2FORA

Crystal structure of the shigella flexneri farnesyl pyrophosphate synthase complex with an isopentenyl pyrophosphate
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
298
structure length
283
Chain Sequence
DFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFGVSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTLAFSILSDANMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRHKTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGGKSTYPALLGLEQARKKARDLIDDARQALKQLAEQSLDTSALEALADYIIQRNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Crystal Structure of the Shigella flexneri Farnesyl Pyrophosphate Synthase Complex with an Isopentenyl Pyrophosphate
rcsb
source organism Shigella flexneri
total genus 112
structure length 283
sequence length 298
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2006-01-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2forA00
2Z50A 3WCDA 4JVJF 2I19A 3S9VA 1N1ZA 2PS5A 5E8KA 2F7MF 5JV1F 4LUUA 5B00A 4JYXA 2VF6A 1N20A 3LOMA 1RQJA 3N45F 4GP2A 4OGUA 1JFGA 4XQTF 2E93A 4KUXA 4LFGA 5AYPA 4EA0A 3N46F 1VG6A 4E9UA 1HXCA 5HN8A 2Z4YA 3KRPB 3M01A 2E8UA 5IVGA 2AELA 5ILIA 2Z52A 3W7FA 5IK9A 3WCLA 1YHKA 3KRAB 3OACB 4JZXA 2Z7IA 2AEKA 2H8OA 1V4HA 4EA1A 3LGKA 3SDUA 4LTZA 3WCEA 2OPMA 5IN8A 1YYUA 5DW7A 4DZWA 4E1EA 3DYHA 4OKMA 5B01A 4GA3A 1YHMA 4DI5A 3ACYA 2OGDA 4LA6A 4XQSF 3WCCA 2FORA 1WMWA 4NKEA 3P5RA 3KRPA 1RQIA 2E94A 2J1PA 2Q9ZA 3EZ3A 4KK2A 3M0GA 5JA0F 4LOBA 3ZMBA 4KKMA 5A0IA 1WL3A 3WJNA 5E8LA 3AQ0A 2AZJA 3OACA 4QPFA 1VG3A 2E4OA 3KB9A 3RBMA 3Q2ZA 3N5HF 3WSBA 1YV5A 3Q2QA 4RXDA 3KROA 3SDTA 1VG4A 4H5EF 4HD1A 3NF2A 3M00A 2E8TA 2OPNA 4QXSF 5ILJA 2F89F 2ZCQA 3WJOA 1EZFA 2AZLA 1UBXA 4RXEA 4JZBA 1V4IA 1HXAA 3N49F 3P8RA 4OKZA 1N21A 1V4JA 3WEFA 2Z4XA 3UCAA 5DJVF 3LGZB 1V4EA 3VJEA 2E90A 1YQ7A 4RYPA 3ICMA 5DJPF 5HN9A 2Z4WA 3ZOUA 2E8VA 3Q30A 5DJRF 4ZQ8A 1FPSA 4KVWA 3EGTA 4RXAA 2DH4A 5B0KA 4KPJA 3N0GA 5B0IA 3RYEA 4DWGA 3WEGA 1N1BA 2FTZA 4OMGA 2OA6A 4WK5A 3AQBB 5IKAA 5AHUB 5IL3A 5IM1A 4PVXF 3LG5A 5EASA 3WE9A 3TFPA 3BNYA 3B7LA 3IPIA 3VJ9A 3M02A 3RYWA 3ZMCA 5A0KA 3LEEA 1VG7A 3ASXA 2E92A 4F6XA 5ER8A 3MAVA 4EA2A 3VJCA 1YJ4A 4F62A 4MC8A 4E9ZA 2E91A 5DIQF 4KQ5A 3WC9A 2Q58A 2O1OA 4LLTA 4RXCA 3LMDA 1PS1A 4P0WA 3WCJA 4GP1A 1YYSA 5EROA 3VJBA 3M9UA 1N23A 2ZCRA 3WEKA 3KROB 3IBAA 2ONGA 2F8CF 3PDEA 5B02A 1YYTA 1WL1A 4NFKF 3LK5A 3NPKA 5C05A 3N1VF 5DGMF 5HNAA 3QQVA 4LIXA 5CG6A 3RMGA 3WCMA 2E95A 3TFNA 3CC9A 5EATA 5DHIA 3PKOA 4GAXA 2AZKA 1YYRA 4KWDA 3DYGA 2ONHA 2Z78A 4UMJA 3ACXA 3VJAA 3TC1A 3NRIA 4LPGF 3ICZA 3P5PA 3BNXA 5IK6A 4H5DF 3TFVA 5IMPA 5HN7A 2EWGA 3KRFB 4LTVA 5ILDA 2J5CA 4NFIF 4DWBA 1HM7A 4FJQA 2Z4ZA 1WY0A 3DYFA 1VG2A 5IMIA 4P0VA 3VJ8A 5ILZA 2ZEVA 2ZEUA 2E8XA 3LJIA 4LA5A 4FP4A 4OMHA 2AETA 3LDWA 2Q9YA 5DHKA 5EAUA 3ACWA 4MC0A 3WEIA 3PH7A 1JFAA 5IMNA 3WCBA 4KQUA 4JXNA 1DI1A 3N6KF 3APZA 4N9UA 3KRFA 