2P1CA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-210
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
367
structure length
357
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl pyrophosphate synthase
publication title Structures of a potent phenylalkyl bisphosphonate inhibitor bound to farnesyl and geranylgeranyl diphosphate synthases.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 146
structure length 357
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2007-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2p1cA00
5B0IA 3WCCA 4LA5A 5IM1A 4E9ZA 3V1VA 1N21A 3TS7A 3DYHA 3WCMA 2F8CF 5DJVF 1UBYA 5EAUA 4LOBA 5JA0F 2J5CA 2Q9YA 1YJ4A 1N20A 1V4JA 4KVIA 5ILZA 3LLWA 1EZFA 1JFGA 1HXAA 1N1ZA 3SAEA 2AEKA 3SDUA 4JZXA 4P0XA 2ONHA 4LPHF 3N0GA 5DHIA 2Q80A 5ER8A 1N24A 5A0JA 5HN9A 1V4EA 3ZMCA 3PH7A 4KQ5A 4LIXA 2OPNA 4RYPA 2E94A 3N1WF 2E93A 2F92F 5IMIA 2E4OA 1YYQA 3PYAA 4OMGA 3IBAA 3M9UA 5ILHA 2PS6A 3ACXA 3N45F 3SDVA 3W7FA 4GAXA 3OYRA 4JVJF 4ZQ8A 4F6VA 3TC1A 3SDTA 4JXNA 2OA6A 3WJKA 3AQBB 1HXGA 1N1BA 1UBVA 3IPIA 3BNYA 3PDEA 4EA0A 5JUZF 4FP4A 3LVSA 1WKZA 4KQSA 4LPGF 4LFEA 2F7MF 1YYRA 1N22A 5HNAA 3AE0A 2Q58A 3LEEA 3VJDA 2AZKA 3WSAA 4KK2A 4OMHA 3WJOA 5B0KA 4L2XF 1YHMA 4GP2A 3M02A 3B7LA 4OGUA 3NPRA 3APZA 1JFAA 5IL8A 2Z7HA 1FPSA 2P1CA 1WL1A 1WL0A 2ZY1A 3KRAA 4FJQA 5E8LA 5ILJA 5CG6A 5B00A 2VF6A 3KRPA 3ICMA 3G4DA 3ICZA 4KQUA 2PS8A 4RXCA 5IKAA 4DWGA 4KWDA 3WSBA 3TFPA 5ILDA 4XQRF 3N6KF 3PKOA 3KRPB 4JYXA 5IK9A 5C05A 5JV2F 4RXAA 3N3DA 3WC9A 4LZ0A 4P0VA 4EA1A 3ACYA 5AFXA 2RAHA 3WCIA 2E95A 1RQJA 4MC8A 4LA6A 3RYEA 3N1VF 5ILYA 4F62A 2PS7A 1WY0A 4LZ3A 2ZEUA 2O1OA 3WCGA 3WCAA 1VG3A 3ZL6A 4LFVF 3RMGA 4Q23A 2QISA 3N0FA 3S9VA 1RTRA 4DI5A 3Q30A 5DZ2A 2AZLA 4NUAA 1HM7A 2ONGA 5JV0F 4LFGA 1VG6A 2Z4YA 