2FORA

Crystal structure of the shigella flexneri farnesyl pyrophosphate synthase complex with an isopentenyl pyrophosphate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
283
Chain Sequence
DFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTLAFSILSDANMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGGKSTYPALLGLEQARKKARDLIDDARQALKQLAEQSLDTSALEALADYIIQRNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranyltranstransferase
publication title Crystal Structure of the Shigella flexneri Farnesyl Pyrophosphate Synthase Complex with an Isopentenyl Pyrophosphate
rcsb
source organism Shigella flexneri
molecule tags Transferase
total genus 112
structure length 283
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2006-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2forA00
1V4KA 4LTZA 4PVXF 2AELA 5H9DA 3LMDA 3KBKA 4LLSA 1N1BA 5JV0F 4KQSA 1WL1A 1DGPA 3CC9A 5DJRF 4RXDA 5CG5A 2F94F 3APZA 4OGUA 3PYBA 3ID0A 3TS7A 4DXJA 3P8RA 1HXGA 4RXCA 2ONHA 3BNXA 3Q30A 5DHIA 2Z7HA 3CKEA 5EASA 2I19A 3WSAA 3VJ9A 3KRPA 3EFQA 1WL2A 3TFNA 3WSBA 3KRAB 4KFAA 3BNYA 3P5PA 1N23A 2OA6A 5B02A 5JA0F 1UBYA 2AZJA 4L2XF 4H5DF 4E1EA 3LDWA 3VJAA 5EATA 1WKZA 5HN8A 3VJEA 1V4HA 2OGDA 3V66A 5IKHA 5DJVF 4NG6A 5AELA 4KPJA 3NRIA 4KVDA 3N5JF 3W7FA 3MAVA 3ICKA 4LFGA 1YHKA 1YYTA 3WCLA 1JFAA 3MZVA 3QKCA 3SDQA 3P8LA 4LFVF 1YHLA 3WJKA 2ZCRA 1YV5A 4MC0A 1UBWA 3WCGA 4OMHA 3WEIA 1RQJA 5CG6A 4LZCA 3N3LF 4KQ5A 2RAHA 3RMGA 4WK5A 3WCMA 5IK0A 3S4JA 4F6VA 4KVYA 2J1PA 5I1UA 4DHDA 5ERMA 3LGZB 4GA3A 3IPIA 4XQRF 3S9VA 3N3DA 4N9UA 2H8OA 3WJOA 4LLTA 4LXWA 4DZWA 1N22A 2FORA 3VJDA 1YYSA 3LK5A 5IM1A 3ZCDA 5DW7A 5ERNA 2J1OA 3WCBA 2Q58A 4H5CF 2E92A 2OPNA 4LZ3A 3WEGA 3LLWA 4RXEA 1KIYA 4KVIA 3V1VA 5ILZA 4LA5A 4Q23A 4DWBA 4E9UA 5B00A 3UCAA 4LIXA 3WCFA 3M02A 3WEJA 4RYPA 3TFPA 2F89F 3N45F 3Q2QA 2Q80A 5ILIA 2Z4VA 3WEHA 4MC8A 1YYQA 5E8LA 3TFVA 3ADZA 5ILDA 1HM7A 4NKFA 4JZBA 5AYPA 2O1OA 4GP2A 3SDTA 3G4DA 1VG4A 2E8WA 3VJBA 1V4JA 3KROA 3WCJA 4KWDA 3ICNA 3OYRA 1RTRA 3OABA 4JXNA 2E8VA 4LA6A 2ZY1A 1VG7A 2Z4WA 2E94A 5DJPF 1V4IA 5E8HA 3M00A 5IN8A 4H5EF 2E95A 4KPDA 3WCEA 3LZ9A 4PVYF 3PYAA 2E8XA 4P0VA 3PH7A 1JFGA 4FJQA 5JV2F 3P5RA 2F7MF 2ZEVA 3OACA 5B0JA 4N1ZF 4MC3A 3RBMA 3RYEA 3WE9A 3WCAA 5EAUA 3AQBB 5DGSF 3KRPB 5ILYA 1KIZA 3B7LA 3KRFA 3OABB 5JV1F 5B03A 2E90A 1PS1A 3EZ3A 4F6XA 2QISA 4RXAA 3ZOUA 3N46F 1WMWA 1UBXA 4LPGF 4DEMF 2E4OA 3PKOA 4EA1A 2Q9ZA 5DZ2A 2PS7A 3ASXA 5A0JA 1RQIA 5IL8A 1V4EA 3WJNA 2FTZA 3ACWA 2ONGA 3LJIA 3ZMCA 5B0LA 3NPRA 4JXYA 1HXAA 2ZCOA 3OACB 2P1CA 5ER8A 3AQCB 3EGTA 4EA2A 4KVWA 4QPFA 1UBVA 5AHUB 4HD1A 4FP4A 4NFKF 2EWGA 2AEKA 3DYHA 5DGNF 2Z7IA 4K10A 4JYXA 4NKEA 5B0IA 1N1ZA 3V1XA 1VG6A 1YYRA 4KQUA 1DI1A 5IMIA 3N49F 5B0KA 3LVSA 2F8ZF 3SDUA 2Z52A 1HM4A 5ILJA 5DGMF 5IK9A 1FPSA 3M0GA 3PDEA 3DYGA 1WL3A 1HX9A 2Z78A 3WC9A 1N20A 3ZMBA 3SDRA 3M9UA 4ZQ8A 4P0XA 