3V1XA 5B0MA 4NKFA 2F9KF 3NPRA 3Q1OA 4MC3A 3WCAA 1WKZA 1YYQA 3ADZA 3AE0A 3OABB 2ZCSA 1RTRA 2PS8A 3ICNA 2PS7A 4LFEA 5ILYA 5A0JA 3LVSA 3SDQA 3CP6A 3G4FA 3CKEA 5B0LA 2ZCOA 4LXWA 1V4KA 4K10A 3ZL6A 1WL2A 3N0FA 4N1ZF 5E8HA 5CG5A 3G4DA 4KVIA 2PS6A 4Q23A 4LZ3A 3KRCB 5ERMA 1HXGA 3LSNA 1UBYA 3S4JA 2PS4A 4LZCA 2F94F 3WCIA 3N1WF 4KVDA 4KVYA 3N3LF 1UBVA 5IL8A 3PYBA 1WL0A 3OABA 3V1VA 5IK0A 4NFJF 3QKCA 3P8LA 4JXYA 1DGPA 4KFAA 4PVYF 1UBWA 3AQCB 5IKHA 4DHDA 1KIYA 2E8WA 3OYRA 4RNQA 5B0JA 3WCHA 3SDRA 3KRCA 4KPDA 5ERNA 5I1UA 2QISA 4LPHF 2F92F 5JUZF 3ZCDA 5H9DA 2RAHA 1N22A 4LZ0A 3WCFA 3TS7A 5DGNF 5DGSF 2Z7HA 3ICKA 5AELA 1HX9A 4DEMF 5KSXF 4DXJA 3N5JF 5ILKA 3ID0A 3V66A 1N24A 1ZW5A 3KRAA 3P41A 4LFVF 2Z4VA 3KBKA 4LLSA 2J1OA 3SDVA 4H5CF 3EFQA 3PYAA 5B03A 5JV0F 5AFXA 3MZVA 3LLWA 3SAEA 4KQSA 3N3DA 1KIZA 1HM4A 4NUAA 1YHLA 3LZ9A 5ILHA 5JV2F 3VJDA 2Q80A 3WCGA 2F8ZF 4L2XF 3WEHA 4F6VA 2P1CA 3WEJA 4XQRF 3WSAA 4NG6A 2ZY1A 4P0XA 3WJKA 5DZ2A
chains in the Genus database with same CATH superfamily
2Z50A 3WCDA 4JVJF 2I19A 3S9VA 1N1ZA 2PS5A 5E8KA 2F7MF 5JV1F 4LUUA 5B00A 4JYXA 2VF6A 1N20A 3LOMA 1RQJA 3N45F 4GP2A 4OGUA 1JFGA 4XQTF 2E93A 4KUXA 4LFGA 5AYPA 4EA0A 3N46F 1VG6A 4E9UA 1HXCA 5HN8A 2Z4YA 3KRPB 3M01A 2E8UA 5IVGA 2AELA 5ILIA 2Z52A 3W7FA 5IK9A 3WCLA 1YHKA 3KRAB 3OACB 4JZXA 2Z7IA 2AEKA 2H8OA 1V4HA 4EA1A 3LGKA 3SDUA 4LTZA 3WCEA 2OPMA 5IN8A 1YYUA 5DW7A 4DZWA 4E1EA 3DYHA 4OKMA 5B01A 4GA3A 1YHMA 4DI5A 3ACYA 2OGDA 4LA6A 4XQSF 3WCCA 2FORA 1WMWA 4NKEA 3P5RA 3KRPA 1RQIA 2E94A 2J1PA 2Q9ZA 3EZ3A 4KK2A 3M0GA 5JA0F 4LOBA 3ZMBA 4KKMA 5A0IA 1WL3A 3WJNA 5E8LA 3AQ0A 2AZJA 3OACA 4QPFA 1VG3A 2E4OA 3KB9A 3RBMA 3Q2ZA 3N5HF 3WSBA 1YV5A 3Q2QA 4RXDA 3KROA 3SDTA 1VG4A 4H5EF 4HD1A 3NF2A 3M00A 2E8TA 2OPNA 4QXSF 5ILJA 2F89F 2ZCQA 3WJOA 1EZFA 2AZLA 1UBXA 4RXEA 4JZBA 1V4IA 1HXAA 3N49F 3P8RA 4OKZA 1N21A 1V4JA 3WEFA 2Z4XA 3UCAA 5DJVF 3LGZB 1V4EA 3VJEA 2E90A 1YQ7A 4RYPA 3ICMA 5DJPF 5HN9A 2Z4WA 3ZOUA 2E8VA 3Q30A 5DJRF 4ZQ8A 1FPSA 4KVWA 3EGTA 4RXAA 2DH4A 5B0KA 4KPJA 3N0GA 5B0IA 3RYEA 4DWGA 3WEGA 1N1BA 2FTZA 4OMGA 2OA6A 4WK5A 3AQBB 5IKAA 5AHUB 5IL3A 5IM1A 4PVXF 3LG5A 5EASA 3WE9A 3TFPA 3BNYA 3B7LA 3IPIA 3VJ9A 3M02A 3RYWA 3ZMCA 5A0KA 3LEEA 1VG7A 3ASXA 2E92A 4F6XA 5ER8A 3MAVA 4EA2A 3VJCA 1YJ4A 4F62A 4MC8A 4E9ZA 2E91A 5DIQF 4KQ5A 3WC9A 2Q58A 2O1OA 4LLTA 4RXCA 3LMDA 1PS1A 4P0WA 3WCJA 4GP1A 1YYSA 5EROA 3VJBA 3M9UA 1N23A 2ZCRA 3WEKA 3KROB 3IBAA 2ONGA 2F8CF 3PDEA 5B02A 1YYTA 1WL1A 4NFKF 3LK5A 3NPKA 5C05A 3N1VF 5DGMF 5HNAA 3QQVA 4LIXA 5CG6A 3RMGA 3WCMA 2E95A 3TFNA 3CC9A 5EATA 5DHIA 3PKOA 4GAXA 2AZKA 1YYRA 4KWDA 3DYGA 2ONHA 2Z78A 4UMJA 3ACXA 3VJAA 3TC1A 3NRIA 4LPGF 3ICZA 3P5PA 3BNXA 5IK6A 4H5DF 3TFVA 5IMPA 5HN7A 2EWGA 3KRFB 4LTVA 5ILDA 2J5CA 4NFIF 4DWBA 1HM7A 4FJQA 2Z4ZA 1WY0A 3DYFA 1VG2A 5IMIA 4P0VA 3VJ8A 5ILZA 2ZEVA 2ZEUA 2E8XA 3LJIA 4LA5A 4FP4A 4OMHA 2AETA 3LDWA 2Q9YA 5DHKA 5EAUA 3ACWA 