4LLSA

Crystal structure of a farnesyl diphosphate synthase from roseobacter denitrificans och 114, target efi-509393, with ipp, gspp, and calcium bound in active site
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
300
structure length
300
Chain Sequence
DLGTENLYFQSMFTQRLDAAAAAVQAHFDKVLAAFEPLPIVEAMAHATSGGKRLRGFLVLETARLHDIAAGEAIWSATAIEALHAYSLVHDDLPCMDNDDMRRGQPTVHKKWDDATAVLAGDALQTLAFELVTHPGASASAEVRADLALSLARASGAQGMVLGQALDIAAETARAPLSLDEITRLQQGKTGALIGWSAQAGARLAQADTAALKRYAQALGLAFQIADDILDVTGDSAQVGKAVGKDASAGKATFVSLLGLDAARARAMSLIDEACDSLATYGAKADTLRETARFVVRRTH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Crystal structure of a farnesyl diphosphate synthase from Roseobacter denitrificans OCh 114, target EFI-509393, with IPP, GSPP and calcium bound in active site
rcsb
source organism Roseobacter denitrificans
total genus 128
structure length 300
sequence length 300
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2013-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4llsA00
3V1VA 4H5DF 5IK9A 4KUXA 2OA6A 4FJQA 5IL8A 1HXCA 5IL3A 4RXCA 1N21A 4WK5A 3WCBA 1WKZA 5DJVF 3LDWA 2Z4WA 5B0IA 1HXGA 3VJAA 4DWBA 3VJ8A 2Z7HA 4NUAA 3M01A 5DJPF 1HXAA 5IMNA 3KROB 1HX9A 4LUUA 2E4OA 3AQ0A 4RXDA 3N49F 3UCAA 4KQ5A 3V1XA 5IVGA 3LG5A 3KRCA 1YHLA 5AFXA 3ZMBA 2AEKA 4KQSA 5B01A 4JYXA 3TC1A 3EZ3A 3S9VA 1PS1A 3ZOUA 3LOMA 4E9ZA 3ICKA 3CKEA 3OABA 3WCMA 3VJDA 4UMJA 3KRFA 1YV5A 3DYHA 4LLSA 5ERMA 3WCCA 5JV1F 1YYSA 3SDUA 2E8VA 3PYBA 3KB9A 5DGSF 2FTZA 3N5JF 4LOBA 4HD1A 2PS7A 3Q2QA 3WEIA 3OYRA 4OKZA 2J5CA 4P0XA 3P5PA 5IK0A 1JFGA 2AZLA 2E8WA 2F9KF 3EGTA 1RQIA 4LLTA 5EATA 1YHMA 3KBKA 3WCFA 5IMIA 1FPSA 4KKMA 3ICZA 2E8UA 3PKOA 2H8OA 1WL3A 5JV0F 1N1BA 3G4DA 3SDRA 5HNAA 2E90A 3CC9A 4RNQA 3V66A 2Z4YA 4PVYF 4KVIA 2F89F 5EASA 4N9UA 4E9UA 2PS8A 4LIXA 3P8RA 5B0MA 2ZCOA 4XQSF 3RBMA 3N45F 5AYPA 2Z52A 4LTVA 4EA1A 4NKFA 4PVXF 3KRPB 3QKCA 5KSXF 1YYUA 4MC0A 3WCEA 5A0JA 3WSBA 3ZL6A 4OMGA 5DJRF 3M0GA 3KROA 2ONHA 5ILJA 3LZ9A 5DGNF 5IKAA 2Z50A 5DZ2A 3WEJA 3RYWA 3ICMA 3AE0A 4JVJF 3LMDA 4NG6A 3WEGA 5JA0F 2F7MF 3VJCA 3KRAB 2E92A 5EROA 5DHKA 3SAEA 3P5RA 1KIYA 4GP2A 5I1UA 2ZCSA 3LLWA 5IN8A 3M9UA 3N46F 4FP4A 4KQUA 3N1VF 3LEEA 5B03A 4LZCA 2VF6A 1YYRA 1UBYA 2F94F 2P1CA 4RYPA 2AZKA 3TFNA 1VG7A 3BNYA 3WCAA 3ADZA 3LGZB 3WCIA 4LFEA 2RAHA 5B0LA 1VG6A 2J1OA 3ACWA 1V4JA 3IPIA 4N1ZF 3AQCB 2E95A 4KK2A 3RMGA 2ZEUA 1DGPA 4MC8A 4P0WA 3EFQA 4NFKF 1KIZA 2PS6A 5DW7A 3OACB 2Z4ZA 3N3DA 1UBWA 1YQ7A 5E8KA 1V4KA 3Q1OA 4GA3A 4LA5A 5DHIA 4LPGF 2Z4XA 5A0IA 5HN7A 3P41A 2Z4VA 5E8HA 1EZFA 2I19A 2E93A 3WCHA 5CG5A 4GAXA 3KRPA 3VJ9A 5JUZF 3SDTA 2OPNA 5B02A 4OMHA 3VJBA 2AZJA 3ACXA 4JXNA 3M02A 3Q30A 3DYGA 4DZWA 1N23A 1N1ZA 1RTRA 5AELA 2OPMA 3SDVA 3NPRA 4P0VA 2OGDA 3Q2ZA 3LVSA 3G4FA 3LJIA 3N3LF 5DIQF 3KRAA 1V4HA 4QPFA 3WEHA 5A0KA 3RYEA 1VG3A 5IM1A 4RXAA 3NPKA 4DI5A 4JZBA 3N6KF 1YJ4A 3APZA 3ACYA 3ICNA 3WJOA 