2ZCQA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus complexed with bisphosphonate bph-652
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dehydrosqualene synthase
publication title A cholesterol biosynthesis inhibitor blocks Staphylococcus aureus virulence.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 114
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2007-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2zcqA00
3KROB 1HX9A 2ZEUA 1YHKA 1UBYA 2Q9YA 3N0FA 2EWGA 2VF6A 2Z4XA 1V4IA 2E8VA 3WC9A 3N5JF 4MC3A 2OGDA 5JV1F 1WL2A 3CC9A 3WJNA 2AZLA 3DYHA 1RQJA 3TS7A 1YYSA 3WCFA 3Q2QA 1YQ7A 3MZVA 3N49F 5EATA 2PS5A 3WSAA 5B0IA 1N21A 3ZCDA 2PS8A 4JXYA 2E93A 4PVYF 4RYPA 5HNAA 4LPHF 1N20A 1YHLA 4OMGA 4JYXA 5DGMF 3LGKA 5B0KA 3SDTA 2F94F 2Z78A 5HN7A 4DEMF 4GAXA 2E90A 4F62A 3APZA 5EROA 4FP4A 4NG6A 3KRCB 1WKZA 4MC0A 1VG7A 3UCAA 1YJ4A 3KBKA 3WCHA 3ICZA 5IMIA 2Q9ZA 3WJKA 4P0XA 3TC1A 4LXWA 2Z52A 2AETA 1VG4A 1UBXA 4DZWA 1YV5A 5IMNA 3TFPA 3VJDA 3N3DA 3TFNA 3PKOA 3LLWA 3M00A 3OYRA 1WL0A 5AFXA 3AQBB 2PS6A 3EGTA 5JA0F 3WEJA 4NFKF 2AELA 2Z4VA 5EASA 5EAUA 3LDWA 3TFVA 1HM7A 3N1WF 2I19A 1WL1A 4H5DF 4OKZA 5IL8A 3NPRA 3M9UA 4LLSA 3AQ0A 4OGUA 4NKFA 4F6XA 1RQIA 4XQRF 5DHIA 3P5RA 3KRPB 2J5CA 4JXNA 5IKAA 4EA0A 5HN9A 1KIYA 4LPGF 1N22A 4N1ZF 3LOMA 5E8LA 3KROA 1YYUA 3WCCA 5IN8A 3SDUA 4JZBA 3SDRA 3B7LA 5DIQF 1N24A 1DGPA 4RXDA 2ONGA 3VJEA 4RNQA 5B01A 5A0KA 3WCIA 5ERMA 2F8ZF 1WL3A 1HXAA 2Q80A 3WCEA 3AE0A 1PS1A 4KVIA 1JFGA 2OPNA 5JV0F 3ZMBA 5H9DA 3VJAA 3N0GA 4KUXA 3KB9A 4DXJA 3Q2ZA 3SAEA 5A0JA 1V4JA 5IK9A 1ZW5A 1FPSA 4RXEA 1HXCA 5DJPF 1V4EA 5AHUB 5IVGA 4KPDA 3WCJA 3DYGA 5JUZF 1N23A 1UBWA 3RBMA 4FJQA 3Q1OA 5DGSF 4F6VA 2Z7IA 3KRCA 5ILIA 1JFAA 2PS4A 1UBVA 3LMDA 3BNYA 5B0LA 3CKEA 3M0GA 3M02A 3ICNA 3IBAA 4LFGA 3LZ9A 3RYWA 3RYEA 3SDVA 3WEKA 3IPIA 3LEEA 4KPJA 5DZ2A 5ILKA 3S4JA 2E8UA 5I1UA 3N45F 2RAHA 5ILJA 4LIXA 2DH4A 2Z4YA 4DWGA 2E8TA 3EZ3A 2F7MF 2E92A 4QPFA 3VJCA 5B0JA 4UMJA 3RMGA 2Z50A 5ILHA 2O1OA 4P0VA 3WCLA 2J1OA 3QQVA 5B03A 5IK6A 3OABB 4L2XF 5JV2F 4EA2A 3ZOUA 3V1VA 1YHMA 4NFJF 4JZXA 3PYBA 4JVJF 5DJVF 3G4DA 3ACWA 1YYQA 3P8LA 5CG5A 1VG2A 4OMHA 3LGZB 5B02A 3WE9A 3KRPA 4DWBA 3ZL6A 3P5PA 5HN8A 4XQTF 2H8OA 5AYPA 3KRFB 4KKMA 2E94A 2Z7HA 2J1PA 3LJIA 3LK5A 3PDEA 3OACB 4KVYA 3MAVA 2QISA 3P8RA 4DI5A 4OKMA 4WK5A 3V1XA 3AQCB 3WCDA 3NPKA 3BNXA 4KVDA 3WCBA 3WSBA 5IL3A 3N5HF 3NRIA 1V4KA 3EFQA 4E9UA 4EA1A 2ZCQA 2FTZA 5ILYA 3VJBA 2E8WA 3S9VA 1WMWA 4H5EF 1N1BA 1N1ZA 3PYAA 3ADZA 3N6KF 3ASXA 2Z4ZA 4LUUA 5IM1A 2AZJA 2OPMA 4NKEA 1EZFA 4RXCA 4KVWA 5IKHA 3Q30A 5B0MA 3ICMA 2Z4WA 2OA6A 4LFVF 2P1CA 5DJRF 4LZ3A 1YYTA 5IK0A 4RXAA 2E91A 3ID0A 4KFAA 5E8KA 3SDQA 1RTRA 2E95A 4KQUA 5C05A 3N46F 3DYFA 5B00A 5AELA 3WCMA 1VG3A 4KQSA 2ZY1A 1HXGA 2AZKA 2F92F 4HD1A 3WEGA 4GA3A 3ICKA 3WCAA 4E9ZA 4NFIF 5CG6A 