4MC0A 3WEIA 3PH7A 1JFAA 5IMNA 3WCBA 4KQUA 4JXNA 1DI1A 3N6KF 3APZA 4N9UA 3KRFA 3V1XA 5B0MA 4NKFA 2F9KF 3NPRA 3Q1OA 4MC3A 3WCAA 1WKZA 1YYQA 3ADZA 3AE0A 3OABB 2ZCSA 1RTRA 2PS8A 3ICNA 2PS7A 4LFEA 5ILYA 5A0JA 3LVSA 3SDQA 3CP6A 3G4FA 3CKEA 5B0LA 2ZCOA 4LXWA 1V4KA 4K10A 3ZL6A 1WL2A 3N0FA 4N1ZF 5E8HA 5CG5A 3G4DA 4KVIA 2PS6A 4Q23A 4LZ3A 3KRCB 5ERMA 1HXGA 3LSNA 1UBYA 3S4JA 2PS4A 4LZCA 2F94F 3WCIA 3N1WF 4KVDA 4KVYA 3N3LF 1UBVA 5IL8A 3PYBA 1WL0A 3OABA 3V1VA 5IK0A 4NFJF 3QKCA 3P8LA 4JXYA 1DGPA 4KFAA 4PVYF 1UBWA 3AQCB 5IKHA 4DHDA 1KIYA 2E8WA 3OYRA 4RNQA 5B0JA 3WCHA 3SDRA 3KRCA 4KPDA 5ERNA 5I1UA 2QISA 4LPHF 2F92F 5JUZF 3ZCDA 5H9DA 2RAHA 1N22A 4LZ0A 3WCFA 3TS7A 5DGNF 5DGSF 2Z7HA 3ICKA 5AELA 1HX9A 4DEMF 5KSXF 4DXJA 3N5JF 5ILKA 3ID0A 3V66A 1N24A 1ZW5A 3KRAA 3P41A 4LFVF 2Z4VA 3KBKA 4LLSA 2J1OA 3SDVA 4H5CF 3EFQA 3PYAA 5B03A 5JV0F 5AFXA 3MZVA 3LLWA 3SAEA 4KQSA 3N3DA 1KIZA 1HM4A 4NUAA 1YHLA 3LZ9A 5ILHA 5JV2F 3VJDA 2Q80A 3WCGA 2F8ZF 4L2XF 3WEHA 4F6VA 2P1CA 3WEJA 4XQRF 3WSAA 4NG6A 2ZY1A 4P0XA 3WJKA 5DZ2A
chains in the Genus database with same CATH topology
2Z50A 3WCDA 4JVJF 2I19A 3S9VA 1N1ZA 2PS5A 5E8KA 2F7MF 5JV1F 4LUUA 5B00A 4JYXA 2VF6A 1N20A 3LOMA 1RQJA 3N45F 4GP2A 4OGUA 1JFGA 4XQTF 2E93A 4KUXA 4LFGA 5AYPA 4EA0A 3N46F 1VG6A 4E9UA 1HXCA 5HN8A 2Z4YA 3KRPB 3M01A 2E8UA 5IVGA 2AELA 5ILIA 2Z52A 3W7FA 5IK9A 3WCLA 1YHKA 3KRAB 3OACB 4JZXA 2Z7IA 2AEKA 2H8OA 1V4HA 4EA1A 3LGKA 3SDUA 4LTZA 3WCEA 2OPMA 5IN8A 1YYUA 5DW7A 4DZWA 4E1EA 3DYHA 4OKMA 5B01A 4GA3A 1YHMA 4DI5A 3ACYA 2OGDA 4LA6A 4XQSF 3WCCA 2FORA 1WMWA 4NKEA 3P5RA 3KRPA 1RQIA 2E94A 2J1PA 2Q9ZA 3EZ3A 4KK2A 3M0GA 5JA0F 4LOBA 3ZMBA 4KKMA 5A0IA 1WL3A 3WJNA 5E8LA 3AQ0A 2AZJA 3OACA 4QPFA 1VG3A 2E4OA 3KB9A 3RBMA 3Q2ZA 3N5HF 3WSBA 1YV5A 3Q2QA 4RXDA 3KROA 3SDTA 1VG4A 4H5EF 4HD1A 3NF2A 3M00A 2E8TA 2OPNA 4QXSF 5ILJA 2F89F 2ZCQA 3WJOA 1EZFA 2AZLA 1UBXA 4RXEA 4JZBA 1V4IA 1HXAA 3N49F 3P8RA 4OKZA 1N21A 1V4JA 3WEFA 2Z4XA 3UCAA 5DJVF 3LGZB 1V4EA 3VJEA 2E90A 1YQ7A 4RYPA 3ICMA 5DJPF 5HN9A 2Z4WA 3ZOUA 2E8VA 3Q30A 5DJRF 4ZQ8A 1FPSA 4KVWA 3EGTA 4RXAA 2DH4A 5B0KA 4KPJA 3N0GA 5B0IA 3RYEA 4DWGA 3WEGA 1N1BA 2FTZA 4OMGA 2OA6A 4WK5A 3AQBB 5IKAA 5AHUB 5IL3A 5IM1A 4PVXF 3LG5A 5EASA 3WE9A 3TFPA 3BNYA 3B7LA 3IPIA 3VJ9A 3M02A 3RYWA 3ZMCA 5A0KA 3LEEA 1VG7A 3ASXA 2E92A 4F6XA 5ER8A 3MAVA 4EA2A 3VJCA 1YJ4A 4F62A 4MC8A 4E9ZA 2E91A 5DIQF 4KQ5A 3WC9A 2Q58A 2O1OA 4LLTA 4RXCA 3LMDA 1PS1A 4P0WA 3WCJA 4GP1A 1YYSA 5EROA 3VJBA 3M9UA 1N23A 2ZCRA 3WEKA 3KROB 3IBAA 2ONGA 2F8CF 3PDEA 5B02A 1YYTA 1WL1A 4NFKF 3LK5A 3NPKA 5C05A 3N1VF 5DGMF 5HNAA 3QQVA 4LIXA 5CG6A 3RMGA 3WCMA 2E95A 3TFNA 3CC9A 5EATA 5DHIA 3PKOA 4GAXA 2AZKA 1YYRA 4KWDA 3DYGA 2ONHA 2Z78A 4UMJA 3ACXA 3VJAA 3TC1A 3NRIA 4LPGF 3ICZA 3P5PA 3BNXA 5IK6A 4H5DF 3TFVA 5IMPA 5HN7A 2EWGA 3KRFB 4LTVA 5ILDA 2J5CA 4NFIF 4DWBA 1HM7A 4FJQA 2Z4ZA 1WY0A 3DYFA 1VG2A 5IMIA 4P0VA 3VJ8A 5ILZA 2ZEVA 