3DYFA 5IK0A 3KROA 2E92A 3NPKA 4H5EF 1WMWA 1DI1A 4LUUA 2E8TA 3RYWA 2DH4A 3LZ9A 3ADZA 3ASXA 2OGDA 3WEKA 2E90A 1YYTA 3KROB 5IMNA 3LGZB 3N49F 3UCAA 3WE9A 3P8LA 4RNQA 4HD1A 2PS4A 2J1OA 3V1XA 4H5CF 5B0MA 2EWGA 2Q9ZA 2H8OA 1VG2A 2J1PA 3P41A 3SDQA 5ERMA 3VJEA 3WJNA 3LDWA 5JV1F 3WEHA 2PS5A 2Z4VA 4XQTF 4DWBA 4NKFA 4QPFA 3OABA 3LK5A 2E8UA 3P5PA 1V4KA 1YYSA 3EZ3A 3LGKA 3N5JF 5DHKA 1V4HA 1YV5A 5DGNF 5I1UA 3OABB 4LLTA 1ZW5A 3M00A 2OPMA 4GP1A 3VJ8A 5EROA 1N23A 1VG7A 5IN8A 1YHKA 2I19A 2Z4ZA 3RBMA 1UBXA 5DGMF 4XQSF 5DGSF 3MAVA 3WCLA 2ZEVA 3WCFA 4N1ZF 5ILIA 3WCEA 3WCDA 4KVWA 5B01A 5ILKA 5KSXF 3AQ0A 5EASA 5B03A 3KRFB 2Z78A 3TFNA 2ZCOA 1KIYA 4KPDA 5A0IA 4F6XA 3EFQA 4H5DF 3ZCDA 3PYBA 3ZOUA 3NRIA 3WCHA 3M0GA 3TFVA 3WEFA 1YYUA 3N3LF 4RXDA 4DHDA 3V66A 4DZWA 4NFKF 2AZJA 4E9UA 1WL3A 5DJPF 2AETA 3ICNA 4GA3A 3LOMA 3ZMBA 3G4FA 4PVXF 3EGTA 4JZBA 5IMPA 3WCJA 5AYPA 5IVGA 3QKCA 4KVYA 5ERNA 5H9DA 4E1EA 3VJ9A 3LSNA 3KBKA 1YQ7A 5A0KA 1HX9A 4RXEA 5DW7A 4KFAA 3WEGA 1RQIA 1KIZA 2Z7IA 3CP6A 4KVDA 4LTZA 5B0JA 4LZCA 5E8HA 4OKMA 4QXSF 5AHUB 5IK6A 3SDRA 4PVYF 4LLSA 5IL3A 5DJRF 2ZCSA 3NF2A 4NFIF 4DEMF 3ID0A 4LTVA 5HN8A 3N46F 1V4IA 4EA2A 1PS1A 4KUXA 4UMJA 4N9UA 2F89F 2ZCRA 1VG4A 3OACA 3Q1OA 5IKHA 2Z50A 3Q2ZA 3KB9A 1UBWA 2AELA 2FORA 4OKZA 5AELA 2E8XA 3WEJA 3QQVA 2Z4XA 4MC3A 3KRCA 3OACB 3ICKA 4JXYA 4WK5A 2Z52A 2F9KF 3DYGA 4MC0A 4NKEA 3P8RA 3VJCA 3ACWA 4NFJF 3N5HF 4NG6A 3M01A 1DGPA 3WCBA 3KRCB 3BNXA 3MZVA 3KRFA 4DXJA 2Z4WA 3AQCB 3VJBA 3WEIA 5E8KA 5CG5A 3S4JA 5DIQF 3CKEA 3LJIA 3VJAA 2F8ZF 4LXWA 5B02A 3LG5A 3P5RA 1HM4A 2FTZA 2E8WA 1HXCA 2ZCQA 3LMDA 5HN7A 2F94F 3Q2QA 1YHLA 4KPJA 5B0LA 4K10A 2E91A 3CC9A 3KRAB 2E8VA 1WL2A 4KKMA 4P0WA 5EATA
chains in the Genus database with same CATH superfamily