2E8XA 4PVXF 4XQSF 5ER8A 4MC8A 4E1EA 3OABA 2ZEVA 4LZ0A 3WJOA 3VJ9A 5ERNA 4LA6A 4LOBA 3NF2A 4ZQ8A 1HM4A 3WEFA 3WCGA 3WEIA 2FORA 2Q58A 5IMPA 3ZMCA 4KK2A 1KIZA 1DI1A 2ONHA 4LZCA 2ZCRA 2ZCOA 4K10A 3ACXA 5KSXF 5E8HA 3LVSA 2PS7A 4NUAA 4LA5A 1V4HA 1WY0A 3V66A 3ACYA 3KRFA 4H5CF 5DHKA 4P0WA 3VJ8A 5ILZA 1YYRA 3LG5A 2ZCSA 4LTVA 3N1VF 2F9KF 3KRAA 2E4OA 3G4FA 4LTZA 3QKCA 5A0IA 3OACA 5DW7A 3KRAB 3LSNA 4KQ5A 4GP1A 5ILDA 4LLTA 1VG6A 2AEKA 2F8CF 3P41A 2F89F 4QXSF 5DGNF 4KWDA 3WEHA 4Q23A 4DHDA 3W7FA 3CP6A 4LFEA 4N9UA 3PH7A 4GP2A 3N3LF 3M01A
chains in the Genus database with same CATH superfamily
3KROB 1HX9A 2ZEUA 1YHKA 1UBYA 2Q9YA 3N0FA 2EWGA 2VF6A 2Z4XA 1V4IA 2E8VA 3WC9A 3N5JF 4MC3A 2OGDA 5JV1F 1WL2A 3CC9A 3WJNA 2AZLA 3DYHA 1RQJA 3TS7A 1YYSA 3WCFA 3Q2QA 1YQ7A 3MZVA 3N49F 5EATA 2PS5A 3WSAA 5B0IA 1N21A 3ZCDA 2PS8A 4JXYA 2E93A 4PVYF 4RYPA 5HNAA 4LPHF 1N20A 1YHLA 4OMGA 4JYXA 5DGMF 3LGKA 5B0KA 3SDTA 2F94F 2Z78A 5HN7A 4DEMF 4GAXA 2E90A 4F62A 3APZA 5EROA 4FP4A 4NG6A 3KRCB 1WKZA 4MC0A 1VG7A 3UCAA 1YJ4A 3KBKA 3WCHA 3ICZA 5IMIA 2Q9ZA 3WJKA 4P0XA 3TC1A 4LXWA 2Z52A 2AETA 1VG4A 1UBXA 4DZWA 1YV5A 5IMNA 3TFPA 3VJDA 3N3DA 3TFNA 3PKOA 3LLWA 3M00A 3OYRA 1WL0A 5AFXA 3AQBB 2PS6A 3EGTA 5JA0F 3WEJA 4NFKF 2AELA 2Z4VA 5EASA 5EAUA 3LDWA 3TFVA 1HM7A 3N1WF 2I19A 1WL1A 4H5DF 4OKZA 5IL8A 3NPRA 3M9UA 4LLSA 3AQ0A 4OGUA 4NKFA 4F6XA 1RQIA 4XQRF 5DHIA 3P5RA 3KRPB 2J5CA 4JXNA 5IKAA 4EA0A 5HN9A 1KIYA 4LPGF 1N22A 4N1ZF 3LOMA 5E8LA 3KROA 1YYUA 3WCCA 5IN8A 3SDUA 4JZBA 3SDRA 3B7LA 5DIQF 1N24A 1DGPA 4RXDA 2ONGA 3VJEA 4RNQA 5B01A 5A0KA 3WCIA 5ERMA 2F8ZF 1WL3A 1HXAA 2Q80A 3WCEA 3AE0A 1PS1A 4KVIA 1JFGA 2OPNA 5JV0F 3ZMBA 5H9DA 3VJAA 3N0GA 4KUXA 3KB9A 4DXJA 3Q2ZA 3SAEA 5A0JA 1V4JA 5IK9A 1ZW5A 1FPSA 4RXEA 1HXCA 5DJPF 1V4EA 5AHUB 5IVGA 4KPDA 3WCJA 3DYGA 5JUZF 1N23A 1UBWA 3RBMA 4FJQA 3Q1OA 5DGSF 4F6VA 2Z7IA 3KRCA 5ILIA 1JFAA 2PS4A 1UBVA 3LMDA 3BNYA 5B0LA 3CKEA 3M0GA 3M02A 3ICNA 3IBAA 4LFGA 3LZ9A 3RYWA 3RYEA 3SDVA 3WEKA 3IPIA 3LEEA 4KPJA 5DZ2A 5ILKA 3S4JA 2E8UA 5I1UA 3N45F 2RAHA 5ILJA 4LIXA 2DH4A 2Z4YA 4DWGA 2E8TA 3EZ3A 2F7MF 2E92A 4QPFA 3VJCA 5B0JA 4UMJA 3RMGA 2Z50A 5ILHA 2O1OA 4P0VA 3WCLA 2J1OA 3QQVA 5B03A 5IK6A 3OABB 4L2XF 5JV2F 4EA2A 3ZOUA 3V1VA 1YHMA 4NFJF 4JZXA 3PYBA 4JVJF 5DJVF 3G4DA 3ACWA 1YYQA 3P8LA 5CG5A 1VG2A 4OMHA 3LGZB 5B02A 3WE9A 3KRPA 4DWBA 3ZL6A 3P5PA 5HN8A 4XQTF 2H8OA 5AYPA 3KRFB 4KKMA 2E94A 2Z7HA 2J1PA 3LJIA 3LK5A 3PDEA 3OACB 4KVYA 3MAVA 2QISA 3P8RA 4DI5A 4OKMA 4WK5A 3V1XA 3AQCB 3WCDA 3NPKA 3BNXA 4KVDA 3WCBA 3WSBA 5IL3A 3N5HF 3NRIA 1V4KA 3EFQA 4E9UA 4EA1A 2ZCQA 2FTZA 5ILYA 3VJBA 2E8WA 3S9VA 1WMWA 4H5EF 1N1BA 1N1ZA 3PYAA 3ADZA 3N6KF 3ASXA 2Z4ZA 4LUUA 5IM1A 2AZJA 2OPMA 4NKEA 1EZFA 4RXCA 4KVWA 5IKHA 3Q30A 5B0MA 3ICMA 2Z4WA 2OA6A 4LFVF 2P1CA 5DJRF 4LZ3A 1YYTA 5IK0A 4RXAA 2E91A 3ID0A 4KFAA 5E8KA 3SDQA 1RTRA 