4KFAA 4NFIF 4H5CF 2Q80A 3WC9A 5ILYA 2AETA 2ZCQA 5H9DA 4OGUA 4XQRF 2F8CF 3WEFA 5ER8A 2Z7IA 3WCJA 1WL0A 1HM7A 2O1OA 3B7LA 3LSNA 3BNXA 4LTZA 1DI1A 3WSAA 4F6XA 1ZW5A 3ID0A 3PYAA 5CG6A 5B0KA 2J1PA 4LXWA 3ZCDA 2Z78A 3PDEA 4LA6A 1VG2A 4K10A 3TFVA 3WCDA 3W7FA 1N20A 4L2XF 3TS7A 4LZ3A 4EA2A 4KPDA 1RQJA 4DHDA 3AQBB 4RXEA 3WJNA 5ILKA 2PS4A 2Q9ZA 3OACA 4JXYA 3QQVA 2E8XA 4GP1A 4OKMA 5IKHA 5ILHA 3LGKA 3DYFA 4LPHF 2E94A 3WCGA 1V4EA 2PS5A 3WEKA 5HN9A 2ZEVA 4KPJA 3P8LA 3WE9A 4KVYA 3IBAA 1JFAA 1WY0A 1UBXA 2E91A 2FORA 4DWGA 5JV2F 2QISA 3ASXA 3N0FA 4LFGA 2ZCRA 3KRCB 3PH7A 5AHUB 2F92F 5IMPA 1V4IA 3VJEA 5ERNA 2ONGA 3M00A 4LZ0A 5B0JA 5ILDA 3OABB 2Q58A 2DH4A 2E8TA 3KRFB 4DEMF 1YYTA 1YYQA 1UBVA 2F8ZF 3ZMCA 4KWDA 4XQTF 3NRIA 2EWGA 5B00A 1YHKA 1WMWA 4ZQ8A 4DXJA 5E8LA 4NKEA 2ZY1A 4MC3A 4EA0A 4KVDA 3N0GA 3TFPA 2AELA 2Q9YA 4Q23A 3S4JA 1N24A 4NFJF 1HM4A 3N1WF 5EAUA 3WJKA 4KVWA 5HN8A 4E1EA 5IK6A 4F6VA 3MAVA 5ILZA 5ILIA 4F62A 1WL2A 4LFVF 3SDQA 1WL1A 3N5HF 3CP6A 3LK5A 3MZVA 4QXSF 1VG4A 3NF2A 1N22A 5DGMF 5C05A 3WCLA 4JZXA 4H5EF
chains in the Genus database with same CATH superfamily
3V1VA 4H5DF 5IK9A 4KUXA 2OA6A 4FJQA 5IL8A 1HXCA 5IL3A 4RXCA 1N21A 4WK5A 3WCBA 1WKZA 5DJVF 3LDWA 2Z4WA 5B0IA 1HXGA 3VJAA 4DWBA 3VJ8A 2Z7HA 4NUAA 3M01A 5DJPF 1HXAA 5IMNA 3KROB 1HX9A 4LUUA 2E4OA 3AQ0A 4RXDA 3N49F 3UCAA 4KQ5A 3V1XA 5IVGA 3LG5A 3KRCA 1YHLA 5AFXA 3ZMBA 2AEKA 4KQSA 5B01A 4JYXA 3TC1A 3EZ3A 3S9VA 1PS1A 3ZOUA 3LOMA 4E9ZA 3ICKA 3CKEA 3OABA 3WCMA 3VJDA 4UMJA 3KRFA 1YV5A 3DYHA 4LLSA 5ERMA 3WCCA 5JV1F 1YYSA 3SDUA 2E8VA 3PYBA 3KB9A 5DGSF 2FTZA 3N5JF 4LOBA 4HD1A 2PS7A 3Q2QA 3WEIA 3OYRA 4OKZA 2J5CA 4P0XA 3P5PA 5IK0A 1JFGA 2AZLA 2E8WA 2F9KF 3EGTA 1RQIA 4LLTA 5EATA 1YHMA 3KBKA 3WCFA 5IMIA 1FPSA 4KKMA 3ICZA 2E8UA 3PKOA 2H8OA 1WL3A 5JV0F 1N1BA 3G4DA 3SDRA 5HNAA 2E90A 3CC9A 4RNQA 3V66A 2Z4YA 4PVYF 4KVIA 2F89F 5EASA 4N9UA 4E9UA 2PS8A 4LIXA 3P8RA 5B0MA 2ZCOA 4XQSF 3RBMA 3N45F 5AYPA 2Z52A 4LTVA 4EA1A 4NKFA 4PVXF 3KRPB 3QKCA 5KSXF 1YYUA 4MC0A 3WCEA 5A0JA 3WSBA 3ZL6A 4OMGA 5DJRF 3M0GA 3KROA 2ONHA 5ILJA 3LZ9A 5DGNF 5IKAA 2Z50A 5DZ2A 3WEJA 3RYWA 3ICMA 3AE0A 4JVJF 3LMDA 4NG6A 3WEGA 5JA0F 2F7MF 3VJCA 3KRAB 2E92A 5EROA 5DHKA 3SAEA 3P5RA 1KIYA 4GP2A 5I1UA 2ZCSA 3LLWA 5IN8A 3M9UA 3N46F 4FP4A 4KQUA 3N1VF 3LEEA 5B03A 4LZCA 2VF6A 1YYRA 1UBYA 2F94F 2P1CA 4RYPA 2AZKA 3TFNA 1VG7A 3BNYA 3WCAA 3ADZA 3LGZB 3WCIA 4LFEA 2RAHA 5B0LA 1VG6A 2J1OA 3ACWA 1V4JA 3IPIA 4N1ZF 3AQCB 2E95A 4KK2A 3RMGA 2ZEUA 1DGPA 4MC8A 4P0WA 3EFQA 4NFKF 1KIZA 2PS6A 5DW7A 3OACB 2Z4ZA 3N3DA 1UBWA 1YQ7A 5E8KA 1V4KA 3Q1OA 4GA3A 4LA5A 5DHIA 4LPGF 2Z4XA 5A0IA 5HN7A 3P41A 2Z4VA 5E8HA 1EZFA 2I19A 2E93A 3WCHA 5CG5A 4GAXA 3KRPA 3VJ9A 5JUZF 3SDTA 2OPNA 5B02A 4OMHA 3VJBA 2AZJA 3ACXA 4JXNA 3M02A 3Q30A 3DYGA 4DZWA 1N23A 1N1ZA 1RTRA 5AELA 2OPMA 3SDVA 3NPRA 4P0VA 2OGDA 3Q2ZA 3LVSA 3G4FA 3LJIA 3N3LF 5DIQF 3KRAA 1V4HA 4QPFA 3WEHA 5A0KA 3RYEA 1VG3A 