4F62A 3IBAA 3SAEA 3WCDA 2PS5A 5EROA 4OMGA 3KRAA 2AETA 3ICMA 3Q2ZA 1VG3A 3WEKA 2F9KF 5IMPA 3ACXA 3VJCA 3KRCA 4E9ZA 3TC1A 4GAXA 3LGKA 3G4FA 4JVJF 3NF2A 4OKZA 2PS4A 5AFXA 1HXCA 2AZKA 4DI5A 5IMNA 1WY0A 3RYWA 2PS8A 1YYUA 1ZW5A 3WCIA 2E91A 3WEFA 3N1VF 4XQTF 4JZXA 4P0WA 4KK2A 4XQSF 4UMJA 5IKAA 3SDVA 2E8TA 1YHMA 2Z4ZA 2Z50A 3KROB 3KRCB 3ZL6A 5HNAA 4KUXA 3AQ0A 3ACYA 3KB9A 5C05A 2PS6A 2J5CA 5DIQF 4GP1A 2DH4A 5B01A 3LOMA 2E93A 5JUZF 5DHKA 2Z4YA 4DWGA 4EA0A 3N1WF 3CP6A 5E8KA 1VG2A 3N0GA 2ZCSA 1YQ7A 5KSXF 5ILHA 3N6KF 2ZEUA 4NFJF 5A0KA 5IVGA 3WCCA 4NUAA 4LTVA 2E8UA 3Q1OA 4LZ0A 4NFIF 3LSNA 5IK6A 4LOBA 4QXSF 3KRFB 3QQVA 4OKMA 5A0IA 5IL3A 3LG5A 3LEEA 5B0MA 4RNQA 3P41A 2Z4XA 1WL0A 2ZCQA 2Q9YA 3WCHA 4LUUA 2VF6A 3VJ8A 3N0FA 5HN7A 1EZFA 3ICZA 5HN9A 3N5HF 3M01A 2F8CF 2OPMA 2AZLA 2F92F 3NPKA 1YJ4A 1N21A 5ILKA 3DYFA 4LFEA 3AE0A 1N24A 4KKMA 4LPHF
chains in the Genus database with same CATH superfamily
1V4KA 4LTZA 4PVXF 2AELA 5H9DA 3LMDA 3KBKA 4LLSA 1N1BA 5JV0F 4KQSA 1WL1A 1DGPA 3CC9A 5DJRF 4RXDA 5CG5A 2F94F 3APZA 4OGUA 3PYBA 3ID0A 3TS7A 4DXJA 3P8RA 1HXGA 4RXCA 2ONHA 3BNXA 3Q30A 5DHIA 2Z7HA 3CKEA 5EASA 2I19A 3WSAA 3VJ9A 3KRPA 3EFQA 1WL2A 3TFNA 3WSBA 3KRAB 4KFAA 3BNYA 3P5PA 1N23A 2OA6A 5B02A 5JA0F 1UBYA 2AZJA 4L2XF 4H5DF 4E1EA 3LDWA 3VJAA 5EATA 1WKZA 5HN8A 3VJEA 1V4HA 2OGDA 3V66A 5IKHA 5DJVF 4NG6A 5AELA 4KPJA 3NRIA 4KVDA 3N5JF 3W7FA 3MAVA 3ICKA 4LFGA 1YHKA 1YYTA 3WCLA 1JFAA 3MZVA 3QKCA 3SDQA 3P8LA 4LFVF 1YHLA 3WJKA 2ZCRA 1YV5A 4MC0A 1UBWA 3WCGA 4OMHA 3WEIA 1RQJA 5CG6A 4LZCA 3N3LF 4KQ5A 2RAHA 3RMGA 4WK5A 3WCMA 5IK0A 3S4JA 4F6VA 4KVYA 2J1PA 5I1UA 4DHDA 5ERMA 3LGZB 4GA3A 3IPIA 4XQRF 3S9VA 3N3DA 4N9UA 2H8OA 3WJOA 4LLTA 4LXWA 4DZWA 1N22A 2FORA 3VJDA 1YYSA 3LK5A 5IM1A 3ZCDA 5DW7A 5ERNA 2J1OA 3WCBA 2Q58A 4H5CF 2E92A 2OPNA 4LZ3A 3WEGA 3LLWA 4RXEA 1KIYA 4KVIA 3V1VA 5ILZA 4LA5A 4Q23A 4DWBA 4E9UA 5B00A 3UCAA 4LIXA 3WCFA 3M02A 3WEJA 4RYPA 3TFPA 2F89F 3N45F 3Q2QA 2Q80A 5ILIA 2Z4VA 3WEHA 4MC8A 1YYQA 5E8LA 3TFVA 3ADZA 5ILDA 1HM7A 4NKFA 4JZBA 5AYPA 2O1OA 4GP2A 3SDTA 3G4DA 1VG4A 2E8WA 3VJBA 1V4JA 3KROA 3WCJA 4KWDA 3ICNA 3OYRA 1RTRA 3OABA 4JXNA 2E8VA 4LA6A 2ZY1A 1VG7A 2Z4WA 2E94A 5DJPF 1V4IA 5E8HA 3M00A 5IN8A 4H5EF 2E95A 4KPDA 3WCEA 3LZ9A 4PVYF 3PYAA 2E8XA 4P0VA 3PH7A 1JFGA 4FJQA 5JV2F 3P5RA 2F7MF 2ZEVA 3OACA 5B0JA 4N1ZF 4MC3A 3RBMA 3RYEA 3WE9A 3WCAA 5EAUA 3AQBB 5DGSF 3KRPB 5ILYA 1KIZA 3B7LA 3KRFA 3OABB 5JV1F 5B03A 2E90A 1PS1A 3EZ3A 4F6XA 2QISA 4RXAA 3ZOUA 3N46F 1WMWA 1UBXA 4LPGF 4DEMF 2E4OA 3PKOA 4EA1A 2Q9ZA 5DZ2A 2PS7A 3ASXA 5A0JA 1RQIA 5IL8A 1V4EA 3WJNA 2FTZA 3ACWA 2ONGA 3LJIA 3ZMCA 5B0LA 3NPRA 4JXYA 1HXAA 2ZCOA 3OACB 2P1CA 5ER8A 3AQCB 3EGTA 4EA2A 4KVWA 4QPFA 1UBVA 5AHUB 4HD1A 4FP4A 4NFKF 2EWGA 2AEKA 3DYHA 5DGNF 2Z7IA 4K10A 4JYXA 4NKEA 5B0IA 1N1ZA 3V1XA 1VG6A 1YYRA 4KQUA 1DI1A 5IMIA 3N49F 5B0KA 3LVSA 2F8ZF 3SDUA 2Z52A 1HM4A 5ILJA 5DGMF 