2E95A 4KQUA 5C05A 3N46F 3DYFA 5B00A 5AELA 3WCMA 1VG3A 4KQSA 2ZY1A 1HXGA 2AZKA 2F92F 4HD1A 3WEGA 4GA3A 3ICKA 3WCAA 4E9ZA 4NFIF 5CG6A 2E8XA 4PVXF 4XQSF 5ER8A 4MC8A 4E1EA 3OABA 2ZEVA 4LZ0A 3WJOA 3VJ9A 5ERNA 4LA6A 4LOBA 3NF2A 4ZQ8A 1HM4A 3WEFA 3WCGA 3WEIA 2FORA 2Q58A 5IMPA 3ZMCA 4KK2A 1KIZA 1DI1A 2ONHA 4LZCA 2ZCRA 2ZCOA 4K10A 3ACXA 5KSXF 5E8HA 3LVSA 2PS7A 4NUAA 4LA5A 1V4HA 1WY0A 3V66A 3ACYA 3KRFA 4H5CF 5DHKA 4P0WA 3VJ8A 5ILZA 1YYRA 3LG5A 2ZCSA 4LTVA 3N1VF 2F9KF 3KRAA 2E4OA 3G4FA 4LTZA 3QKCA 5A0IA 3OACA 5DW7A 3KRAB 3LSNA 4KQ5A 4GP1A 5ILDA 4LLTA 1VG6A 2AEKA 2F8CF 3P41A 2F89F 4QXSF 5DGNF 4KWDA 3WEHA 4Q23A 4DHDA 3W7FA 3CP6A 4LFEA 4N9UA 3PH7A 4GP2A 3N3LF 3M01A
chains in the Genus database with same CATH topology
3KROB 1HX9A 2ZEUA 1YHKA 1UBYA 2Q9YA 3N0FA 2EWGA 2VF6A 2Z4XA 1V4IA 2E8VA 3WC9A 3N5JF 4MC3A 2OGDA 5JV1F 1WL2A 3CC9A 3WJNA 2AZLA 3DYHA 1RQJA 3TS7A 1YYSA 3WCFA 3Q2QA 1YQ7A 3MZVA 3N49F 5EATA 2PS5A 3WSAA 5B0IA 1N21A 3ZCDA 2PS8A 4JXYA 2E93A 4PVYF 4RYPA 5HNAA 4LPHF 1N20A 1YHLA 4OMGA 4JYXA 5DGMF 3LGKA 5B0KA 3SDTA 2F94F 2Z78A 5HN7A 4DEMF 4GAXA 2E90A 4F62A 3APZA 5EROA 4FP4A 4NG6A 3KRCB 1WKZA 4MC0A 1VG7A 3UCAA 1YJ4A 3KBKA 3WCHA 3ICZA 5IMIA 2Q9ZA 3WJKA 4P0XA 3TC1A 4LXWA 2Z52A 2AETA 1VG4A 1UBXA 4DZWA 1YV5A 5IMNA 3TFPA 3VJDA 3N3DA 3TFNA 3PKOA 3LLWA 3M00A 3OYRA 1WL0A 5AFXA 3AQBB 2PS6A 3EGTA 5JA0F 3WEJA 4NFKF 2AELA 2Z4VA 5EASA 5EAUA 3LDWA 3TFVA 1HM7A 3N1WF 2I19A 1WL1A 4H5DF 4OKZA 5IL8A 3NPRA 3M9UA 4LLSA 3AQ0A 4OGUA 4NKFA 4F6XA 1RQIA 4XQRF 5DHIA 3P5RA 3KRPB 2J5CA 4JXNA 5IKAA 4EA0A 5HN9A 1KIYA 4LPGF 1N22A 4N1ZF 3LOMA 5E8LA 3KROA 1YYUA 3WCCA 5IN8A 3SDUA 4JZBA 3SDRA 3B7LA 5DIQF 1N24A 1DGPA 4RXDA 2ONGA 3VJEA 4RNQA 5B01A 5A0KA 3WCIA 5ERMA 2F8ZF 1WL3A 1HXAA 2Q80A 3WCEA 3AE0A 1PS1A 4KVIA 1JFGA 2OPNA 5JV0F 3ZMBA 5H9DA 3VJAA 3N0GA 4KUXA 3KB9A 4DXJA 3Q2ZA 3SAEA 5A0JA 1V4JA 5IK9A 1ZW5A 1FPSA 4RXEA 1HXCA 5DJPF 1V4EA 5AHUB 5IVGA 4KPDA 3WCJA 3DYGA 5JUZF 1N23A 1UBWA 3RBMA 4FJQA 3Q1OA 5DGSF 4F6VA 2Z7IA 3KRCA 5ILIA 1JFAA 2PS4A 1UBVA 3LMDA 3BNYA 5B0LA 3CKEA 3M0GA 3M02A 3ICNA 3IBAA 4LFGA 3LZ9A 3RYWA 3RYEA 3SDVA 3WEKA 3IPIA 3LEEA 4KPJA 5DZ2A 5ILKA 3S4JA 2E8UA 5I1UA 3N45F 2RAHA 5ILJA 4LIXA 2DH4A 2Z4YA 4DWGA 2E8TA 3EZ3A 2F7MF 2E92A 4QPFA 3VJCA 5B0JA 4UMJA 3RMGA 2Z50A 5ILHA 2O1OA 4P0VA 3WCLA 2J1OA 3QQVA 5B03A 5IK6A 3OABB 4L2XF 5JV2F 4EA2A 3ZOUA 3V1VA 1YHMA 4NFJF 4JZXA 3PYBA 4JVJF 5DJVF 3G4DA 3ACWA 1YYQA 3P8LA 5CG5A 1VG2A 4OMHA 3LGZB 5B02A 3WE9A 3KRPA 4DWBA 3ZL6A 3P5PA 5HN8A 4XQTF 2H8OA 5AYPA 3KRFB 4KKMA 2E94A 2Z7HA 2J1PA 3LJIA 3LK5A 3PDEA 3OACB 4KVYA 3MAVA 2QISA 3P8RA 4DI5A 4OKMA 4WK5A 3V1XA 3AQCB 3WCDA 3NPKA 3BNXA 4KVDA 3WCBA 3WSBA 5IL3A 3N5HF 3NRIA 1V4KA 3EFQA 4E9UA 4EA1A 2ZCQA 2FTZA 5ILYA 3VJBA 2E8WA 3S9VA 1WMWA 4H5EF 1N1BA 1N1ZA 3PYAA 3ADZA 3N6KF 3ASXA 2Z4ZA 4LUUA 5IM1A 2AZJA 2OPMA 4NKEA 