2ZEUA 2E8XA 3LJIA 4LA5A 4FP4A 4OMHA 2AETA 3LDWA 2Q9YA 5DHKA 5EAUA 3ACWA 4MC0A 3WEIA 3PH7A 1JFAA 5IMNA 3WCBA 4KQUA 4JXNA 1DI1A 3N6KF 3APZA 4N9UA 3KRFA 3V1XA 5B0MA 4NKFA 2F9KF 3NPRA 3Q1OA 4MC3A 3WCAA 1WKZA 1YYQA 3ADZA 3AE0A 3OABB 2ZCSA 1RTRA 2PS8A 3ICNA 2PS7A 4LFEA 5ILYA 5A0JA 3LVSA 3SDQA 3CP6A 3G4FA 3CKEA 5B0LA 2ZCOA 4LXWA 1V4KA 4K10A 3ZL6A 1WL2A 3N0FA 4N1ZF 5E8HA 5CG5A 3G4DA 4KVIA 2PS6A 4Q23A 4LZ3A 3KRCB 5ERMA 1HXGA 3LSNA 1UBYA 3S4JA 2PS4A 4LZCA 2F94F 3WCIA 3N1WF 4KVDA 4KVYA 3N3LF 1UBVA 5IL8A 3PYBA 1WL0A 3OABA 3V1VA 5IK0A 4NFJF 3QKCA 3P8LA 4JXYA 1DGPA 4KFAA 4PVYF 1UBWA 3AQCB 5IKHA 4DHDA 1KIYA 2E8WA 3OYRA 4RNQA 5B0JA 3WCHA 3SDRA 3KRCA 4KPDA 5ERNA 5I1UA 2QISA 4LPHF 2F92F 5JUZF 3ZCDA 5H9DA 2RAHA 1N22A 4LZ0A 3WCFA 3TS7A 5DGNF 5DGSF 2Z7HA 3ICKA 5AELA 1HX9A 4DEMF 5KSXF 4DXJA 3N5JF 5ILKA 3ID0A 3V66A 1N24A 1ZW5A 3KRAA 3P41A 4LFVF 2Z4VA 3KBKA 4LLSA 2J1OA 3SDVA 4H5CF 3EFQA 3PYAA 5B03A 5JV0F 5AFXA 3MZVA 3LLWA 3SAEA 4KQSA 3N3DA 1KIZA 1HM4A 4NUAA 1YHLA 3LZ9A 5ILHA 5JV2F 3VJDA 2Q80A 3WCGA 2F8ZF 4L2XF 3WEHA 4F6VA 2P1CA 3WEJA 4XQRF 3WSAA 4NG6A 2ZY1A 4P0XA 3WJKA 5DZ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z50 A;  3WCD A;  4JVJ F;  2I19 A;  3S9V A;  1N1Z A;  2PS5 A;  5E8K A;  2F7M F;  5JV1 F;  4LUU A;  5B00 A;  4JYX A;  2VF6 A;  1N20 A;  3LOM A;  1RQJ A;  3N45 F;  4GP2 A;  4OGU A;  1JFG A;  4XQT F;  2E93 A;  4KUX A;  4LFG A;  5AYP A;  4EA0 A;  3N46 F;  1VG6 A;  4E9U A;  1HXC A;  5HN8 A;  2Z4Y A;  3KRP B;  3M01 A;  2E8U A;  5IVG A;  2AEL A;  5ILI A;  2Z52 A;  3W7F A;  5IK9 A;  3WCL A;  1YHK A;  3KRA B;  3OAC B;  4JZX A;  2Z7I A;  2AEK A;  2H8O A;  1V4H A;  4EA1 A;  3LGK A;  3SDU A;  4LTZ A;  3WCE A;  2OPM A;  5IN8 A;  1YYU A;  5DW7 A;  4DZW A;  4E1E A;  3DYH A;  4OKM A;  5B01 A;  4GA3 A;  1YHM A;  4DI5 A;  3ACY A;  2OGD A;  4LA6 A;  4XQS F;  3WCC A;  2FOR A;  1WMW A;  4NKE A;  3P5R A;  3KRP A;  1RQI A;  2E94 A;  2J1P A;  2Q9Z A;  3EZ3 A;  4KK2 A;  3M0G A;  5JA0 F;  4LOB A;  3ZMB A;  4KKM A;  5A0I A;  1WL3 A;  3WJN A;  5E8L A;  3AQ0 A;  2AZJ A;  3OAC A;  4QPF A;  1VG3 A;  2E4O A;  3KB9 A;  3RBM A;  3Q2Z A;  3N5H F;  3WSB A;  1YV5 A;  3Q2Q A;  4RXD A;  3KRO A;  3SDT A;  1VG4 A;  4H5E F;  4HD1 A;  3NF2 A;  3M00 A;  2E8T A;  2OPN A;  4QXS F;  5ILJ A;  2F89 F;  2ZCQ A;  3WJO A;  1EZF A;  2AZL A;  1UBX A;  4RXE A;  4JZB A;  1V4I A;  1HXA A;  3N49 F;  3P8R A;  4OKZ A;  1N21 A;  1V4J A;  3WEF A;  2Z4X A;  3UCA A;  5DJV F;  3LGZ B;  1V4E A;  3VJE A;  2E90 A;  1YQ7 A;  4RYP A;  3ICM A;  5DJP F;  5HN9 A;  2Z4W A;  3ZOU A;  2E8V A;  3Q30 A;  5DJR F;  4ZQ8 A;  1FPS A;  4KVW A;  3EGT A;  4RXA A;  2DH4 A;  5B0K A;  4KPJ A;  3N0G A;  5B0I A;  3RYE A;  4DWG A;  3WEG A;  1N1B A;  2FTZ A;  4OMG A;  2OA6 A;  4WK5 A;  3AQB B;  5IKA A;  5AHU B;  5IL3 A;  5IM1 A;  4PVX F;  3LG5 A;  5EAS A;  3WE9 A;  3TFP A;  3BNY A;  3B7L A;  3IPI A;  