5IK9A 1FPSA 3M0GA 3PDEA 3DYGA 1WL3A 1HX9A 2Z78A 3WC9A 1N20A 3ZMBA 3SDRA 3M9UA 4ZQ8A 4P0XA 4F62A 3IBAA 3SAEA 3WCDA 2PS5A 5EROA 4OMGA 3KRAA 2AETA 3ICMA 3Q2ZA 1VG3A 3WEKA 2F9KF 5IMPA 3ACXA 3VJCA 3KRCA 4E9ZA 3TC1A 4GAXA 3LGKA 3G4FA 4JVJF 3NF2A 4OKZA 2PS4A 5AFXA 1HXCA 2AZKA 4DI5A 5IMNA 1WY0A 3RYWA 2PS8A 1YYUA 1ZW5A 3WCIA 2E91A 3WEFA 3N1VF 4XQTF 4JZXA 4P0WA 4KK2A 4XQSF 4UMJA 5IKAA 3SDVA 2E8TA 1YHMA 2Z4ZA 2Z50A 3KROB 3KRCB 3ZL6A 5HNAA 4KUXA 3AQ0A 3ACYA 3KB9A 5C05A 2PS6A 2J5CA 5DIQF 4GP1A 2DH4A 5B01A 3LOMA 2E93A 5JUZF 5DHKA 2Z4YA 4DWGA 4EA0A 3N1WF 3CP6A 5E8KA 1VG2A 3N0GA 2ZCSA 1YQ7A 5KSXF 5ILHA 3N6KF 2ZEUA 4NFJF 5A0KA 5IVGA 3WCCA 4NUAA 4LTVA 2E8UA 3Q1OA 4LZ0A 4NFIF 3LSNA 5IK6A 4LOBA 4QXSF 3KRFB 3QQVA 4OKMA 5A0IA 5IL3A 3LG5A 3LEEA 5B0MA 4RNQA 3P41A 2Z4XA 1WL0A 2ZCQA 2Q9YA 3WCHA 4LUUA 2VF6A 3VJ8A 3N0FA 5HN7A 1EZFA 3ICZA 5HN9A 3N5HF 3M01A 2F8CF 2OPMA 2AZLA 2F92F 3NPKA 1YJ4A 1N21A 5ILKA 3DYFA 4LFEA 3AE0A 1N24A 4KKMA 4LPHF
chains in the Genus database with same CATH topology
1V4KA 4LTZA 4PVXF 2AELA 5H9DA 3LMDA 3KBKA 4LLSA 1N1BA 5JV0F 4KQSA 1WL1A 1DGPA 3CC9A 5DJRF 4RXDA 5CG5A 2F94F 3APZA 4OGUA 3PYBA 3ID0A 3TS7A 4DXJA 3P8RA 1HXGA 4RXCA 2ONHA 3BNXA 3Q30A 5DHIA 2Z7HA 3CKEA 5EASA 2I19A 3WSAA 3VJ9A 3KRPA 3EFQA 1WL2A 3TFNA 3WSBA 3KRAB 4KFAA 3BNYA 3P5PA 1N23A 2OA6A 5B02A 5JA0F 1UBYA 2AZJA 4L2XF 4H5DF 4E1EA 3LDWA 3VJAA 5EATA 1WKZA 5HN8A 3VJEA 1V4HA 2OGDA 3V66A 5IKHA 5DJVF 4NG6A 5AELA 4KPJA 3NRIA 4KVDA 3N5JF 3W7FA 3MAVA 3ICKA 4LFGA 1YHKA 1YYTA 3WCLA 1JFAA 3MZVA 3QKCA 3SDQA 3P8LA 4LFVF 1YHLA 3WJKA 2ZCRA 1YV5A 4MC0A 1UBWA 3WCGA 4OMHA 3WEIA 1RQJA 5CG6A 4LZCA 3N3LF 4KQ5A 2RAHA 3RMGA 4WK5A 3WCMA 5IK0A 3S4JA 4F6VA 4KVYA 2J1PA 5I1UA 4DHDA 5ERMA 3LGZB 4GA3A 3IPIA 4XQRF 3S9VA 3N3DA 4N9UA 2H8OA 3WJOA 4LLTA 4LXWA 4DZWA 1N22A 2FORA 3VJDA 1YYSA 3LK5A 5IM1A 3ZCDA 5DW7A 5ERNA 2J1OA 3WCBA 2Q58A 4H5CF 2E92A 2OPNA 4LZ3A 3WEGA 3LLWA 4RXEA 1KIYA 4KVIA 3V1VA 5ILZA 4LA5A 4Q23A 4DWBA 4E9UA 5B00A 3UCAA 4LIXA 3WCFA 3M02A 3WEJA 4RYPA 3TFPA 2F89F 3N45F 3Q2QA 2Q80A 5ILIA 2Z4VA 3WEHA 4MC8A 1YYQA 5E8LA 3TFVA 3ADZA 5ILDA 1HM7A 4NKFA 4JZBA 5AYPA 2O1OA 4GP2A 3SDTA 3G4DA 1VG4A 2E8WA 3VJBA 1V4JA 3KROA 3WCJA 4KWDA 3ICNA 3OYRA 1RTRA 3OABA 4JXNA 2E8VA 4LA6A 2ZY1A 1VG7A 2Z4WA 2E94A 5DJPF 1V4IA 5E8HA 3M00A 5IN8A 4H5EF 2E95A 4KPDA 3WCEA 3LZ9A 4PVYF 3PYAA 2E8XA 4P0VA 3PH7A 1JFGA 4FJQA 5JV2F 3P5RA 2F7MF 2ZEVA 3OACA 5B0JA 4N1ZF 4MC3A 3RBMA 3RYEA 3WE9A 3WCAA 5EAUA 3AQBB 5DGSF 3KRPB 5ILYA 1KIZA 3B7LA 3KRFA 3OABB 5JV1F 5B03A 2E90A 1PS1A 3EZ3A 4F6XA 2QISA 4RXAA 3ZOUA 3N46F 1WMWA 1UBXA 4LPGF 4DEMF 2E4OA 3PKOA 4EA1A 2Q9ZA 5DZ2A 2PS7A 3ASXA 5A0JA 1RQIA 5IL8A 1V4EA 3WJNA 2FTZA 3ACWA 2ONGA 3LJIA 3ZMCA 5B0LA 3NPRA 4JXYA 1HXAA 2ZCOA 3OACB 2P1CA 5ER8A 3AQCB 3EGTA 4EA2A 4KVWA 4QPFA 1UBVA 5AHUB 4HD1A 4FP4A 4NFKF 2EWGA 2AEKA 3DYHA 5DGNF 2Z7IA 4K10A 4JYXA 4NKEA 5B0IA 1N1ZA 3V1XA 