1EZFA 4RXCA 4KVWA 5IKHA 3Q30A 5B0MA 3ICMA 2Z4WA 2OA6A 4LFVF 2P1CA 5DJRF 4LZ3A 1YYTA 5IK0A 4RXAA 2E91A 3ID0A 4KFAA 5E8KA 3SDQA 1RTRA 2E95A 4KQUA 5C05A 3N46F 3DYFA 5B00A 5AELA 3WCMA 1VG3A 4KQSA 2ZY1A 1HXGA 2AZKA 2F92F 4HD1A 3WEGA 4GA3A 3ICKA 3WCAA 4E9ZA 4NFIF 5CG6A 2E8XA 4PVXF 4XQSF 5ER8A 4MC8A 4E1EA 3OABA 2ZEVA 4LZ0A 3WJOA 3VJ9A 5ERNA 4LA6A 4LOBA 3NF2A 4ZQ8A 1HM4A 3WEFA 3WCGA 3WEIA 2FORA 2Q58A 5IMPA 3ZMCA 4KK2A 1KIZA 1DI1A 2ONHA 4LZCA 2ZCRA 2ZCOA 4K10A 3ACXA 5KSXF 5E8HA 3LVSA 2PS7A 4NUAA 4LA5A 1V4HA 1WY0A 3V66A 3ACYA 3KRFA 4H5CF 5DHKA 4P0WA 3VJ8A 5ILZA 1YYRA 3LG5A 2ZCSA 4LTVA 3N1VF 2F9KF 3KRAA 2E4OA 3G4FA 4LTZA 3QKCA 5A0IA 3OACA 5DW7A 3KRAB 3LSNA 4KQ5A 4GP1A 5ILDA 4LLTA 1VG6A 2AEKA 2F8CF 3P41A 2F89F 4QXSF 5DGNF 4KWDA 3WEHA 4Q23A 4DHDA 3W7FA 3CP6A 4LFEA 4N9UA 3PH7A 4GP2A 3N3LF 3M01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KRO B;  1HX9 A;  2ZEU A;  1YHK A;  1UBY A;  2Q9Y A;  3N0F A;  2EWG A;  2VF6 A;  2Z4X A;  1V4I A;  2E8V A;  3WC9 A;  3N5J F;  4MC3 A;  2OGD A;  5JV1 F;  1WL2 A;  3CC9 A;  3WJN A;  2AZL A;  3DYH A;  1RQJ A;  3TS7 A;  1YYS A;  3WCF A;  3Q2Q A;  1YQ7 A;  3MZV A;  3N49 F;  5EAT A;  2PS5 A;  3WSA A;  5B0I A;  1N21 A;  3ZCD A;  2PS8 A;  4JXY A;  2E93 A;  4PVY F;  4RYP A;  5HNA A;  4LPH F;  1N20 A;  1YHL A;  4OMG A;  4JYX A;  5DGM F;  3LGK A;  5B0K A;  3SDT A;  2F94 F;  2Z78 A;  5HN7 A;  4DEM F;  4GAX A;  2E90 A;  4F62 A;  3APZ A;  5ERO A;  4FP4 A;  4NG6 A;  3KRC B;  1WKZ A;  4MC0 A;  1VG7 A;  3UCA A;  1YJ4 A;  3KBK A;  3WCH A;  3ICZ A;  5IMI A;  2Q9Z A;  3WJK A;  4P0X A;  3TC1 A;  4LXW A;  2Z52 A;  2AET A;  1VG4 A;  1UBX A;  4DZW A;  1YV5 A;  5IMN A;  3TFP A;  3VJD A;  3N3D A;  3TFN A;  3PKO A;  3LLW A;  3M00 A;  3OYR A;  1WL0 A;  5AFX A;  3AQB B;  2PS6 A;  3EGT A;  5JA0 F;  3WEJ A;  4NFK F;  2AEL A;  2Z4V A;  5EAS A;  5EAU A;  3LDW A;  3TFV A;  1HM7 A;  3N1W F;  2I19 A;  1WL1 A;  4H5D F;  4OKZ A;  5IL8 A;  3NPR A;  3M9U A;  4LLS A;  3AQ0 A;  4OGU A;  4NKF A;  4F6X A;  1RQI A;  4XQR F;  5DHI A;  3P5R A;  3KRP B;  2J5C A;  4JXN A;  5IKA A;  4EA0 A;  5HN9 A;  1KIY A;  4LPG F;  1N22 A;  4N1Z F;  3LOM A;  5E8L A;  3KRO A;  1YYU A;  3WCC A;  5IN8 A;  3SDU A;  4JZB A;  3SDR A;  3B7L A;  5DIQ F;  1N24 A;  1DGP A;  4RXD A;  2ONG A;  3VJE A;  4RNQ A;  5B01 A;  5A0K A;  3WCI A;  5ERM A;  2F8Z F;  1WL3 A;  1HXA A;  2Q80 A;  3WCE A;  3AE0 A;  1PS1 A;  4KVI A;  1JFG A;  2OPN A;  5JV0 F;  3ZMB A;  5H9D A;  3VJA A;  3N0G A;  4KUX A;  3KB9 A;  4DXJ A;  3Q2Z A;  3SAE A;  5A0J A;  1V4J A;  5IK9 A;  1ZW5 A;  1FPS A;  4RXE A;  1HXC A;  5DJP F;  1V4E A;  5AHU B;  5IVG A;  4KPD A;  3WCJ A;  3DYG A;  5JUZ F;  1N23 A;  1UBW A;  3RBM A;  4FJQ A;  3Q1O A;  5DGS F;  4F6V A;  2Z7I A;  3KRC A;  5ILI A;  1JFA A;  2PS4 A;  1UBV A;  3LMD A;  3BNY A;  5B0L A;  3CKE