3VJ9 A;  3M02 A;  3RYW A;  3ZMC A;  5A0K A;  3LEE A;  1VG7 A;  3ASX A;  2E92 A;  4F6X A;  5ER8 A;  3MAV A;  4EA2 A;  3VJC A;  1YJ4 A;  4F62 A;  4MC8 A;  4E9Z A;  2E91 A;  5DIQ F;  4KQ5 A;  3WC9 A;  2Q58 A;  2O1O A;  4LLT A;  4RXC A;  3LMD A;  1PS1 A;  4P0W A;  3WCJ A;  4GP1 A;  1YYS A;  5ERO A;  3VJB A;  3M9U A;  1N23 A;  2ZCR A;  3WEK A;  3KRO B;  3IBA A;  2ONG A;  2F8C F;  3PDE A;  5B02 A;  1YYT A;  1WL1 A;  4NFK F;  3LK5 A;  3NPK A;  5C05 A;  3N1V F;  5DGM F;  5HNA A;  3QQV A;  4LIX A;  5CG6 A;  3RMG A;  3WCM A;  2E95 A;  3TFN A;  3CC9 A;  5EAT A;  5DHI A;  3PKO A;  4GAX A;  2AZK A;  1YYR A;  4KWD A;  3DYG A;  2ONH A;  2Z78 A;  4UMJ A;  3ACX A;  3VJA A;  3TC1 A;  3NRI A;  4LPG F;  3ICZ A;  3P5P A;  3BNX A;  5IK6 A;  4H5D F;  3TFV A;  5IMP A;  5HN7 A;  2EWG A;  3KRF B;  4LTV A;  5ILD A;  2J5C A;  4NFI F;  4DWB A;  1HM7 A;  4FJQ A;  2Z4Z A;  1WY0 A;  3DYF A;  1VG2 A;  5IMI A;  4P0V A;  3VJ8 A;  5ILZ A;  2ZEV A;  2ZEU A;  2E8X A;  3LJI A;  4LA5 A;  4FP4 A;  4OMH A;  2AET A;  3LDW A;  2Q9Y A;  5DHK A;  5EAU A;  3ACW A;  4MC0 A;  3WEI A;  3PH7 A;  1JFA A;  5IMN A;  3WCB A;  4KQU A;  4JXN A;  1DI1 A;  3N6K F;  3APZ A;  4N9U A;  3KRF A;  3V1X A;  5B0M A;  4NKF A;  2F9K F;  3NPR A;  3Q1O A;  4MC3 A;  3WCA A;  1WKZ A;  1YYQ A;  3ADZ A;  3AE0 A;  3OAB B;  2ZCS A;  1RTR A;  2PS8 A;  3ICN A;  2PS7 A;  4LFE A;  5ILY A;  5A0J A;  3LVS A;  3SDQ A;  3CP6 A;  3G4F A;  3CKE A;  5B0L A;  2ZCO A;  4LXW A;  1V4K A;  4K10 A;  3ZL6 A;  1WL2 A;  3N0F A;  4N1Z F;  5E8H A;  5CG5 A;  3G4D A;  4KVI A;  2PS6 A;  4Q23 A;  4LZ3 A;  3KRC B;  5ERM A;  1HXG A;  3LSN A;  1UBY A;  3S4J A;  2PS4 A;  4LZC A;  2F94 F;  3WCI A;  3N1W F;  4KVD A;  4KVY A;  3N3L F;  1UBV A;  5IL8 A;  3PYB A;  1WL0 A;  3OAB A;  3V1V A;  5IK0 A;  4NFJ F;  3QKC A;  3P8L A;  4JXY A;  1DGP A;  4KFA A;  4PVY F;  1UBW A;  3AQC B;  5IKH A;  4DHD A;  1KIY A;  2E8W A;  3OYR A;  4RNQ A;  5B0J A;  3WCH A;  3SDR A;  3KRC A;  4KPD A;  5ERN A;  5I1U A;  2QIS A;  4LPH F;  2F92 F;  5JUZ F;  3ZCD A;  5H9D A;  2RAH A;  1N22 A;  4LZ0 A;  3WCF A;  3TS7 A;  5DGN F;  5DGS F;  2Z7H A;  3ICK A;  5AEL A;  1HX9 A;  4DEM F;  5KSX F;  4DXJ A;  3N5J F;  5ILK A;  3ID0 A;  3V66 A;  1N24 A;  1ZW5 A;  3KRA A;  3P41 A;  4LFV F;  2Z4V A;  3KBK A;  4LLS A;  2J1O A;  3SDV A;  4H5C F;  3EFQ A;  3PYA A;  5B03 A;  5JV0 F;  5AFX A;  3MZV A;  3LLW A;  3SAE A;  4KQS A;  3N3D A;  1KIZ A;  1HM4 A;  4NUA A;  1YHL A;  3LZ9 A;  5ILH A;  5JV2 F;  3VJD A;  2Q80 A;  3WCG A;  2F8Z F;  4L2X F;  3WEH A;  4F6V A;  2P1C A;  3WEJ A;  4XQR F;  3WSA A;  4NG6 A;  2ZY1 A;  4P0X A;  3WJK A;  5DZ2 A; 
#chains in the Genus database with same CATH topology
