1N24 A;  3ZCD A;  4RXE A;  5ILY A;  5ILI A;  2ZCO A;  1N23 A;  5ILJ A;  5H9D A;  2F9K F;  3UCA A;  2I19 A;  2Z4V A;  1HXA A;  3LLW A;  1KIY A;  5B03 A;  2H8O A;  1RQI A;  2E8X A;  2Q58 A;  4KFA A;  1YJ4 A;  3G4F A;  2VF6 A;  3N0G A;  3N6K F;  1YHM A;  3WCL A;  4NKE A;  2Z52 A;  5AEL A;  3BNX A;  3LGK A;  4JYX A;  5ERM A;  4KK2 A;  3WCB A;  4Q23 A;  4DXJ A;  2AZK A;  4RXD A;  4UMJ A;  2E95 A;  4L2X F;  4NKF A;  2F92 F;  1N22 A;  1VG7 A;  4OMG A;  3S9V A;  4LOB A;  2E91 A;  3W7F A;  4XQS F;  3EGT A;  3ZMB A;  1RTR A;  4NFK F;  3Q30 A;  1N1Z A;  4LFG A;  5IK6 A;  2Q9Z A;  5JV2 F;  4JVJ F;  5ILK A;  5DGM F;  2ZEU A;  1HXC A;  2Z50 A;  3WCE A;  4LFE A;  4KWD A;  4KKM A;  4E1E A;  4N1Z F;  2PS7 A;  4LZ3 A;  1DI1 A;  3ICZ A;  3EFQ A;  5IVG A;  4P0W A;  4EA2 A;  4KQS A;  3N5H F;  5ILD A;  1WL0 A;  1YQ7 A;  5EAS A;  5DHK A;  5E8K A;  4N9U A;  2QIS A;  2E94 A;  2OPM A;  4LIX A;  2PS6 A;  4QXS F;  3SAE A;  1VG4 A;  2FTZ A;  3ASX A;  5HN7 A;  3ICK A;  3KRA B;  4KQ5 A;  3RYE A;  1JFA A;  3KRA A;  5B02 A;  3LGZ B;  3Q1O A;  3LVS A;  3AE0 A;  3P5R A;  3P41 A;  4LZC A;  4XQT F;  3ZL6 A;  3WEF A;  5I1U A;  3BNY A;  4NFI F;  3SDR A;  2OA6 A;  4H5C F;  3KRO B;  4JZX A;  1WKZ A;  3KRO A;  3V66 A;  2ZCQ A;  5B0K A;  3EZ3 A;  3VJA A;  3VJ8 A;  3WCI A;  1YYT A;  4LTZ A;  1N21 A;  4KQU A;  3VJD A;  1DGP A;  4KVD A;  3V1X A;  4OKM A;  2F8C F;  4KVI A;  1N20 A;  4NUA A;  4EA1 A;  3Q2Q A;  4LA6 A;  1YYQ A;  5DZ2 A;  5DHI A;  3WJK A;  4PVY F;  5ERN A;  4LTV A;  5IN8 A;  2ZEV A;  5ERO A;  2J1O A;  3SDT A;  1WL1 A;  2ZCR A;  2Z7I A;  1HX9 A;  4KUX A;  5KSX F;  5HNA A;  2PS4 A;  3CP6 A;  2EWG A;  3KRC B;  5CG6 A;  3KRC A;  3PDE A;  3WCA A;  2AEK A;  4H5D F;  3NF2 A;  4XQR F;  3PYA A;  2E4O A;  3KBK A;  1UBW A;  3N0F A;  4MC3 A;  2ONG A;  1V4I A;  5B0L A;  5HN9 A;  2Z4X A;  2Z4Y A;  2F94 F;  1N1B A;  1WL2 A;  3WCC A;  3VJE A;  3IPI A;  4QPF A;  3B7L A;  1RQJ A;  4LA5 A;  4RXC A;  4WK5 A;  2ZY1 A;  5IMN A;  3KB9 A;  5B00 A;  4F6V A;  3LZ9 A;  4EA0 A;  3VJ9 A;  1VG3 A;  3ACW A;  3WJO A;  1VG6 A;  1YYU A;  5B0M A;  5DGS F;  4F62 A;  4HD1 A;  4GP1 A;  4KVY A;  5HN8 A;  4JZB A;  3KRP A;  4LFV F;  5IL3 A;  5DJP F;  4DZW A;  3LSN A;  5E8L A;  3ICM A;  4H5E F;  3SDV A;  4FP4 A;  4JXN A;  5IKH A;  3LJI A;  5AHU B;  1UBY A;  1YYR A;  5DJR F;  5JV1 F;  3SDQ A;  2AEL A;  2E8T A;  3N49 F;  4P0V A;  1V4E A;  5ER8 A;  2F7M F;  5DGN F;  3LMD A;  3ACY A;  1ZW5 A;  5B0I A;  3WCD A;  3WSB A;  3WC9 A;  1PS1 A;  4DWB A;  5EAU A;  5JUZ F;  3P5P A;  3WSA A;  3ICN A;  4FJQ A;  5A0J A;  4DEM F;  1WL3 A;  4RNQ A;  1YHK A;  5B01 A;  3ADZ A;  3VJC A;  3N45 F;  5IK9 A;  3N46 F;  4F6X A;  2F8Z F;  3AQC B;  5IKA A;  1JFG A;  3PYB A;  4GP2 A;  3WCJ A;  1YV5 A;  5ILZ A;  3M02 A;  1WY0 A;  3N5J F;  3AQ0 A;  2PS5 A;  5JV0 F;  4RXA A;  4DI5 A;  2PS8 A;  5EAT A;  3NPR A;  3OAB B;  3SDU A;  3N3D A;  3OAB A;  5E8H A;  2Z78 A;  2E92 A;  3WCF A;  3DYF A;  2ONH A;  4NG6 A;  2F89 F;  2E8U A;  5AYP A;  3LDW A;  5AFX A;  3RYW A;  1V4K A;  3PH7 A;  3WE9 A;  2Z7H A;  4MC8 A;  3TS7 A;  4E9U A;  4LLS A;  1YYS A;  3P8L A;  4KPD A;  2AZL A;  4LPH F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...