A;  3M0G A;  3M02 A;  3ICN A;  3IBA A;  4LFG A;  3LZ9 A;  3RYW A;  3RYE A;  3SDV A;  3WEK A;  3IPI A;  3LEE A;  4KPJ A;  5DZ2 A;  5ILK A;  3S4J A;  2E8U A;  5I1U A;  3N45 F;  2RAH A;  5ILJ A;  4LIX A;  2DH4 A;  2Z4Y A;  4DWG A;  2E8T A;  3EZ3 A;  2F7M F;  2E92 A;  4QPF A;  3VJC A;  5B0J A;  4UMJ A;  3RMG A;  2Z50 A;  5ILH A;  2O1O A;  4P0V A;  3WCL A;  2J1O A;  3QQV A;  5B03 A;  5IK6 A;  3OAB B;  4L2X F;  5JV2 F;  4EA2 A;  3ZOU A;  3V1V A;  1YHM A;  4NFJ F;  4JZX A;  3PYB A;  4JVJ F;  5DJV F;  3G4D A;  3ACW A;  1YYQ A;  3P8L A;  5CG5 A;  1VG2 A;  4OMH A;  3LGZ B;  5B02 A;  3WE9 A;  3KRP A;  4DWB A;  3ZL6 A;  3P5P A;  5HN8 A;  4XQT F;  2H8O A;  5AYP A;  3KRF B;  4KKM A;  2E94 A;  2Z7H A;  2J1P A;  3LJI A;  3LK5 A;  3PDE A;  3OAC B;  4KVY A;  3MAV A;  2QIS A;  3P8R A;  4DI5 A;  4OKM A;  4WK5 A;  3V1X A;  3AQC B;  3WCD A;  3NPK A;  3BNX A;  4KVD A;  3WCB A;  3WSB A;  5IL3 A;  3N5H F;  3NRI A;  1V4K A;  3EFQ A;  4E9U A;  4EA1 A;  2ZCQ A;  2FTZ A;  5ILY A;  3VJB A;  2E8W A;  3S9V A;  1WMW A;  4H5E F;  1N1B A;  1N1Z A;  3PYA A;  3ADZ A;  3N6K F;  3ASX A;  2Z4Z A;  4LUU A;  5IM1 A;  2AZJ A;  2OPM A;  4NKE A;  1EZF A;  4RXC A;  4KVW A;  5IKH A;  3Q30 A;  5B0M A;  3ICM A;  2Z4W A;  2OA6 A;  4LFV F;  2P1C A;  5DJR F;  4LZ3 A;  1YYT A;  5IK0 A;  4RXA A;  2E91 A;  3ID0 A;  4KFA A;  5E8K A;  3SDQ A;  1RTR A;  2E95 A;  4KQU A;  5C05 A;  3N46 F;  3DYF A;  5B00 A;  5AEL A;  3WCM A;  1VG3 A;  4KQS A;  2ZY1 A;  1HXG A;  2AZK A;  2F92 F;  4HD1 A;  3WEG A;  4GA3 A;  3ICK A;  3WCA A;  4E9Z A;  4NFI F;  5CG6 A;  2E8X A;  4PVX F;  4XQS F;  5ER8 A;  4MC8 A;  4E1E A;  3OAB A;  2ZEV A;  4LZ0 A;  3WJO A;  3VJ9 A;  5ERN A;  4LA6 A;  4LOB A;  3NF2 A;  4ZQ8 A;  1HM4 A;  3WEF A;  3WCG A;  3WEI A;  2FOR A;  2Q58 A;  5IMP A;  3ZMC A;  4KK2 A;  1KIZ A;  1DI1 A;  2ONH A;  4LZC A;  2ZCR A;  2ZCO A;  4K10 A;  3ACX A;  5KSX F;  5E8H A;  3LVS A;  2PS7 A;  4NUA A;  4LA5 A;  1V4H A;  1WY0 A;  3V66 A;  3ACY A;  3KRF A;  4H5C F;  5DHK A;  4P0W A;  3VJ8 A;  5ILZ A;  1YYR A;  3LG5 A;  2ZCS A;  4LTV A;  3N1V F;  2F9K F;  3KRA A;  2E4O A;  3G4F A;  4LTZ A;  3QKC A;  5A0I A;  3OAC A;  5DW7 A;  3KRA B;  3LSN A;  4KQ5 A;  4GP1 A;  5ILD A;  4LLT A;  1VG6 A;  2AEK A;  2F8C F;  3P41 A;  2F89 F;  4QXS F;  5DGN F;  4KWD A;  3WEH A;  4Q23 A;  4DHD A;  3W7F A;  3CP6 A;  4LFE A;  4N9U A;  3PH7 A;  4GP2 A;  3N3L F;  3M01 A; 
#chains in the Genus database with same CATH topology