1VG6A 1YYRA 4KQUA 1DI1A 5IMIA 3N49F 5B0KA 3LVSA 2F8ZF 3SDUA 2Z52A 1HM4A 5ILJA 5DGMF 5IK9A 1FPSA 3M0GA 3PDEA 3DYGA 1WL3A 1HX9A 2Z78A 3WC9A 1N20A 3ZMBA 3SDRA 3M9UA 4ZQ8A 4P0XA 4F62A 3IBAA 3SAEA 3WCDA 2PS5A 5EROA 4OMGA 3KRAA 2AETA 3ICMA 3Q2ZA 1VG3A 3WEKA 2F9KF 5IMPA 3ACXA 3VJCA 3KRCA 4E9ZA 3TC1A 4GAXA 3LGKA 3G4FA 4JVJF 3NF2A 4OKZA 2PS4A 5AFXA 1HXCA 2AZKA 4DI5A 5IMNA 1WY0A 3RYWA 2PS8A 1YYUA 1ZW5A 3WCIA 2E91A 3WEFA 3N1VF 4XQTF 4JZXA 4P0WA 4KK2A 4XQSF 4UMJA 5IKAA 3SDVA 2E8TA 1YHMA 2Z4ZA 2Z50A 3KROB 3KRCB 3ZL6A 5HNAA 4KUXA 3AQ0A 3ACYA 3KB9A 5C05A 2PS6A 2J5CA 5DIQF 4GP1A 2DH4A 5B01A 3LOMA 2E93A 5JUZF 5DHKA 2Z4YA 4DWGA 4EA0A 3N1WF 3CP6A 5E8KA 1VG2A 3N0GA 2ZCSA 1YQ7A 5KSXF 5ILHA 3N6KF 2ZEUA 4NFJF 5A0KA 5IVGA 3WCCA 4NUAA 4LTVA 2E8UA 3Q1OA 4LZ0A 4NFIF 3LSNA 5IK6A 4LOBA 4QXSF 3KRFB 3QQVA 4OKMA 5A0IA 5IL3A 3LG5A 3LEEA 5B0MA 4RNQA 3P41A 2Z4XA 1WL0A 2ZCQA 2Q9YA 3WCHA 4LUUA 2VF6A 3VJ8A 3N0FA 5HN7A 1EZFA 3ICZA 5HN9A 3N5HF 3M01A 2F8CF 2OPMA 2AZLA 2F92F 3NPKA 1YJ4A 1N21A 5ILKA 3DYFA 4LFEA 3AE0A 1N24A 4KKMA 4LPHF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V4K A;  4LTZ A;  4PVX F;  2AEL A;  5H9D A;  3LMD A;  3KBK A;  4LLS A;  1N1B A;  5JV0 F;  4KQS A;  1WL1 A;  1DGP A;  3CC9 A;  5DJR F;  4RXD A;  5CG5 A;  2F94 F;  3APZ A;  4OGU A;  3PYB A;  3ID0 A;  3TS7 A;  4DXJ A;  3P8R A;  1HXG A;  4RXC A;  2ONH A;  3BNX A;  3Q30 A;  5DHI A;  2Z7H A;  3CKE A;  5EAS A;  2I19 A;  3WSA A;  3VJ9 A;  3KRP A;  3EFQ A;  1WL2 A;  3TFN A;  3WSB A;  3KRA B;  4KFA A;  3BNY A;  3P5P A;  1N23 A;  2OA6 A;  5B02 A;  5JA0 F;  1UBY A;  2AZJ A;  4L2X F;  4H5D F;  4E1E A;  3LDW A;  3VJA A;  5EAT A;  1WKZ A;  5HN8 A;  3VJE A;  1V4H A;  2OGD A;  3V66 A;  5IKH A;  5DJV F;  4NG6 A;  5AEL A;  4KPJ A;  3NRI A;  4KVD A;  3N5J F;  3W7F A;  3MAV A;  3ICK A;  4LFG A;  1YHK A;  1YYT A;  3WCL A;  1JFA A;  3MZV A;  3QKC A;  3SDQ A;  3P8L A;  4LFV F;  1YHL A;  3WJK A;  2ZCR A;  1YV5 A;  4MC0 A;  1UBW A;  3WCG A;  4OMH A;  3WEI A;  1RQJ A;  5CG6 A;  4LZC A;  3N3L F;  4KQ5 A;  2RAH A;  3RMG A;  4WK5 A;  3WCM A;  5IK0 A;  3S4J A;  4F6V A;  4KVY A;  2J1P A;  5I1U A;  4DHD A;  5ERM A;  3LGZ B;  4GA3 A;  3IPI A;  4XQR F;  3S9V A;  3N3D A;  4N9U A;  2H8O A;  3WJO A;  4LLT A;  4LXW A;  4DZW A;  1N22 A;  2FOR A;  3VJD A;  1YYS A;  3LK5 A;  5IM1 A;  3ZCD A;  5DW7 A;  5ERN A;  2J1O A;  3WCB A;  2Q58 A;  4H5C F;  2E92 A;  2OPN A;  4LZ3 A;  3WEG A;  3LLW A;  4RXE A;  1KIY A;  4KVI A;  3V1V A;  5ILZ A;  4LA5 A;  4Q23 A;  4DWB A;  4E9U A;  5B00 A;  3UCA A;  4LIX A;  3WCF A;  3M02 A;  3WEJ A;  4RYP A;  3TFP A;  2F89 F;  3N45 F;  3Q2Q A;  2Q80 A;  5ILI A;  2Z4V A;  3WEH A;  4MC8 A;  1YYQ A;  5E8L A;  3TFV A;  3ADZ A;  5ILD A;  1HM7 A;  4NKF A;  4JZB A;  5AYP A;  2O1O A;  4GP2 A;  3SDT A;  3G4D A;  1VG4 A;  2E8W A;  3VJB A;  1V4J A;  3KRO A;  3WCJ A;  4KWD A;  3ICN A;  