 2Z50 A;  3WCD A;  4JVJ F;  2I19 A;  3S9V A;  1N1Z A;  2PS5 A;  5E8K A;  2F7M F;  5JV1 F;  4LUU A;  5B00 A;  4JYX A;  2VF6 A;  1N20 A;  3LOM A;  1RQJ A;  3N45 F;  4GP2 A;  4OGU A;  1JFG A;  4XQT F;  2E93 A;  4KUX A;  4LFG A;  5AYP A;  4EA0 A;  3N46 F;  1VG6 A;  4E9U A;  1HXC A;  5HN8 A;  2Z4Y A;  3KRP B;  3M01 A;  2E8U A;  5IVG A;  2AEL A;  5ILI A;  2Z52 A;  3W7F A;  5IK9 A;  3WCL A;  1YHK A;  3KRA B;  3OAC B;  4JZX A;  2Z7I A;  2AEK A;  2H8O A;  1V4H A;  4EA1 A;  3LGK A;  3SDU A;  4LTZ A;  3WCE A;  2OPM A;  5IN8 A;  1YYU A;  5DW7 A;  4DZW A;  4E1E A;  3DYH A;  4OKM A;  5B01 A;  4GA3 A;  1YHM A;  4DI5 A;  3ACY A;  2OGD A;  4LA6 A;  4XQS F;  3WCC A;  2FOR A;  1WMW A;  4NKE A;  3P5R A;  3KRP A;  1RQI A;  2E94 A;  2J1P A;  2Q9Z A;  3EZ3 A;  4KK2 A;  3M0G A;  5JA0 F;  4LOB A;  3ZMB A;  4KKM A;  5A0I A;  1WL3 A;  3WJN A;  5E8L A;  3AQ0 A;  2AZJ A;  3OAC A;  4QPF A;  1VG3 A;  2E4O A;  3KB9 A;  3RBM A;  3Q2Z A;  3N5H F;  3WSB A;  1YV5 A;  3Q2Q A;  4RXD A;  3KRO A;  3SDT A;  1VG4 A;  4H5E F;  4HD1 A;  3NF2 A;  3M00 A;  2E8T A;  2OPN A;  4QXS F;  5ILJ A;  2F89 F;  2ZCQ A;  3WJO A;  1EZF A;  2AZL A;  1UBX A;  4RXE A;  4JZB A;  1V4I A;  1HXA A;  3N49 F;  3P8R A;  4OKZ A;  1N21 A;  1V4J A;  3WEF A;  2Z4X A;  3UCA A;  5DJV F;  3LGZ B;  1V4E A;  3VJE A;  2E90 A;  1YQ7 A;  4RYP A;  3ICM A;  5DJP F;  5HN9 A;  2Z4W A;  3ZOU A;  2E8V A;  3Q30 A;  5DJR F;  4ZQ8 A;  1FPS A;  4KVW A;  3EGT A;  4RXA A;  2DH4 A;  5B0K A;  4KPJ A;  3N0G A;  5B0I A;  3RYE A;  4DWG A;  3WEG A;  1N1B A;  2FTZ A;  4OMG A;  2OA6 A;  4WK5 A;  3AQB B;  5IKA A;  5AHU B;  5IL3 A;  5IM1 A;  4PVX F;  3LG5 A;  5EAS A;  3WE9 A;  3TFP A;  3BNY A;  3B7L A;  3IPI A;  3VJ9 A;  3M02 A;  3RYW A;  3ZMC A;  5A0K A;  3LEE A;  1VG7 A;  3ASX A;  2E92 A;  4F6X A;  5ER8 A;  3MAV A;  4EA2 A;  3VJC A;  1YJ4 A;  4F62 A;  4MC8 A;  4E9Z A;  2E91 A;  5DIQ F;  4KQ5 A;  3WC9 A;  2Q58 A;  2O1O A;  4LLT A;  4RXC A;  3LMD A;  1PS1 A;  4P0W A;  3WCJ A;  4GP1 A;  1YYS A;  5ERO A;  3VJB A;  3M9U A;  1N23 A;  2ZCR A;  3WEK A;  3KRO B;  3IBA A;  2ONG A;  2F8C F;  3PDE A;  5B02 A;  1YYT A;  1WL1 A;  4NFK F;  3LK5 A;  3NPK A;  5C05 A;  3N1V F;  5DGM F;  5HNA A;  3QQV A;  4LIX A;  5CG6 A;  3RMG A;  3WCM A;  2E95 A;  3TFN A;  3CC9 A;  5EAT A;  5DHI A;  3PKO A;  4GAX A;  2AZK A;  1YYR A;  4KWD A;  3DYG A;  2ONH A;  2Z78 A;  4UMJ A;  3ACX A;  3VJA A;  3TC1 A;  3NRI A;  4LPG F;  3ICZ A;  3P5P A;  3BNX A;  5IK6 A;  4H5D F;  3TFV A;  5IMP A;  5HN7 A;  2EWG A;  3KRF B;  4LTV A;  5ILD A;  2J5C A;  4NFI F;  4DWB A;  1HM7 A;  4FJQ A;  2Z4Z A;  1WY0 A;  3DYF A;  1VG2 A;  5IMI A;  4P0V A;  3VJ8 A;  5ILZ A;  2ZEV A;  2ZEU A;  2E8X A;  3LJI A;  4LA5 A;  4FP4 A;  4OMH A;  2AET A;  3LDW A;  2Q9Y A;  5DHK A;  5EAU A;  3ACW A;  4MC0 A;  3WEI A;  3PH7 A;  1JFA A;  5IMN A;  3WCB A;  4KQU A;  4JXN A;  1DI1 A;  3N6K F;  3APZ A;  4N9U A;  3KRF A;  3V1X A;  5B0M A;  4NKF A;  2F9K F;  3NPR A;  3Q1O A;  4MC3 A;  3WCA A;  1WKZ A;  1YYQ A;  3ADZ A;  3AE0 A;  3OAB B;  2ZCS A;  1RTR A;  