5IM1A 4RXAA 3NPKA 4DI5A 4JZBA 3N6KF 1YJ4A 3APZA 3ACYA 3ICNA 3WJOA 4KFAA 4NFIF 4H5CF 2Q80A 3WC9A 5ILYA 2AETA 2ZCQA 5H9DA 4OGUA 4XQRF 2F8CF 3WEFA 5ER8A 2Z7IA 3WCJA 1WL0A 1HM7A 2O1OA 3B7LA 3LSNA 3BNXA 4LTZA 1DI1A 3WSAA 4F6XA 1ZW5A 3ID0A 3PYAA 5CG6A 5B0KA 2J1PA 4LXWA 3ZCDA 2Z78A 3PDEA 4LA6A 1VG2A 4K10A 3TFVA 3WCDA 3W7FA 1N20A 4L2XF 3TS7A 4LZ3A 4EA2A 4KPDA 1RQJA 4DHDA 3AQBB 4RXEA 3WJNA 5ILKA 2PS4A 2Q9ZA 3OACA 4JXYA 3QQVA 2E8XA 4GP1A 4OKMA 5IKHA 5ILHA 3LGKA 3DYFA 4LPHF 2E94A 3WCGA 1V4EA 2PS5A 3WEKA 5HN9A 2ZEVA 4KPJA 3P8LA 3WE9A 4KVYA 3IBAA 1JFAA 1WY0A 1UBXA 2E91A 2FORA 4DWGA 5JV2F 2QISA 3ASXA 3N0FA 4LFGA 2ZCRA 3KRCB 3PH7A 5AHUB 2F92F 5IMPA 1V4IA 3VJEA 5ERNA 2ONGA 3M00A 4LZ0A 5B0JA 5ILDA 3OABB 2Q58A 2DH4A 2E8TA 3KRFB 4DEMF 1YYTA 1YYQA 1UBVA 2F8ZF 3ZMCA 4KWDA 4XQTF 3NRIA 2EWGA 5B00A 1YHKA 1WMWA 4ZQ8A 4DXJA 5E8LA 4NKEA 2ZY1A 4MC3A 4EA0A 4KVDA 3N0GA 3TFPA 2AELA 2Q9YA 4Q23A 3S4JA 1N24A 4NFJF 1HM4A 3N1WF 5EAUA 3WJKA 4KVWA 5HN8A 4E1EA 5IK6A 4F6VA 3MAVA 5ILZA 5ILIA 4F62A 1WL2A 4LFVF 3SDQA 1WL1A 3N5HF 3CP6A 3LK5A 3MZVA 4QXSF 1VG4A 3NF2A 1N22A 5DGMF 5C05A 3WCLA 4JZXA 4H5EF
chains in the Genus database with same CATH topology
3V1VA 4H5DF 5IK9A 4KUXA 2OA6A 4FJQA 5IL8A 1HXCA 5IL3A 4RXCA 1N21A 4WK5A 3WCBA 1WKZA 5DJVF 3LDWA 2Z4WA 5B0IA 1HXGA 3VJAA 4DWBA 3VJ8A 2Z7HA 4NUAA 3M01A 5DJPF 1HXAA 5IMNA 3KROB 1HX9A 4LUUA 2E4OA 3AQ0A 4RXDA 3N49F 3UCAA 4KQ5A 3V1XA 5IVGA 3LG5A 3KRCA 1YHLA 5AFXA 3ZMBA 2AEKA 4KQSA 5B01A 4JYXA 3TC1A 3EZ3A 3S9VA 1PS1A 3ZOUA 3LOMA 4E9ZA 3ICKA 3CKEA 3OABA 3WCMA 3VJDA 4UMJA 3KRFA 1YV5A 3DYHA 4LLSA 5ERMA 3WCCA 5JV1F 1YYSA 3SDUA 2E8VA 3PYBA 3KB9A 5DGSF 2FTZA 3N5JF 4LOBA 4HD1A 2PS7A 3Q2QA 3WEIA 3OYRA 4OKZA 2J5CA 4P0XA 3P5PA 5IK0A 1JFGA 2AZLA 2E8WA 2F9KF 3EGTA 1RQIA 4LLTA 5EATA 1YHMA 3KBKA 3WCFA 5IMIA 1FPSA 4KKMA 3ICZA 2E8UA 3PKOA 2H8OA 1WL3A 5JV0F 1N1BA 3G4DA 3SDRA 5HNAA 2E90A 3CC9A 4RNQA 3V66A 2Z4YA 4PVYF 4KVIA 2F89F 5EASA 4N9UA 4E9UA 2PS8A 4LIXA 3P8RA 5B0MA 2ZCOA 4XQSF 3RBMA 3N45F 5AYPA 2Z52A 4LTVA 4EA1A 4NKFA 4PVXF 3KRPB 3QKCA 5KSXF 1YYUA 4MC0A 3WCEA 5A0JA 3WSBA 3ZL6A 4OMGA 5DJRF 3M0GA 3KROA 2ONHA 5ILJA 3LZ9A 5DGNF 5IKAA 2Z50A 5DZ2A 3WEJA 3RYWA 3ICMA 3AE0A 4JVJF 3LMDA 4NG6A 3WEGA 5JA0F 2F7MF 3VJCA 3KRAB 2E92A 5EROA 5DHKA 3SAEA 3P5RA 1KIYA 4GP2A 5I1UA 2ZCSA 3LLWA 5IN8A 3M9UA 3N46F 4FP4A 4KQUA 3N1VF 3LEEA 5B03A 4LZCA 2VF6A 1YYRA 1UBYA 2F94F 2P1CA 4RYPA 2AZKA 3TFNA 1VG7A 3BNYA 3WCAA 3ADZA 3LGZB 3WCIA 4LFEA 2RAHA 5B0LA 1VG6A 2J1OA 3ACWA 1V4JA 3IPIA 4N1ZF 3AQCB 2E95A 4KK2A 3RMGA 2ZEUA 1DGPA 4MC8A 4P0WA 3EFQA 4NFKF 1KIZA 2PS6A 5DW7A 3OACB 2Z4ZA 3N3DA 1UBWA 1YQ7A 5E8KA 1V4KA 3Q1OA 4GA3A 4LA5A 5DHIA 4LPGF 2Z4XA 5A0IA 5HN7A 3P41A 2Z4VA 5E8HA 1EZFA 2I19A 2E93A 3WCHA 5CG5A 4GAXA 3KRPA 3VJ9A 5JUZF 3SDTA 2OPNA 5B02A 4OMHA 3VJBA 2AZJA 3ACXA 4JXNA 3M02A 3Q30A 3DYGA 4DZWA 1N23A 1N1ZA 1RTRA 5AELA 2OPMA 3SDVA 3NPRA 4P0VA 2OGDA 3Q2ZA 3LVSA 3G4FA 