3OYR A;  1RTR A;  3OAB A;  4JXN A;  2E8V A;  4LA6 A;  2ZY1 A;  1VG7 A;  2Z4W A;  2E94 A;  5DJP F;  1V4I A;  5E8H A;  3M00 A;  5IN8 A;  4H5E F;  2E95 A;  4KPD A;  3WCE A;  3LZ9 A;  4PVY F;  3PYA A;  2E8X A;  4P0V A;  3PH7 A;  1JFG A;  4FJQ A;  5JV2 F;  3P5R A;  2F7M F;  2ZEV A;  3OAC A;  5B0J A;  4N1Z F;  4MC3 A;  3RBM A;  3RYE A;  3WE9 A;  3WCA A;  5EAU A;  3AQB B;  5DGS F;  3KRP B;  5ILY A;  1KIZ A;  3B7L A;  3KRF A;  3OAB B;  5JV1 F;  5B03 A;  2E90 A;  1PS1 A;  3EZ3 A;  4F6X A;  2QIS A;  4RXA A;  3ZOU A;  3N46 F;  1WMW A;  1UBX A;  4LPG F;  4DEM F;  2E4O A;  3PKO A;  4EA1 A;  2Q9Z A;  5DZ2 A;  2PS7 A;  3ASX A;  5A0J A;  1RQI A;  5IL8 A;  1V4E A;  3WJN A;  2FTZ A;  3ACW A;  2ONG A;  3LJI A;  3ZMC A;  5B0L A;  3NPR A;  4JXY A;  1HXA A;  2ZCO A;  3OAC B;  2P1C A;  5ER8 A;  3AQC B;  3EGT A;  4EA2 A;  4KVW A;  4QPF A;  1UBV A;  5AHU B;  4HD1 A;  4FP4 A;  4NFK F;  2EWG A;  2AEK A;  3DYH A;  5DGN F;  2Z7I A;  4K10 A;  4JYX A;  4NKE A;  5B0I A;  1N1Z A;  3V1X A;  1VG6 A;  1YYR A;  4KQU A;  1DI1 A;  5IMI A;  3N49 F;  5B0K A;  3LVS A;  2F8Z F;  3SDU A;  2Z52 A;  1HM4 A;  5ILJ A;  5DGM F;  5IK9 A;  1FPS A;  3M0G A;  3PDE A;  3DYG A;  1WL3 A;  1HX9 A;  2Z78 A;  3WC9 A;  1N20 A;  3ZMB A;  3SDR A;  3M9U A;  4ZQ8 A;  4P0X A;  4F62 A;  3IBA A;  3SAE A;  3WCD A;  2PS5 A;  5ERO A;  4OMG A;  3KRA A;  2AET A;  3ICM A;  3Q2Z A;  1VG3 A;  3WEK A;  2F9K F;  5IMP A;  3ACX A;  3VJC A;  3KRC A;  4E9Z A;  3TC1 A;  4GAX A;  3LGK A;  3G4F A;  4JVJ F;  3NF2 A;  4OKZ A;  2PS4 A;  5AFX A;  1HXC A;  2AZK A;  4DI5 A;  5IMN A;  1WY0 A;  3RYW A;  2PS8 A;  1YYU A;  1ZW5 A;  3WCI A;  2E91 A;  3WEF A;  3N1V F;  4XQT F;  4JZX A;  4P0W A;  4KK2 A;  4XQS F;  4UMJ A;  5IKA A;  3SDV A;  2E8T A;  1YHM A;  2Z4Z A;  2Z50 A;  3KRO B;  3KRC B;  3ZL6 A;  5HNA A;  4KUX A;  3AQ0 A;  3ACY A;  3KB9 A;  5C05 A;  2PS6 A;  2J5C A;  5DIQ F;  4GP1 A;  2DH4 A;  5B01 A;  3LOM A;  2E93 A;  5JUZ F;  5DHK A;  2Z4Y A;  4DWG A;  4EA0 A;  3N1W F;  3CP6 A;  5E8K A;  1VG2 A;  3N0G A;  2ZCS A;  1YQ7 A;  5KSX F;  5ILH A;  3N6K F;  2ZEU A;  4NFJ F;  5A0K A;  5IVG A;  3WCC A;  4NUA A;  4LTV A;  2E8U A;  3Q1O A;  4LZ0 A;  4NFI F;  3LSN A;  5IK6 A;  4LOB A;  4QXS F;  3KRF B;  3QQV A;  4OKM A;  5A0I A;  5IL3 A;  3LG5 A;  3LEE A;  5B0M A;  4RNQ A;  3P41 A;  2Z4X A;  1WL0 A;  2ZCQ A;  2Q9Y A;  3WCH A;  4LUU A;  2VF6 A;  3VJ8 A;  3N0F A;  5HN7 A;  1EZF A;  3ICZ A;  5HN9 A;  3N5H F;  3M01 A;  2F8C F;  2OPM A;  2AZL A;  2F92 F;  3NPK A;  1YJ4 A;  1N21 A;  5ILK A;  3DYF A;  4LFE A;  3AE0 A;  1N24 A;  4KKM A;  4LPH F; 
#chains in the Genus database with same CATH topology