2PS8 A;  3ICN A;  2PS7 A;  4LFE A;  5ILY A;  5A0J A;  3LVS A;  3SDQ A;  3CP6 A;  3G4F A;  3CKE A;  5B0L A;  2ZCO A;  4LXW A;  1V4K A;  4K10 A;  3ZL6 A;  1WL2 A;  3N0F A;  4N1Z F;  5E8H A;  5CG5 A;  3G4D A;  4KVI A;  2PS6 A;  4Q23 A;  4LZ3 A;  3KRC B;  5ERM A;  1HXG A;  3LSN A;  1UBY A;  3S4J A;  2PS4 A;  4LZC A;  2F94 F;  3WCI A;  3N1W F;  4KVD A;  4KVY A;  3N3L F;  1UBV A;  5IL8 A;  3PYB A;  1WL0 A;  3OAB A;  3V1V A;  5IK0 A;  4NFJ F;  3QKC A;  3P8L A;  4JXY A;  1DGP A;  4KFA A;  4PVY F;  1UBW A;  3AQC B;  5IKH A;  4DHD A;  1KIY A;  2E8W A;  3OYR A;  4RNQ A;  5B0J A;  3WCH A;  3SDR A;  3KRC A;  4KPD A;  5ERN A;  5I1U A;  2QIS A;  4LPH F;  2F92 F;  5JUZ F;  3ZCD A;  5H9D A;  2RAH A;  1N22 A;  4LZ0 A;  3WCF A;  3TS7 A;  5DGN F;  5DGS F;  2Z7H A;  3ICK A;  5AEL A;  1HX9 A;  4DEM F;  5KSX F;  4DXJ A;  3N5J F;  5ILK A;  3ID0 A;  3V66 A;  1N24 A;  1ZW5 A;  3KRA A;  3P41 A;  4LFV F;  2Z4V A;  3KBK A;  4LLS A;  2J1O A;  3SDV A;  4H5C F;  3EFQ A;  3PYA A;  5B03 A;  5JV0 F;  5AFX A;  3MZV A;  3LLW A;  3SAE A;  4KQS A;  3N3D A;  1KIZ A;  1HM4 A;  4NUA A;  1YHL A;  3LZ9 A;  5ILH A;  5JV2 F;  3VJD A;  2Q80 A;  3WCG A;  2F8Z F;  4L2X F;  3WEH A;  4F6V A;  2P1C A;  3WEJ A;  4XQR F;  3WSA A;  4NG6 A;  2ZY1 A;  4P0X A;  3WJK A;  5DZ2 A; 
#chains in the Genus database with same CATH homology
 2Z50 A;  3WCD A;  4JVJ F;  2I19 A;  3S9V A;  1N1Z A;  2PS5 A;  5E8K A;  2F7M F;  5JV1 F;  4LUU A;  5B00 A;  4JYX A;  2VF6 A;  1N20 A;  3LOM A;  1RQJ A;  3N45 F;  4GP2 A;  4OGU A;  1JFG A;  4XQT F;  2E93 A;  4KUX A;  4LFG A;  5AYP A;  4EA0 A;  3N46 F;  1VG6 A;  4E9U A;  1HXC A;  5HN8 A;  2Z4Y A;  3KRP B;  3M01 A;  2E8U A;  5IVG A;  2AEL A;  5ILI A;  2Z52 A;  3W7F A;  5IK9 A;  3WCL A;  1YHK A;  3KRA B;  3OAC B;  4JZX A;  2Z7I A;  2AEK A;  2H8O A;  1V4H A;  4EA1 A;  3LGK A;  3SDU A;  4LTZ A;  3WCE A;  2OPM A;  5IN8 A;  1YYU A;  5DW7 A;  4DZW A;  4E1E A;  3DYH A;  4OKM A;  5B01 A;  4GA3 A;  1YHM A;  4DI5 A;  3ACY A;  2OGD A;  4LA6 A;  4XQS F;  3WCC A;  2FOR A;  1WMW A;  4NKE A;  3P5R A;  3KRP A;  1RQI A;  2E94 A;  2J1P A;  2Q9Z A;  3EZ3 A;  4KK2 A;  3M0G A;  5JA0 F;  4LOB A;  3ZMB A;  4KKM A;  5A0I A;  1WL3 A;  3WJN A;  5E8L A;  3AQ0 A;  2AZJ A;  3OAC A;  4QPF A;  1VG3 A;  2E4O A;  3KB9 A;  3RBM A;  3Q2Z A;  3N5H F;  3WSB A;  1YV5 A;  3Q2Q A;  4RXD A;  3KRO A;  3SDT A;  1VG4 A;  4H5E F;  4HD1 A;  3NF2 A;  3M00 A;  2E8T A;  2OPN A;  4QXS F;  5ILJ A;  2F89 F;  2ZCQ A;  3WJO A;  1EZF A;  2AZL A;  1UBX A;  4RXE A;  4JZB A;  1V4I A;  1HXA A;  3N49 F;  3P8R A;  4OKZ A;  1N21 A;  1V4J A;  3WEF A;  2Z4X A;  3UCA A;  5DJV F;  3LGZ B;  1V4E A;  3VJE A;  2E90 A;  1YQ7 A;  4RYP A;  3ICM A;  5DJP F;  5HN9 A;  2Z4W A;  3ZOU A;  2E8V A;  3Q30 A;  5DJR F;  4ZQ8 A;  1FPS A;  4KVW A;  3EGT A;  4RXA A;  2DH4 A;  5B0K A;  4KPJ A;  3N0G A;  5B0I A;  3RYE A;  4DWG