 3KRO B;  1HX9 A;  2ZEU A;  1YHK A;  1UBY A;  2Q9Y A;  3N0F A;  2EWG A;  2VF6 A;  2Z4X A;  1V4I A;  2E8V A;  3WC9 A;  3N5J F;  4MC3 A;  2OGD A;  5JV1 F;  1WL2 A;  3CC9 A;  3WJN A;  2AZL A;  3DYH A;  1RQJ A;  3TS7 A;  1YYS A;  3WCF A;  3Q2Q A;  1YQ7 A;  3MZV A;  3N49 F;  5EAT A;  2PS5 A;  3WSA A;  5B0I A;  1N21 A;  3ZCD A;  2PS8 A;  4JXY A;  2E93 A;  4PVY F;  4RYP A;  5HNA A;  4LPH F;  1N20 A;  1YHL A;  4OMG A;  4JYX A;  5DGM F;  3LGK A;  5B0K A;  3SDT A;  2F94 F;  2Z78 A;  5HN7 A;  4DEM F;  4GAX A;  2E90 A;  4F62 A;  3APZ A;  5ERO A;  4FP4 A;  4NG6 A;  3KRC B;  1WKZ A;  4MC0 A;  1VG7 A;  3UCA A;  1YJ4 A;  3KBK A;  3WCH A;  3ICZ A;  5IMI A;  2Q9Z A;  3WJK A;  4P0X A;  3TC1 A;  4LXW A;  2Z52 A;  2AET A;  1VG4 A;  1UBX A;  4DZW A;  1YV5 A;  5IMN A;  3TFP A;  3VJD A;  3N3D A;  3TFN A;  3PKO A;  3LLW A;  3M00 A;  3OYR A;  1WL0 A;  5AFX A;  3AQB B;  2PS6 A;  3EGT A;  5JA0 F;  3WEJ A;  4NFK F;  2AEL A;  2Z4V A;  5EAS A;  5EAU A;  3LDW A;  3TFV A;  1HM7 A;  3N1W F;  2I19 A;  1WL1 A;  4H5D F;  4OKZ A;  5IL8 A;  3NPR A;  3M9U A;  4LLS A;  3AQ0 A;  4OGU A;  4NKF A;  4F6X A;  1RQI A;  4XQR F;  5DHI A;  3P5R A;  3KRP B;  2J5C A;  4JXN A;  5IKA A;  4EA0 A;  5HN9 A;  1KIY A;  4LPG F;  1N22 A;  4N1Z F;  3LOM A;  5E8L A;  3KRO A;  1YYU A;  3WCC A;  5IN8 A;  3SDU A;  4JZB A;  3SDR A;  3B7L A;  5DIQ F;  1N24 A;  1DGP A;  4RXD A;  2ONG A;  3VJE A;  4RNQ A;  5B01 A;  5A0K A;  3WCI A;  5ERM A;  2F8Z F;  1WL3 A;  1HXA A;  2Q80 A;  3WCE A;  3AE0 A;  1PS1 A;  4KVI A;  1JFG A;  2OPN A;  5JV0 F;  3ZMB A;  5H9D A;  3VJA A;  3N0G A;  4KUX A;  3KB9 A;  4DXJ A;  3Q2Z A;  3SAE A;  5A0J A;  1V4J A;  5IK9 A;  1ZW5 A;  1FPS A;  4RXE A;  1HXC A;  5DJP F;  1V4E A;  5AHU B;  5IVG A;  4KPD A;  3WCJ A;  3DYG A;  5JUZ F;  1N23 A;  1UBW A;  3RBM A;  4FJQ A;  3Q1O A;  5DGS F;  4F6V A;  2Z7I A;  3KRC A;  5ILI A;  1JFA A;  2PS4 A;  1UBV A;  3LMD A;  3BNY A;  5B0L A;  3CKE A;  3M0G A;  3M02 A;  3ICN A;  3IBA A;  4LFG A;  3LZ9 A;  3RYW A;  3RYE A;  3SDV A;  3WEK A;  3IPI A;  3LEE A;  4KPJ A;  5DZ2 A;  5ILK A;  3S4J A;  2E8U A;  5I1U A;  3N45 F;  2RAH A;  5ILJ A;  4LIX A;  2DH4 A;  2Z4Y A;  4DWG A;  2E8T A;  3EZ3 A;  2F7M F;  2E92 A;  4QPF A;  3VJC A;  5B0J A;  4UMJ A;  3RMG A;  2Z50 A;  5ILH A;  2O1O A;  4P0V A;  3WCL A;  2J1O A;  3QQV A;  5B03 A;  5IK6 A;  3OAB B;  4L2X F;  5JV2 F;  4EA2 A;  3ZOU A;  3V1V A;  1YHM A;  4NFJ F;  4JZX A;  3PYB A;  4JVJ F;  5DJV F;  3G4D A;  3ACW A;  1YYQ A;  3P8L A;  5CG5 A;  1VG2 A;  4OMH A;  3LGZ B;  5B02 A;  3WE9 A;  3KRP A;  4DWB A;  3ZL6 A;  3P5P A;  5HN8 A;  4XQT F;  2H8O A;  5AYP A;  3KRF B;  4KKM A;  2E94 A;  2Z7H A;  2J1P A;  3LJI A;  3LK5 A;  3PDE A;  3OAC B;  4KVY A;  3MAV A;  2QIS A;  3P8R A;  4DI5 A;  4OKM A;  4WK5 A;  3V1X A;  3AQC B;  3WCD A;  3NPK A;  3BNX A;  4KVD A;  3WCB A;  3WSB A;  5IL3 A;  3N5H F;  3NRI A;  1V4K A;  3EFQ A;  4E9U A;  4EA1 A;  2ZCQ A;  2FTZ A;  5ILY A;  3VJB A;  2E8W A;  3S9V A;  1WMW A;  4H5E F;  1N1B A;  1N1Z A;  3PYA A;  3ADZ A;  3N6K F;  3ASX A;  2Z4Z A;  4LUU A;  5IM1 A;  2AZJ A;  2OPM A;  4NKE A;  1EZF A;  4RXC A;  4KVW A;  5IKH A;  3Q30 A;  5B0M A;  3ICM