 1V4K A;  4LTZ A;  4PVX F;  2AEL A;  5H9D A;  3LMD A;  3KBK A;  4LLS A;  1N1B A;  5JV0 F;  4KQS A;  1WL1 A;  1DGP A;  3CC9 A;  5DJR F;  4RXD A;  5CG5 A;  2F94 F;  3APZ A;  4OGU A;  3PYB A;  3ID0 A;  3TS7 A;  4DXJ A;  3P8R A;  1HXG A;  4RXC A;  2ONH A;  3BNX A;  3Q30 A;  5DHI A;  2Z7H A;  3CKE A;  5EAS A;  2I19 A;  3WSA A;  3VJ9 A;  3KRP A;  3EFQ A;  1WL2 A;  3TFN A;  3WSB A;  3KRA B;  4KFA A;  3BNY A;  3P5P A;  1N23 A;  2OA6 A;  5B02 A;  5JA0 F;  1UBY A;  2AZJ A;  4L2X F;  4H5D F;  4E1E A;  3LDW A;  3VJA A;  5EAT A;  1WKZ A;  5HN8 A;  3VJE A;  1V4H A;  2OGD A;  3V66 A;  5IKH A;  5DJV F;  4NG6 A;  5AEL A;  4KPJ A;  3NRI A;  4KVD A;  3N5J F;  3W7F A;  3MAV A;  3ICK A;  4LFG A;  1YHK A;  1YYT A;  3WCL A;  1JFA A;  3MZV A;  3QKC A;  3SDQ A;  3P8L A;  4LFV F;  1YHL A;  3WJK A;  2ZCR A;  1YV5 A;  4MC0 A;  1UBW A;  3WCG A;  4OMH A;  3WEI A;  1RQJ A;  5CG6 A;  4LZC A;  3N3L F;  4KQ5 A;  2RAH A;  3RMG A;  4WK5 A;  3WCM A;  5IK0 A;  3S4J A;  4F6V A;  4KVY A;  2J1P A;  5I1U A;  4DHD A;  5ERM A;  3LGZ B;  4GA3 A;  3IPI A;  4XQR F;  3S9V A;  3N3D A;  4N9U A;  2H8O A;  3WJO A;  4LLT A;  4LXW A;  4DZW A;  1N22 A;  2FOR A;  3VJD A;  1YYS A;  3LK5 A;  5IM1 A;  3ZCD A;  5DW7 A;  5ERN A;  2J1O A;  3WCB A;  2Q58 A;  4H5C F;  2E92 A;  2OPN A;  4LZ3 A;  3WEG A;  3LLW A;  4RXE A;  1KIY A;  4KVI A;  3V1V A;  5ILZ A;  4LA5 A;  4Q23 A;  4DWB A;  4E9U A;  5B00 A;  3UCA A;  4LIX A;  3WCF A;  3M02 A;  3WEJ A;  4RYP A;  3TFP A;  2F89 F;  3N45 F;  3Q2Q A;  2Q80 A;  5ILI A;  2Z4V A;  3WEH A;  4MC8 A;  1YYQ A;  5E8L A;  3TFV A;  3ADZ A;  5ILD A;  1HM7 A;  4NKF A;  4JZB A;  5AYP A;  2O1O A;  4GP2 A;  3SDT A;  3G4D A;  1VG4 A;  2E8W A;  3VJB A;  1V4J A;  3KRO A;  3WCJ A;  4KWD A;  3ICN A;  3OYR A;  1RTR A;  3OAB A;  4JXN A;  2E8V A;  4LA6 A;  2ZY1 A;  1VG7 A;  2Z4W A;  2E94 A;  5DJP F;  1V4I A;  5E8H A;  3M00 A;  5IN8 A;  4H5E F;  2E95 A;  4KPD A;  3WCE A;  3LZ9 A;  4PVY F;  3PYA A;  2E8X A;  4P0V A;  3PH7 A;  1JFG A;  4FJQ A;  5JV2 F;  3P5R A;  2F7M F;  2ZEV A;  3OAC A;  5B0J A;  4N1Z F;  4MC3 A;  3RBM A;  3RYE A;  3WE9 A;  3WCA A;  5EAU A;  3AQB B;  5DGS F;  3KRP B;  5ILY A;  1KIZ A;  3B7L A;  3KRF A;  3OAB B;  5JV1 F;  5B03 A;  2E90 A;  1PS1 A;  3EZ3 A;  4F6X A;  2QIS A;  4RXA A;  3ZOU A;  3N46 F;  1WMW A;  1UBX A;  4LPG F;  4DEM F;  2E4O A;  3PKO A;  4EA1 A;  2Q9Z A;  5DZ2 A;  2PS7 A;  3ASX A;  5A0J A;  1RQI A;  5IL8 A;  1V4E A;  3WJN A;  2FTZ A;  3ACW A;  2ONG A;  3LJI A;  3ZMC A;  5B0L A;  3NPR A;  4JXY A;  1HXA A;  2ZCO A;  3OAC B;  2P1C A;  5ER8 A;  3AQC B;  3EGT A;  4EA2 A;  4KVW A;  4QPF A;  1UBV A;  5AHU B;  4HD1 A;  4FP4 A;  4NFK F;  2EWG A;  2AEK A;  3DYH A;  5DGN F;  2Z7I A;  4K10 A;  4JYX A;  4NKE A;  5B0I A;  1N1Z A;  3V1X A;  1VG6 A;  1YYR A;  4KQU A;  1DI1 A;  5IMI A;  3N49 F;  5B0K A;  3LVS A;  2F8Z F;  3SDU A;  2Z52 A;  1HM4 A;  5ILJ A;  5DGM F;  5IK9 A;  1FPS A;  3M0G A;  3PDE A;  3DYG A;  1WL3 A;  1HX9 A;  2Z78 A;  3WC9 A;  1N20 A;  3ZMB A;  3SDR A;  3M9U A;  4ZQ8 A;  4P0X A;  4F62 A;  3IBA A;  3SAE A;  3WCD A;  