3LJIA 3N3LF 5DIQF 3KRAA 1V4HA 4QPFA 3WEHA 5A0KA 3RYEA 1VG3A 5IM1A 4RXAA 3NPKA 4DI5A 4JZBA 3N6KF 1YJ4A 3APZA 3ACYA 3ICNA 3WJOA 4KFAA 4NFIF 4H5CF 2Q80A 3WC9A 5ILYA 2AETA 2ZCQA 5H9DA 4OGUA 4XQRF 2F8CF 3WEFA 5ER8A 2Z7IA 3WCJA 1WL0A 1HM7A 2O1OA 3B7LA 3LSNA 3BNXA 4LTZA 1DI1A 3WSAA 4F6XA 1ZW5A 3ID0A 3PYAA 5CG6A 5B0KA 2J1PA 4LXWA 3ZCDA 2Z78A 3PDEA 4LA6A 1VG2A 4K10A 3TFVA 3WCDA 3W7FA 1N20A 4L2XF 3TS7A 4LZ3A 4EA2A 4KPDA 1RQJA 4DHDA 3AQBB 4RXEA 3WJNA 5ILKA 2PS4A 2Q9ZA 3OACA 4JXYA 3QQVA 2E8XA 4GP1A 4OKMA 5IKHA 5ILHA 3LGKA 3DYFA 4LPHF 2E94A 3WCGA 1V4EA 2PS5A 3WEKA 5HN9A 2ZEVA 4KPJA 3P8LA 3WE9A 4KVYA 3IBAA 1JFAA 1WY0A 1UBXA 2E91A 2FORA 4DWGA 5JV2F 2QISA 3ASXA 3N0FA 4LFGA 2ZCRA 3KRCB 3PH7A 5AHUB 2F92F 5IMPA 1V4IA 3VJEA 5ERNA 2ONGA 3M00A 4LZ0A 5B0JA 5ILDA 3OABB 2Q58A 2DH4A 2E8TA 3KRFB 4DEMF 1YYTA 1YYQA 1UBVA 2F8ZF 3ZMCA 4KWDA 4XQTF 3NRIA 2EWGA 5B00A 1YHKA 1WMWA 4ZQ8A 4DXJA 5E8LA 4NKEA 2ZY1A 4MC3A 4EA0A 4KVDA 3N0GA 3TFPA 2AELA 2Q9YA 4Q23A 3S4JA 1N24A 4NFJF 1HM4A 3N1WF 5EAUA 3WJKA 4KVWA 5HN8A 4E1EA 5IK6A 4F6VA 3MAVA 5ILZA 5ILIA 4F62A 1WL2A 4LFVF 3SDQA 1WL1A 3N5HF 3CP6A 3LK5A 3MZVA 4QXSF 1VG4A 3NF2A 1N22A 5DGMF 5C05A 3WCLA 4JZXA 4H5EF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V1V A;  4H5D F;  5IK9 A;  4KUX A;  2OA6 A;  4FJQ A;  5IL8 A;  1HXC A;  5IL3 A;  4RXC A;  1N21 A;  4WK5 A;  3WCB A;  1WKZ A;  5DJV F;  3LDW A;  2Z4W A;  5B0I A;  1HXG A;  3VJA A;  4DWB A;  3VJ8 A;  2Z7H A;  4NUA A;  3M01 A;  5DJP F;  1HXA A;  5IMN A;  3KRO B;  1HX9 A;  4LUU A;  2E4O A;  3AQ0 A;  4RXD A;  3N49 F;  3UCA A;  4KQ5 A;  3V1X A;  5IVG A;  3LG5 A;  3KRC A;  1YHL A;  5AFX A;  3ZMB A;  2AEK A;  4KQS A;  5B01 A;  4JYX A;  3TC1 A;  3EZ3 A;  3S9V A;  1PS1 A;  3ZOU A;  3LOM A;  4E9Z A;  3ICK A;  3CKE A;  3OAB A;  3WCM A;  3VJD A;  4UMJ A;  3KRF A;  1YV5 A;  3DYH A;  4LLS A;  5ERM A;  3WCC A;  5JV1 F;  1YYS A;  3SDU A;  2E8V A;  3PYB A;  3KB9 A;  5DGS F;  2FTZ A;  3N5J F;  4LOB A;  4HD1 A;  2PS7 A;  3Q2Q A;  3WEI A;  3OYR A;  4OKZ A;  2J5C A;  4P0X A;  3P5P A;  5IK0 A;  1JFG A;  2AZL A;  2E8W A;  2F9K F;  3EGT A;  1RQI A;  4LLT A;  5EAT A;  1YHM A;  3KBK A;  3WCF A;  5IMI A;  1FPS A;  4KKM A;  3ICZ A;  2E8U A;  3PKO A;  2H8O A;  1WL3 A;  5JV0 F;  1N1B A;  3G4D A;  3SDR A;  5HNA A;  2E90 A;  3CC9 A;  4RNQ A;  3V66 A;  2Z4Y A;  4PVY F;  4KVI A;  2F89 F;  5EAS A;  4N9U A;  4E9U A;  2PS8 A;  4LIX A;  3P8R A;  5B0M A;  2ZCO A;  4XQS F;  3RBM A;  3N45 F;  5AYP A;  2Z52 A;  4LTV A;  4EA1 A;  4NKF A;  4PVX F;  3KRP B;  3QKC A;  5KSX F;  1YYU A;  4MC0 A;  3WCE A;  5A0J A;  3WSB A;  3ZL6 A;  4OMG A;  5DJR F;  3M0G A;  3KRO A;  2ONH A;  5ILJ A;  3LZ9 A;  5DGN F;  5IKA A;  2Z50 A;  5DZ2 A;  3WEJ A;  3RYW A;  3ICM A;  3AE0 A;  4JVJ F;  3LMD A;  4NG6 A;  3WEG A;  5JA0 F;  2F7M F;  3VJC A;  3KRA B;  2E92 A;  5ERO A;  5DHK A;  3SAE A;  3P5R A;  1KIY A;  4GP2 A;  5I1U A;  