A;  2Z4W A;  2OA6 A;  4LFV F;  2P1C A;  5DJR F;  4LZ3 A;  1YYT A;  5IK0 A;  4RXA A;  2E91 A;  3ID0 A;  4KFA A;  5E8K A;  3SDQ A;  1RTR A;  2E95 A;  4KQU A;  5C05 A;  3N46 F;  3DYF A;  5B00 A;  5AEL A;  3WCM A;  1VG3 A;  4KQS A;  2ZY1 A;  1HXG A;  2AZK A;  2F92 F;  4HD1 A;  3WEG A;  4GA3 A;  3ICK A;  3WCA A;  4E9Z A;  4NFI F;  5CG6 A;  2E8X A;  4PVX F;  4XQS F;  5ER8 A;  4MC8 A;  4E1E A;  3OAB A;  2ZEV A;  4LZ0 A;  3WJO A;  3VJ9 A;  5ERN A;  4LA6 A;  4LOB A;  3NF2 A;  4ZQ8 A;  1HM4 A;  3WEF A;  3WCG A;  3WEI A;  2FOR A;  2Q58 A;  5IMP A;  3ZMC A;  4KK2 A;  1KIZ A;  1DI1 A;  2ONH A;  4LZC A;  2ZCR A;  2ZCO A;  4K10 A;  3ACX A;  5KSX F;  5E8H A;  3LVS A;  2PS7 A;  4NUA A;  4LA5 A;  1V4H A;  1WY0 A;  3V66 A;  3ACY A;  3KRF A;  4H5C F;  5DHK A;  4P0W A;  3VJ8 A;  5ILZ A;  1YYR A;  3LG5 A;  2ZCS A;  4LTV A;  3N1V F;  2F9K F;  3KRA A;  2E4O A;  3G4F A;  4LTZ A;  3QKC A;  5A0I A;  3OAC A;  5DW7 A;  3KRA B;  3LSN A;  4KQ5 A;  4GP1 A;  5ILD A;  4LLT A;  1VG6 A;  2AEK A;  2F8C F;  3P41 A;  2F89 F;  4QXS F;  5DGN F;  4KWD A;  3WEH A;  4Q23 A;  4DHD A;  3W7F A;  3CP6 A;  4LFE A;  4N9U A;  3PH7 A;  4GP2 A;  3N3L F;  3M01 A; 
#chains in the Genus database with same CATH homology
 3KRO B;  1HX9 A;  2ZEU A;  1YHK A;  1UBY A;  2Q9Y A;  3N0F A;  2EWG A;  2VF6 A;  2Z4X A;  1V4I A;  2E8V A;  3WC9 A;  3N5J F;  4MC3 A;  2OGD A;  5JV1 F;  1WL2 A;  3CC9 A;  3WJN A;  2AZL A;  3DYH A;  1RQJ A;  3TS7 A;  1YYS A;  3WCF A;  3Q2Q A;  1YQ7 A;  3MZV A;  3N49 F;  5EAT A;  2PS5 A;  3WSA A;  5B0I A;  1N21 A;  3ZCD A;  2PS8 A;  4JXY A;  2E93 A;  4PVY F;  4RYP A;  5HNA A;  4LPH F;  1N20 A;  1YHL A;  4OMG A;  4JYX A;  5DGM F;  3LGK A;  5B0K A;  3SDT A;  2F94 F;  2Z78 A;  5HN7 A;  4DEM F;  4GAX A;  2E90 A;  4F62 A;  3APZ A;  5ERO A;  4FP4 A;  4NG6 A;  3KRC B;  1WKZ A;  4MC0 A;  1VG7 A;  3UCA A;  1YJ4 A;  3KBK A;  3WCH A;  3ICZ A;  5IMI A;  2Q9Z A;  3WJK A;  4P0X A;  3TC1 A;  4LXW A;  2Z52 A;  2AET A;  1VG4 A;  1UBX A;  4DZW A;  1YV5 A;  5IMN A;  3TFP A;  3VJD A;  3N3D A;  3TFN A;  3PKO A;  3LLW A;  3M00 A;  3OYR A;  1WL0 A;  5AFX A;  3AQB B;  2PS6 A;  3EGT A;  5JA0 F;  3WEJ A;  4NFK F;  2AEL A;  2Z4V A;  5EAS A;  5EAU A;  3LDW A;  3TFV A;  1HM7 A;  3N1W F;  2I19 A;  1WL1 A;  4H5D F;  4OKZ A;  5IL8 A;  3NPR A;  3M9U A;  4LLS A;  3AQ0 A;  4OGU A;  4NKF A;  4F6X A;  1RQI A;  4XQR F;  5DHI A;  3P5R A;  3KRP B;  2J5C A;  4JXN A;  5IKA A;  4EA0 A;  5HN9 A;  1KIY A;  4LPG F;  1N22 A;  4N1Z F;  3LOM A;  5E8L A;  3KRO A;  1YYU A;  3WCC A;  5IN8 A;  3SDU A;  4JZB A;  3SDR A;  3B7L A;  5DIQ F;  1N24 A;  1DGP A;  4RXD A;  2ONG A;  3VJE A;  4RNQ A;  5B01 A;  5A0K A;  3WCI A;  5ERM A;  2F8Z F;  1WL3 A;  1HXA A;  2Q80 A;  3WCE A;  3AE0 A;  1PS1 A;  4KVI A;  1JFG A;  2OPN A;  5JV0 F;  3ZMB A;  5H9D A;  3VJA