2PS5 A;  5ERO A;  4OMG A;  3KRA A;  2AET A;  3ICM A;  3Q2Z A;  1VG3 A;  3WEK A;  2F9K F;  5IMP A;  3ACX A;  3VJC A;  3KRC A;  4E9Z A;  3TC1 A;  4GAX A;  3LGK A;  3G4F A;  4JVJ F;  3NF2 A;  4OKZ A;  2PS4 A;  5AFX A;  1HXC A;  2AZK A;  4DI5 A;  5IMN A;  1WY0 A;  3RYW A;  2PS8 A;  1YYU A;  1ZW5 A;  3WCI A;  2E91 A;  3WEF A;  3N1V F;  4XQT F;  4JZX A;  4P0W A;  4KK2 A;  4XQS F;  4UMJ A;  5IKA A;  3SDV A;  2E8T A;  1YHM A;  2Z4Z A;  2Z50 A;  3KRO B;  3KRC B;  3ZL6 A;  5HNA A;  4KUX A;  3AQ0 A;  3ACY A;  3KB9 A;  5C05 A;  2PS6 A;  2J5C A;  5DIQ F;  4GP1 A;  2DH4 A;  5B01 A;  3LOM A;  2E93 A;  5JUZ F;  5DHK A;  2Z4Y A;  4DWG A;  4EA0 A;  3N1W F;  3CP6 A;  5E8K A;  1VG2 A;  3N0G A;  2ZCS A;  1YQ7 A;  5KSX F;  5ILH A;  3N6K F;  2ZEU A;  4NFJ F;  5A0K A;  5IVG A;  3WCC A;  4NUA A;  4LTV A;  2E8U A;  3Q1O A;  4LZ0 A;  4NFI F;  3LSN A;  5IK6 A;  4LOB A;  4QXS F;  3KRF B;  3QQV A;  4OKM A;  5A0I A;  5IL3 A;  3LG5 A;  3LEE A;  5B0M A;  4RNQ A;  3P41 A;  2Z4X A;  1WL0 A;  2ZCQ A;  2Q9Y A;  3WCH A;  4LUU A;  2VF6 A;  3VJ8 A;  3N0F A;  5HN7 A;  1EZF A;  3ICZ A;  5HN9 A;  3N5H F;  3M01 A;  2F8C F;  2OPM A;  2AZL A;  2F92 F;  3NPK A;  1YJ4 A;  1N21 A;  5ILK A;  3DYF A;  4LFE A;  3AE0 A;  1N24 A;  4KKM A;  4LPH F; 
#chains in the Genus database with same CATH homology
 1V4K A;  4LTZ A;  4PVX F;  2AEL A;  5H9D A;  3LMD A;  3KBK A;  4LLS A;  1N1B A;  5JV0 F;  4KQS A;  1WL1 A;  1DGP A;  3CC9 A;  5DJR F;  4RXD A;  5CG5 A;  2F94 F;  3APZ A;  4OGU A;  3PYB A;  3ID0 A;  3TS7 A;  4DXJ A;  3P8R A;  1HXG A;  4RXC A;  2ONH A;  3BNX A;  3Q30 A;  5DHI A;  2Z7H A;  3CKE A;  5EAS A;  2I19 A;  3WSA A;  3VJ9 A;  3KRP A;  3EFQ A;  1WL2 A;  3TFN A;  3WSB A;  3KRA B;  4KFA A;  3BNY A;  3P5P A;  1N23 A;  2OA6 A;  5B02 A;  5JA0 F;  1UBY A;  2AZJ A;  4L2X F;  4H5D F;  4E1E A;  3LDW A;  3VJA A;  5EAT A;  1WKZ A;  5HN8 A;  3VJE A;  1V4H A;  2OGD A;  3V66 A;  5IKH A;  5DJV F;  4NG6 A;  5AEL A;  4KPJ A;  3NRI A;  4KVD A;  3N5J F;  3W7F A;  3MAV A;  3ICK A;  4LFG A;  1YHK A;  1YYT A;  3WCL A;  1JFA A;  3MZV A;  3QKC A;  3SDQ A;  3P8L A;  4LFV F;  1YHL A;  3WJK A;  2ZCR A;  1YV5 A;  4MC0 A;  1UBW A;  3WCG A;  4OMH A;  3WEI A;  1RQJ A;  5CG6 A;  4LZC A;  3N3L F;  4KQ5 A;  2RAH A;  3RMG A;  4WK5 A;  3WCM A;  5IK0 A;  3S4J A;  4F6V A;  4KVY A;  2J1P A;  5I1U A;  4DHD A;  5ERM A;  3LGZ B;  4GA3 A;  3IPI A;  4XQR F;  3S9V A;  3N3D A;  4N9U A;  2H8O A;  3WJO A;  4LLT A;  4LXW A;  4DZW A;  1N22 A;  2FOR A;  3VJD A;  1YYS A;  3LK5 A;  5IM1 A;  3ZCD A;  5DW7 A;  5ERN A;  2J1O A;  3WCB A;  2Q58 A;  4H5C F;  2E92 A;  2OPN A;  4LZ3 A;  3WEG A;  3LLW A;  4RXE A;  1KIY A;  4KVI A;  3V1V A;  5ILZ A;  4LA5 A;  4Q23 A;  4DWB A;  4E9U A;  5B00 A;  3UCA A;  4LIX A;  3WCF A;  3M02 A;  3WEJ A;  4RYP A;  3TFP A;  2F89 F;  3N45 F;  3Q2Q A;  2Q80 A;  5ILI A;  2Z4V A;  