2ZCS A;  3LLW A;  5IN8 A;  3M9U A;  3N46 F;  4FP4 A;  4KQU A;  3N1V F;  3LEE A;  5B03 A;  4LZC A;  2VF6 A;  1YYR A;  1UBY A;  2F94 F;  2P1C A;  4RYP A;  2AZK A;  3TFN A;  1VG7 A;  3BNY A;  3WCA A;  3ADZ A;  3LGZ B;  3WCI A;  4LFE A;  2RAH A;  5B0L A;  1VG6 A;  2J1O A;  3ACW A;  1V4J A;  3IPI A;  4N1Z F;  3AQC B;  2E95 A;  4KK2 A;  3RMG A;  2ZEU A;  1DGP A;  4MC8 A;  4P0W A;  3EFQ A;  4NFK F;  1KIZ A;  2PS6 A;  5DW7 A;  3OAC B;  2Z4Z A;  3N3D A;  1UBW A;  1YQ7 A;  5E8K A;  1V4K A;  3Q1O A;  4GA3 A;  4LA5 A;  5DHI A;  4LPG F;  2Z4X A;  5A0I A;  5HN7 A;  3P41 A;  2Z4V A;  5E8H A;  1EZF A;  2I19 A;  2E93 A;  3WCH A;  5CG5 A;  4GAX A;  3KRP A;  3VJ9 A;  5JUZ F;  3SDT A;  2OPN A;  5B02 A;  4OMH A;  3VJB A;  2AZJ A;  3ACX A;  4JXN A;  3M02 A;  3Q30 A;  3DYG A;  4DZW A;  1N23 A;  1N1Z A;  1RTR A;  5AEL A;  2OPM A;  3SDV A;  3NPR A;  4P0V A;  2OGD A;  3Q2Z A;  3LVS A;  3G4F A;  3LJI A;  3N3L F;  5DIQ F;  3KRA A;  1V4H A;  4QPF A;  3WEH A;  5A0K A;  3RYE A;  1VG3 A;  5IM1 A;  4RXA A;  3NPK A;  4DI5 A;  4JZB A;  3N6K F;  1YJ4 A;  3APZ A;  3ACY A;  3ICN A;  3WJO A;  4KFA A;  4NFI F;  4H5C F;  2Q80 A;  3WC9 A;  5ILY A;  2AET A;  2ZCQ A;  5H9D A;  4OGU A;  4XQR F;  2F8C F;  3WEF A;  5ER8 A;  2Z7I A;  3WCJ A;  1WL0 A;  1HM7 A;  2O1O A;  3B7L A;  3LSN A;  3BNX A;  4LTZ A;  1DI1 A;  3WSA A;  4F6X A;  1ZW5 A;  3ID0 A;  3PYA A;  5CG6 A;  5B0K A;  2J1P A;  4LXW A;  3ZCD A;  2Z78 A;  3PDE A;  4LA6 A;  1VG2 A;  4K10 A;  3TFV A;  3WCD A;  3W7F A;  1N20 A;  4L2X F;  3TS7 A;  4LZ3 A;  4EA2 A;  4KPD A;  1RQJ A;  4DHD A;  3AQB B;  4RXE A;  3WJN A;  5ILK A;  2PS4 A;  2Q9Z A;  3OAC A;  4JXY A;  3QQV A;  2E8X A;  4GP1 A;  4OKM A;  5IKH A;  5ILH A;  3LGK A;  3DYF A;  4LPH F;  2E94 A;  3WCG A;  1V4E A;  2PS5 A;  3WEK A;  5HN9 A;  2ZEV A;  4KPJ A;  3P8L A;  3WE9 A;  4KVY A;  3IBA A;  1JFA A;  1WY0 A;  1UBX A;  2E91 A;  2FOR A;  4DWG A;  5JV2 F;  2QIS A;  3ASX A;  3N0F A;  4LFG A;  2ZCR A;  3KRC B;  3PH7 A;  5AHU B;  2F92 F;  5IMP A;  1V4I A;  3VJE A;  5ERN A;  2ONG A;  3M00 A;  4LZ0 A;  5B0J A;  5ILD A;  3OAB B;  2Q58 A;  2DH4 A;  2E8T A;  3KRF B;  4DEM F;  1YYT A;  1YYQ A;  1UBV A;  2F8Z F;  3ZMC A;  4KWD A;  4XQT F;  3NRI A;  2EWG A;  5B00 A;  1YHK A;  1WMW A;  4ZQ8 A;  4DXJ A;  5E8L A;  4NKE A;  2ZY1 A;  4MC3 A;  4EA0 A;  4KVD A;  3N0G A;  3TFP A;  2AEL A;  2Q9Y A;  4Q23 A;  3S4J A;  1N24 A;  4NFJ F;  1HM4 A;  3N1W F;  5EAU A;  3WJK A;  4KVW A;  5HN8 A;  4E1E A;  5IK6 A;  4F6V A;  3MAV A;  5ILZ A;  5ILI A;  4F62 A;  1WL2 A;  4LFV F;  3SDQ A;  1WL1 A;  3N5H F;  3CP6 A;  3LK5 A;  3MZV A;  4QXS F;  1VG4 A;  3NF2 A;  1N22 A;  5DGM F;  5C05 A;  3WCL A;  4JZX A;  4H5E F; 
#chains in the Genus database with same CATH topology