A;  3WEG A;  1N1B A;  2FTZ A;  4OMG A;  2OA6 A;  4WK5 A;  3AQB B;  5IKA A;  5AHU B;  5IL3 A;  5IM1 A;  4PVX F;  3LG5 A;  5EAS A;  3WE9 A;  3TFP A;  3BNY A;  3B7L A;  3IPI A;  3VJ9 A;  3M02 A;  3RYW A;  3ZMC A;  5A0K A;  3LEE A;  1VG7 A;  3ASX A;  2E92 A;  4F6X A;  5ER8 A;  3MAV A;  4EA2 A;  3VJC A;  1YJ4 A;  4F62 A;  4MC8 A;  4E9Z A;  2E91 A;  5DIQ F;  4KQ5 A;  3WC9 A;  2Q58 A;  2O1O A;  4LLT A;  4RXC A;  3LMD A;  1PS1 A;  4P0W A;  3WCJ A;  4GP1 A;  1YYS A;  5ERO A;  3VJB A;  3M9U A;  1N23 A;  2ZCR A;  3WEK A;  3KRO B;  3IBA A;  2ONG A;  2F8C F;  3PDE A;  5B02 A;  1YYT A;  1WL1 A;  4NFK F;  3LK5 A;  3NPK A;  5C05 A;  3N1V F;  5DGM F;  5HNA A;  3QQV A;  4LIX A;  5CG6 A;  3RMG A;  3WCM A;  2E95 A;  3TFN A;  3CC9 A;  5EAT A;  5DHI A;  3PKO A;  4GAX A;  2AZK A;  1YYR A;  4KWD A;  3DYG A;  2ONH A;  2Z78 A;  4UMJ A;  3ACX A;  3VJA A;  3TC1 A;  3NRI A;  4LPG F;  3ICZ A;  3P5P A;  3BNX A;  5IK6 A;  4H5D F;  3TFV A;  5IMP A;  5HN7 A;  2EWG A;  3KRF B;  4LTV A;  5ILD A;  2J5C A;  4NFI F;  4DWB A;  1HM7 A;  4FJQ A;  2Z4Z A;  1WY0 A;  3DYF A;  1VG2 A;  5IMI A;  4P0V A;  3VJ8 A;  5ILZ A;  2ZEV A;  2ZEU A;  2E8X A;  3LJI A;  4LA5 A;  4FP4 A;  4OMH A;  2AET A;  3LDW A;  2Q9Y A;  5DHK A;  5EAU A;  3ACW A;  4MC0 A;  3WEI A;  3PH7 A;  1JFA A;  5IMN A;  3WCB A;  4KQU A;  4JXN A;  1DI1 A;  3N6K F;  3APZ A;  4N9U A;  3KRF A;  3V1X A;  5B0M A;  4NKF A;  2F9K F;  3NPR A;  3Q1O A;  4MC3 A;  3WCA A;  1WKZ A;  1YYQ A;  3ADZ A;  3AE0 A;  3OAB B;  2ZCS A;  1RTR A;  2PS8 A;  3ICN A;  2PS7 A;  4LFE A;  5ILY A;  5A0J A;  3LVS A;  3SDQ A;  3CP6 A;  3G4F A;  3CKE A;  5B0L A;  2ZCO A;  4LXW A;  1V4K A;  4K10 A;  3ZL6 A;  1WL2 A;  3N0F A;  4N1Z F;  5E8H A;  5CG5 A;  3G4D A;  4KVI A;  2PS6 A;  4Q23 A;  4LZ3 A;  3KRC B;  5ERM A;  1HXG A;  3LSN A;  1UBY A;  3S4J A;  2PS4 A;  4LZC A;  2F94 F;  3WCI A;  3N1W F;  4KVD A;  4KVY A;  3N3L F;  1UBV A;  5IL8 A;  3PYB A;  1WL0 A;  3OAB A;  3V1V A;  5IK0 A;  4NFJ F;  3QKC A;  3P8L A;  4JXY A;  1DGP A;  4KFA A;  4PVY F;  1UBW A;  3AQC B;  5IKH A;  4DHD A;  1KIY A;  2E8W A;  3OYR A;  4RNQ A;  5B0J A;  3WCH A;  3SDR A;  3KRC A;  4KPD A;  5ERN A;  5I1U A;  2QIS A;  4LPH F;  2F92 F;  5JUZ F;  3ZCD A;  5H9D A;  2RAH A;  1N22 A;  4LZ0 A;  3WCF A;  3TS7 A;  5DGN F;  5DGS F;  2Z7H A;  3ICK A;  5AEL A;  1HX9 A;  4DEM F;  5KSX F;  4DXJ A;  3N5J F;  5ILK A;  3ID0 A;  3V66 A;  1N24 A;  1ZW5 A;  3KRA A;  3P41 A;  4LFV F;  2Z4V A;  3KBK A;  4LLS A;  2J1O A;  3SDV A;  4H5C F;  3EFQ A;  3PYA A;  5B03 A;  5JV0 F;  5AFX A;  3MZV A;  3LLW A;  3SAE A;  4KQS A;  3N3D A;  1KIZ A;  1HM4 A;  4NUA A;  1YHL A;  3LZ9 A;  5ILH A;  5JV2 F;  3VJD A;  2Q80 A;  3WCG A;  2F8Z F;  4L2X F;  3WEH A;  4F6V A;  2P1C A;  3WEJ A;  4XQR F;  3WSA A;  4NG6 A;  2ZY1 A;  4P0X A;  3WJK A;  5DZ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...