3WEH A;  4MC8 A;  1YYQ A;  5E8L A;  3TFV A;  3ADZ A;  5ILD A;  1HM7 A;  4NKF A;  4JZB A;  5AYP A;  2O1O A;  4GP2 A;  3SDT A;  3G4D A;  1VG4 A;  2E8W A;  3VJB A;  1V4J A;  3KRO A;  3WCJ A;  4KWD A;  3ICN A;  3OYR A;  1RTR A;  3OAB A;  4JXN A;  2E8V A;  4LA6 A;  2ZY1 A;  1VG7 A;  2Z4W A;  2E94 A;  5DJP F;  1V4I A;  5E8H A;  3M00 A;  5IN8 A;  4H5E F;  2E95 A;  4KPD A;  3WCE A;  3LZ9 A;  4PVY F;  3PYA A;  2E8X A;  4P0V A;  3PH7 A;  1JFG A;  4FJQ A;  5JV2 F;  3P5R A;  2F7M F;  2ZEV A;  3OAC A;  5B0J A;  4N1Z F;  4MC3 A;  3RBM A;  3RYE A;  3WE9 A;  3WCA A;  5EAU A;  3AQB B;  5DGS F;  3KRP B;  5ILY A;  1KIZ A;  3B7L A;  3KRF A;  3OAB B;  5JV1 F;  5B03 A;  2E90 A;  1PS1 A;  3EZ3 A;  4F6X A;  2QIS A;  4RXA A;  3ZOU A;  3N46 F;  1WMW A;  1UBX A;  4LPG F;  4DEM F;  2E4O A;  3PKO A;  4EA1 A;  2Q9Z A;  5DZ2 A;  2PS7 A;  3ASX A;  5A0J A;  1RQI A;  5IL8 A;  1V4E A;  3WJN A;  2FTZ A;  3ACW A;  2ONG A;  3LJI A;  3ZMC A;  5B0L A;  3NPR A;  4JXY A;  1HXA A;  2ZCO A;  3OAC B;  2P1C A;  5ER8 A;  3AQC B;  3EGT A;  4EA2 A;  4KVW A;  4QPF A;  1UBV A;  5AHU B;  4HD1 A;  4FP4 A;  4NFK F;  2EWG A;  2AEK A;  3DYH A;  5DGN F;  2Z7I A;  4K10 A;  4JYX A;  4NKE A;  5B0I A;  1N1Z A;  3V1X A;  1VG6 A;  1YYR A;  4KQU A;  1DI1 A;  5IMI A;  3N49 F;  5B0K A;  3LVS A;  2F8Z F;  3SDU A;  2Z52 A;  1HM4 A;  5ILJ A;  5DGM F;  5IK9 A;  1FPS A;  3M0G A;  3PDE A;  3DYG A;  1WL3 A;  1HX9 A;  2Z78 A;  3WC9 A;  1N20 A;  3ZMB A;  3SDR A;  3M9U A;  4ZQ8 A;  4P0X A;  4F62 A;  3IBA A;  3SAE A;  3WCD A;  2PS5 A;  5ERO A;  4OMG A;  3KRA A;  2AET A;  3ICM A;  3Q2Z A;  1VG3 A;  3WEK A;  2F9K F;  5IMP A;  3ACX A;  3VJC A;  3KRC A;  4E9Z A;  3TC1 A;  4GAX A;  3LGK A;  3G4F A;  4JVJ F;  3NF2 A;  4OKZ A;  2PS4 A;  5AFX A;  1HXC A;  2AZK A;  4DI5 A;  5IMN A;  1WY0 A;  3RYW A;  2PS8 A;  1YYU A;  1ZW5 A;  3WCI A;  2E91 A;  3WEF A;  3N1V F;  4XQT F;  4JZX A;  4P0W A;  4KK2 A;  4XQS F;  4UMJ A;  5IKA A;  3SDV A;  2E8T A;  1YHM A;  2Z4Z A;  2Z50 A;  3KRO B;  3KRC B;  3ZL6 A;  5HNA A;  4KUX A;  3AQ0 A;  3ACY A;  3KB9 A;  5C05 A;  2PS6 A;  2J5C A;  5DIQ F;  4GP1 A;  2DH4 A;  5B01 A;  3LOM A;  2E93 A;  5JUZ F;  5DHK A;  2Z4Y A;  4DWG A;  4EA0 A;  3N1W F;  3CP6 A;  5E8K A;  1VG2 A;  3N0G A;  2ZCS A;  1YQ7 A;  5KSX F;  5ILH A;  3N6K F;  2ZEU A;  4NFJ F;  5A0K A;  5IVG A;  3WCC A;  4NUA A;  4LTV A;  2E8U A;  3Q1O A;  4LZ0 A;  4NFI F;  3LSN A;  5IK6 A;  4LOB A;  4QXS F;  3KRF B;  3QQV A;  4OKM A;  5A0I A;  5IL3 A;  3LG5 A;  3LEE A;  5B0M A;  4RNQ A;  3P41 A;  2Z4X A;  1WL0 A;  2ZCQ A;  2Q9Y A;  3WCH A;  4LUU A;  2VF6 A;  3VJ8 A;  3N0F A;  5HN7 A;  1EZF A;  3ICZ A;  5HN9 A;  3N5H F;  3M01 A;  2F8C F;  2OPM A;  2AZL A;  2F92 F;  3NPK A;  1YJ4 A;  1N21 A;  5ILK A;  3DYF A;  4LFE A;  3AE0 A;  1N24 A;  4KKM A;  4LPH F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...