 3V1V A;  4H5D F;  5IK9 A;  4KUX A;  2OA6 A;  4FJQ A;  5IL8 A;  1HXC A;  5IL3 A;  4RXC A;  1N21 A;  4WK5 A;  3WCB A;  1WKZ A;  5DJV F;  3LDW A;  2Z4W A;  5B0I A;  1HXG A;  3VJA A;  4DWB A;  3VJ8 A;  2Z7H A;  4NUA A;  3M01 A;  5DJP F;  1HXA A;  5IMN A;  3KRO B;  1HX9 A;  4LUU A;  2E4O A;  3AQ0 A;  4RXD A;  3N49 F;  3UCA A;  4KQ5 A;  3V1X A;  5IVG A;  3LG5 A;  3KRC A;  1YHL A;  5AFX A;  3ZMB A;  2AEK A;  4KQS A;  5B01 A;  4JYX A;  3TC1 A;  3EZ3 A;  3S9V A;  1PS1 A;  3ZOU A;  3LOM A;  4E9Z A;  3ICK A;  3CKE A;  3OAB A;  3WCM A;  3VJD A;  4UMJ A;  3KRF A;  1YV5 A;  3DYH A;  4LLS A;  5ERM A;  3WCC A;  5JV1 F;  1YYS A;  3SDU A;  2E8V A;  3PYB A;  3KB9 A;  5DGS F;  2FTZ A;  3N5J F;  4LOB A;  4HD1 A;  2PS7 A;  3Q2Q A;  3WEI A;  3OYR A;  4OKZ A;  2J5C A;  4P0X A;  3P5P A;  5IK0 A;  1JFG A;  2AZL A;  2E8W A;  2F9K F;  3EGT A;  1RQI A;  4LLT A;  5EAT A;  1YHM A;  3KBK A;  3WCF A;  5IMI A;  1FPS A;  4KKM A;  3ICZ A;  2E8U A;  3PKO A;  2H8O A;  1WL3 A;  5JV0 F;  1N1B A;  3G4D A;  3SDR A;  5HNA A;  2E90 A;  3CC9 A;  4RNQ A;  3V66 A;  2Z4Y A;  4PVY F;  4KVI A;  2F89 F;  5EAS A;  4N9U A;  4E9U A;  2PS8 A;  4LIX A;  3P8R A;  5B0M A;  2ZCO A;  4XQS F;  3RBM A;  3N45 F;  5AYP A;  2Z52 A;  4LTV A;  4EA1 A;  4NKF A;  4PVX F;  3KRP B;  3QKC A;  5KSX F;  1YYU A;  4MC0 A;  3WCE A;  5A0J A;  3WSB A;  3ZL6 A;  4OMG A;  5DJR F;  3M0G A;  3KRO A;  2ONH A;  5ILJ A;  3LZ9 A;  5DGN F;  5IKA A;  2Z50 A;  5DZ2 A;  3WEJ A;  3RYW A;  3ICM A;  3AE0 A;  4JVJ F;  3LMD A;  4NG6 A;  3WEG A;  5JA0 F;  2F7M F;  3VJC A;  3KRA B;  2E92 A;  5ERO A;  5DHK A;  3SAE A;  3P5R A;  1KIY A;  4GP2 A;  5I1U A;  2ZCS A;  3LLW A;  5IN8 A;  3M9U A;  3N46 F;  4FP4 A;  4KQU A;  3N1V F;  3LEE A;  5B03 A;  4LZC A;  2VF6 A;  1YYR A;  1UBY A;  2F94 F;  2P1C A;  4RYP A;  2AZK A;  3TFN A;  1VG7 A;  3BNY A;  3WCA A;  3ADZ A;  3LGZ B;  3WCI A;  4LFE A;  2RAH A;  5B0L A;  1VG6 A;  2J1O A;  3ACW A;  1V4J A;  3IPI A;  4N1Z F;  3AQC B;  2E95 A;  4KK2 A;  3RMG A;  2ZEU A;  1DGP A;  4MC8 A;  4P0W A;  3EFQ A;  4NFK F;  1KIZ A;  2PS6 A;  5DW7 A;  3OAC B;  2Z4Z A;  3N3D A;  1UBW A;  1YQ7 A;  5E8K A;  1V4K A;  3Q1O A;  4GA3 A;  4LA5 A;  5DHI A;  4LPG F;  2Z4X A;  5A0I A;  5HN7 A;  3P41 A;  2Z4V A;  5E8H A;  1EZF A;  2I19 A;  2E93 A;  3WCH A;  5CG5 A;  4GAX A;  3KRP A;  3VJ9 A;  5JUZ F;  3SDT A;  2OPN A;  5B02 A;  4OMH A;  3VJB A;  2AZJ A;  3ACX A;  4JXN A;  3M02 A;  3Q30 A;  3DYG A;  4DZW A;  1N23 A;  1N1Z A;  1RTR A;  5AEL A;  2OPM A;  3SDV A;  3NPR A;  4P0V A;  2OGD A;  3Q2Z A;  3LVS A;  3G4F A;  3LJI A;  3N3L F;  5DIQ F;  3KRA A;  1V4H A;  4QPF A;  3WEH A;  5A0K A;  3RYE A;  1VG3 A;  5IM1 A;  4RXA A;  3NPK A;  4DI5 A;  4JZB A;  3N6K F;  1YJ4 A;  3APZ A;  3ACY A;  3ICN A;  3WJO A;  4KFA A;  4NFI F;  4H5C F;  2Q80 A;  3WC9 A;  5ILY A;  2AET A;  2ZCQ A;  5H9D A;  4OGU A;  4XQR F;  2F8C F;  3WEF A;  5ER8 A;  2Z7I A;  3WCJ A;  1WL0 A;  1HM7 A;  2O1O A;  3B7L A;  3LSN A;  3BNX A;  4LTZ A;  1DI1 A;  3WSA A;  4F6X A;  1ZW5 A;  3ID0 