A;  3N0G A;  4KUX A;  3KB9 A;  4DXJ A;  3Q2Z A;  3SAE A;  5A0J A;  1V4J A;  5IK9 A;  1ZW5 A;  1FPS A;  4RXE A;  1HXC A;  5DJP F;  1V4E A;  5AHU B;  5IVG A;  4KPD A;  3WCJ A;  3DYG A;  5JUZ F;  1N23 A;  1UBW A;  3RBM A;  4FJQ A;  3Q1O A;  5DGS F;  4F6V A;  2Z7I A;  3KRC A;  5ILI A;  1JFA A;  2PS4 A;  1UBV A;  3LMD A;  3BNY A;  5B0L A;  3CKE A;  3M0G A;  3M02 A;  3ICN A;  3IBA A;  4LFG A;  3LZ9 A;  3RYW A;  3RYE A;  3SDV A;  3WEK A;  3IPI A;  3LEE A;  4KPJ A;  5DZ2 A;  5ILK A;  3S4J A;  2E8U A;  5I1U A;  3N45 F;  2RAH A;  5ILJ A;  4LIX A;  2DH4 A;  2Z4Y A;  4DWG A;  2E8T A;  3EZ3 A;  2F7M F;  2E92 A;  4QPF A;  3VJC A;  5B0J A;  4UMJ A;  3RMG A;  2Z50 A;  5ILH A;  2O1O A;  4P0V A;  3WCL A;  2J1O A;  3QQV A;  5B03 A;  5IK6 A;  3OAB B;  4L2X F;  5JV2 F;  4EA2 A;  3ZOU A;  3V1V A;  1YHM A;  4NFJ F;  4JZX A;  3PYB A;  4JVJ F;  5DJV F;  3G4D A;  3ACW A;  1YYQ A;  3P8L A;  5CG5 A;  1VG2 A;  4OMH A;  3LGZ B;  5B02 A;  3WE9 A;  3KRP A;  4DWB A;  3ZL6 A;  3P5P A;  5HN8 A;  4XQT F;  2H8O A;  5AYP A;  3KRF B;  4KKM A;  2E94 A;  2Z7H A;  2J1P A;  3LJI A;  3LK5 A;  3PDE A;  3OAC B;  4KVY A;  3MAV A;  2QIS A;  3P8R A;  4DI5 A;  4OKM A;  4WK5 A;  3V1X A;  3AQC B;  3WCD A;  3NPK A;  3BNX A;  4KVD A;  3WCB A;  3WSB A;  5IL3 A;  3N5H F;  3NRI A;  1V4K A;  3EFQ A;  4E9U A;  4EA1 A;  2ZCQ A;  2FTZ A;  5ILY A;  3VJB A;  2E8W A;  3S9V A;  1WMW A;  4H5E F;  1N1B A;  1N1Z A;  3PYA A;  3ADZ A;  3N6K F;  3ASX A;  2Z4Z A;  4LUU A;  5IM1 A;  2AZJ A;  2OPM A;  4NKE A;  1EZF A;  4RXC A;  4KVW A;  5IKH A;  3Q30 A;  5B0M A;  3ICM A;  2Z4W A;  2OA6 A;  4LFV F;  2P1C A;  5DJR F;  4LZ3 A;  1YYT A;  5IK0 A;  4RXA A;  2E91 A;  3ID0 A;  4KFA A;  5E8K A;  3SDQ A;  1RTR A;  2E95 A;  4KQU A;  5C05 A;  3N46 F;  3DYF A;  5B00 A;  5AEL A;  3WCM A;  1VG3 A;  4KQS A;  2ZY1 A;  1HXG A;  2AZK A;  2F92 F;  4HD1 A;  3WEG A;  4GA3 A;  3ICK A;  3WCA A;  4E9Z A;  4NFI F;  5CG6 A;  2E8X A;  4PVX F;  4XQS F;  5ER8 A;  4MC8 A;  4E1E A;  3OAB A;  2ZEV A;  4LZ0 A;  3WJO A;  3VJ9 A;  5ERN A;  4LA6 A;  4LOB A;  3NF2 A;  4ZQ8 A;  1HM4 A;  3WEF A;  3WCG A;  3WEI A;  2FOR A;  2Q58 A;  5IMP A;  3ZMC A;  4KK2 A;  1KIZ A;  1DI1 A;  2ONH A;  4LZC A;  2ZCR A;  2ZCO A;  4K10 A;  3ACX A;  5KSX F;  5E8H A;  3LVS A;  2PS7 A;  4NUA A;  4LA5 A;  1V4H A;  1WY0 A;  3V66 A;  3ACY A;  3KRF A;  4H5C F;  5DHK A;  4P0W A;  3VJ8 A;  5ILZ A;  1YYR A;  3LG5 A;  2ZCS A;  4LTV A;  3N1V F;  2F9K F;  3KRA A;  2E4O A;  3G4F A;  4LTZ A;  3QKC A;  5A0I A;  3OAC A;  5DW7 A;  3KRA B;  3LSN A;  4KQ5 A;  4GP1 A;  5ILD A;  4LLT A;  1VG6 A;  2AEK A;  2F8C F;  3P41 A;  2F89 F;  4QXS F;  5DGN F;  4KWD A;  3WEH A;  4Q23 A;  4DHD A;  3W7F A;  3CP6 A;  4LFE A;  4N9U A;  3PH7 A;  4GP2 A;  3N3L F;  3M01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...