A;  3PYA A;  5CG6 A;  5B0K A;  2J1P A;  4LXW A;  3ZCD A;  2Z78 A;  3PDE A;  4LA6 A;  1VG2 A;  4K10 A;  3TFV A;  3WCD A;  3W7F A;  1N20 A;  4L2X F;  3TS7 A;  4LZ3 A;  4EA2 A;  4KPD A;  1RQJ A;  4DHD A;  3AQB B;  4RXE A;  3WJN A;  5ILK A;  2PS4 A;  2Q9Z A;  3OAC A;  4JXY A;  3QQV A;  2E8X A;  4GP1 A;  4OKM A;  5IKH A;  5ILH A;  3LGK A;  3DYF A;  4LPH F;  2E94 A;  3WCG A;  1V4E A;  2PS5 A;  3WEK A;  5HN9 A;  2ZEV A;  4KPJ A;  3P8L A;  3WE9 A;  4KVY A;  3IBA A;  1JFA A;  1WY0 A;  1UBX A;  2E91 A;  2FOR A;  4DWG A;  5JV2 F;  2QIS A;  3ASX A;  3N0F A;  4LFG A;  2ZCR A;  3KRC B;  3PH7 A;  5AHU B;  2F92 F;  5IMP A;  1V4I A;  3VJE A;  5ERN A;  2ONG A;  3M00 A;  4LZ0 A;  5B0J A;  5ILD A;  3OAB B;  2Q58 A;  2DH4 A;  2E8T A;  3KRF B;  4DEM F;  1YYT A;  1YYQ A;  1UBV A;  2F8Z F;  3ZMC A;  4KWD A;  4XQT F;  3NRI A;  2EWG A;  5B00 A;  1YHK A;  1WMW A;  4ZQ8 A;  4DXJ A;  5E8L A;  4NKE A;  2ZY1 A;  4MC3 A;  4EA0 A;  4KVD A;  3N0G A;  3TFP A;  2AEL A;  2Q9Y A;  4Q23 A;  3S4J A;  1N24 A;  4NFJ F;  1HM4 A;  3N1W F;  5EAU A;  3WJK A;  4KVW A;  5HN8 A;  4E1E A;  5IK6 A;  4F6V A;  3MAV A;  5ILZ A;  5ILI A;  4F62 A;  1WL2 A;  4LFV F;  3SDQ A;  1WL1 A;  3N5H F;  3CP6 A;  3LK5 A;  3MZV A;  4QXS F;  1VG4 A;  3NF2 A;  1N22 A;  5DGM F;  5C05 A;  3WCL A;  4JZX A;  4H5E F; 
#chains in the Genus database with same CATH homology
 3V1V A;  4H5D F;  5IK9 A;  4KUX A;  2OA6 A;  4FJQ A;  5IL8 A;  1HXC A;  5IL3 A;  4RXC A;  1N21 A;  4WK5 A;  3WCB A;  1WKZ A;  5DJV F;  3LDW A;  2Z4W A;  5B0I A;  1HXG A;  3VJA A;  4DWB A;  3VJ8 A;  2Z7H A;  4NUA A;  3M01 A;  5DJP F;  1HXA A;  5IMN A;  3KRO B;  1HX9 A;  4LUU A;  2E4O A;  3AQ0 A;  4RXD A;  3N49 F;  3UCA A;  4KQ5 A;  3V1X A;  5IVG A;  3LG5 A;  3KRC A;  1YHL A;  5AFX A;  3ZMB A;  2AEK A;  4KQS A;  5B01 A;  4JYX A;  3TC1 A;  3EZ3 A;  3S9V A;  1PS1 A;  3ZOU A;  3LOM A;  4E9Z A;  3ICK A;  3CKE A;  3OAB A;  3WCM A;  3VJD A;  4UMJ A;  3KRF A;  1YV5 A;  3DYH A;  4LLS A;  5ERM A;  3WCC A;  5JV1 F;  1YYS A;  3SDU A;  2E8V A;  3PYB A;  3KB9 A;  5DGS F;  2FTZ A;  3N5J F;  4LOB A;  4HD1 A;  2PS7 A;  3Q2Q A;  3WEI A;  3OYR A;  4OKZ A;  2J5C A;  4P0X A;  3P5P A;  5IK0 A;  1JFG A;  2AZL A;  2E8W A;  2F9K F;  3EGT A;  1RQI A;  4LLT A;  5EAT A;  1YHM A;  3KBK A;  3WCF A;  5IMI A;  1FPS A;  4KKM A;  3ICZ A;  2E8U A;  3PKO A;  2H8O A;  1WL3 A;  5JV0 F;  1N1B A;  3G4D A;  3SDR A;  5HNA A;  2E90 A;  3CC9 A;  4RNQ A;  3V66 A;  2Z4Y A;  4PVY F;  4KVI A;  2F89 F;  5EAS A;  4N9U A;  4E9U A;  2PS8 A;  4LIX A;  3P8R A;  5B0M A;  2ZCO A;  4XQS F;  3RBM A;  3N45 F;  5AYP A;  2Z52 A;  4LTV A;  4EA1 A;  4NKF A;  4PVX F;  3KRP B;  3QKC A;  5KSX F;  1YYU A;  4MC0 A;  3WCE A;  5A0J A;  3WSB A;  3ZL6 A;  4OMG A;  5DJR F;  3M0G A;  3KRO A;  2ONH A;  5ILJ A;  3LZ9 A;  5DGN F;  5IKA A;  2Z50 A;  5DZ2 A;  3WEJ A;  3RYW A;  3ICM A;  3AE0 A;  4JVJ F;  3LMD A;  4NG6 A;  3WEG A;  5JA0 F;  2F7M F;  3VJC A;  3KRA B;  2E92 A;  5ERO A;  5DHK A;  3SAE A;  3P5R A;  1KIY A;  4GP2 A;  5I1U A;  2ZCS A;  3LLW A;  5IN8 A;  3M9U A;  3N46 F;  4FP4 A;  4KQU A;  3N1V F;  3LEE A;  5B03 A;  4LZC A;  2VF6 A;  1YYR A;  1UBY A;  2F94 F;  2P1C A;  4RYP A;  2AZK A;  3TFN A;  1VG7 A;  3BNY A;  3WCA A;  3ADZ A;  3LGZ B;  3WCI A;  4LFE A;  2RAH A;  5B0L A;  1VG6 A;  2J1O A;  3ACW A;  1V4J A;  3IPI A;  4N1Z F;  3AQC B;  2E95 A;  4KK2 A;  3RMG A;  2ZEU A;  1DGP A;  4MC8 A;  4P0W A;  3EFQ A;  4NFK F;  1KIZ A;  2PS6 A;  5DW7 A;  3OAC B;  2Z4Z A;  3N3D A;  1UBW A;  1YQ7 A;  5E8K A;  1V4K A;  3Q1O A;  4GA3 A;  4LA5 A;  5DHI A;  4LPG F;  2Z4X A;  5A0I A;  5HN7 A;  3P41 A;  2Z4V A;  5E8H A;  1EZF A;  2I19 A;  2E93 A;  3WCH A;  5CG5 A;  4GAX A;  3KRP A;  3VJ9 A;  5JUZ F;  3SDT A;  2OPN A;  5B02 A;  4OMH A;  3VJB A;  2AZJ A;  3ACX A;  4JXN A;  3M02 A;  3Q30 A;  3DYG A;  4DZW A;  1N23 A;  1N1Z A;  1RTR A;  5AEL A;  2OPM A;  3SDV A;  3NPR A;  4P0V A;  2OGD A;  3Q2Z A;  3LVS A;  3G4F A;  3LJI A;  3N3L F;  5DIQ F;  3KRA A;  1V4H A;  4QPF A;  3WEH A;  5A0K A;  3RYE A;  1VG3 A;  5IM1 A;  4RXA A;  3NPK A;  4DI5 A;  4JZB A;  3N6K F;  1YJ4 A;  3APZ A;  3ACY A;  3ICN A;  3WJO A;  4KFA A;  4NFI F;  4H5C F;  2Q80 A;  3WC9 A;  5ILY A;  2AET A;  2ZCQ A;  5H9D A;  4OGU A;  4XQR F;  2F8C F;  3WEF A;  5ER8 A;  2Z7I A;  3WCJ A;  1WL0 A;  1HM7 A;  2O1O A;  3B7L A;  3LSN A;  3BNX A;  4LTZ A;  1DI1 A;  3WSA A;  4F6X A;  1ZW5 A;  3ID0 A;  3PYA A;  5CG6 A;  5B0K A;  2J1P A;  4LXW A;  3ZCD A;  2Z78 A;  3PDE A;  4LA6 A;  1VG2 A;  4K10 A;  3TFV A;  3WCD A;  3W7F A;  1N20 A;  4L2X F;  3TS7 A;  4LZ3 A;  4EA2 A;  4KPD A;  1RQJ A;  4DHD A;  3AQB B;  4RXE A;  3WJN A;  5ILK A;  2PS4 A;  2Q9Z A;  3OAC A;  4JXY A;  3QQV A;  2E8X A;  4GP1 A;  4OKM A;  5IKH A;  5ILH A;  3LGK A;  3DYF A;  4LPH F;  2E94 A;  3WCG A;  1V4E A;  2PS5 A;  3WEK A;  5HN9 A;  2ZEV A;  4KPJ A;  3P8L A;  3WE9 A;  4KVY A;  3IBA A;  1JFA A;  1WY0 A;  1UBX A;  2E91 A;  2FOR A;  4DWG A;  5JV2 F;  2QIS A;  3ASX A;  3N0F A;  4LFG A;  2ZCR A;  3KRC B;  3PH7 A;  5AHU B;  2F92 F;  5IMP A;  1V4I A;  3VJE A;  5ERN A;  2ONG A;  3M00 A;  4LZ0 A;  5B0J A;  5ILD A;  3OAB B;  2Q58 A;  2DH4 A;  2E8T A;  3KRF B;  4DEM F;  1YYT A;  1YYQ A;  1UBV A;  2F8Z F;  3ZMC A;  4KWD A;  4XQT F;  3NRI A;  2EWG A;  5B00 A;  1YHK A;  1WMW A;  4ZQ8 A;  4DXJ A;  5E8L A;  4NKE A;  2ZY1 A;  4MC3 A;  4EA0 A;  4KVD A;  3N0G A;  3TFP A;  2AEL A;  2Q9Y A;  4Q23 A;  3S4J A;  1N24 A;  4NFJ F;  1HM4 A;  3N1W F;  5EAU A;  3WJK A;  4KVW A;  5HN8 A;  4E1E A;  5IK6 A;  4F6V A;  3MAV A;  5ILZ A;  5ILI A;  4F62 A;  1WL2 A;  4LFV F;  3SDQ A;  1WL1 A;  3N5H F;  3CP6 A;  3LK5 A;  3MZV A;  4QXS F;  1VG4 A;  3NF2 A;  1N22 A;  5DGM F;  5C05 A;  3WCL A;  4JZX A;  4H5E F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...