5B0IA 3WCCA 4LA5A 5IM1A 4E9ZA 3V1VA 1N21A 3TS7A 3DYHA 3WCMA 2F8CF 5DJVF 1UBYA 5EAUA 4LOBA 5JA0F 2J5CA 2Q9YA 1YJ4A 1N20A 1V4JA 4KVIA 5ILZA 3LLWA 1EZFA 1JFGA 1HXAA 1N1ZA 3SAEA 2AEKA 3SDUA 4JZXA 4P0XA 2ONHA 4LPHF 3N0GA 5DHIA 2Q80A 5ER8A 1N24A 5A0JA 5HN9A 1V4EA 3ZMCA 3PH7A 4KQ5A 4LIXA 2OPNA 4RYPA 2E94A 3N1WF 2E93A 2F92F 5IMIA 2E4OA 1YYQA 3PYAA 4OMGA 3IBAA 3M9UA 5ILHA 2PS6A 3ACXA 3N45F 3SDVA 3W7FA 4GAXA 3OYRA 4JVJF 4ZQ8A 4F6VA 3TC1A 3SDTA 4JXNA 2OA6A 3WJKA 3AQBB 1HXGA 1N1BA 1UBVA 3IPIA 3BNYA 3PDEA 4EA0A 5JUZF 4FP4A 3LVSA 1WKZA 4KQSA 4LPGF 4LFEA 2F7MF 1YYRA 1N22A 5HNAA 3AE0A 2Q58A 3LEEA 3VJDA 2AZKA 3WSAA 4KK2A 4OMHA 3WJOA 5B0KA 4L2XF 1YHMA 4GP2A 3M02A 3B7LA 4OGUA 3NPRA 3APZA 1JFAA 5IL8A 2Z7HA 1FPSA 2P1CA 1WL1A 1WL0A 2ZY1A 3KRAA 4FJQA 5E8LA 5ILJA 5CG6A 5B00A 2VF6A 3KRPA 3ICMA 3G4DA 3ICZA 4KQUA 2PS8A 4RXCA 5IKAA 4DWGA 4KWDA 3WSBA 3TFPA 5ILDA 4XQRF 3N6KF 3PKOA 3KRPB 4JYXA 5IK9A 5C05A 5JV2F 4RXAA 3N3DA 3WC9A 4LZ0A 4P0VA 4EA1A 3ACYA 5AFXA 2RAHA 3WCIA 2E95A 1RQJA 4MC8A 4LA6A 3RYEA 3N1VF 5ILYA 4F62A 2PS7A 1WY0A 4LZ3A 2ZEUA 2O1OA 3WCGA 3WCAA 1VG3A 3ZL6A 4LFVF 3RMGA 4Q23A 2QISA 3N0FA 3S9VA 1RTRA 4DI5A 3Q30A 5DZ2A 2AZLA 4NUAA 1HM7A 2ONGA 5JV0F 4LFGA 1VG6A 2Z4YA 3DYFA 5IK0A 3KROA 2E92A 3NPKA 4H5EF 1WMWA 1DI1A 4LUUA 2E8TA 3RYWA 2DH4A 3LZ9A 3ADZA 3ASXA 2OGDA 3WEKA 2E90A 1YYTA 3KROB 5IMNA 3LGZB 3N49F 3UCAA 3WE9A 3P8LA 4RNQA 4HD1A 2PS4A 2J1OA 3V1XA 4H5CF 5B0MA 2EWGA 2Q9ZA 2H8OA 1VG2A 2J1PA 3P41A 3SDQA 5ERMA 3VJEA 3WJNA 3LDWA 5JV1F 3WEHA 2PS5A 2Z4VA 4XQTF 4DWBA 4NKFA 4QPFA 3OABA 3LK5A 2E8UA 3P5PA 1V4KA 1YYSA 3EZ3A 3LGKA 3N5JF 5DHKA 1V4HA 1YV5A 5DGNF 5I1UA 3OABB 4LLTA 1ZW5A 3M00A 2OPMA 4GP1A 3VJ8A 5EROA 1N23A 1VG7A 5IN8A 1YHKA 2I19A 2Z4ZA 3RBMA 1UBXA 5DGMF 4XQSF 5DGSF 3MAVA 3WCLA 2ZEVA 3WCFA 4N1ZF 5ILIA 3WCEA 3WCDA 4KVWA 5B01A 5ILKA 5KSXF 3AQ0A 5EASA 5B03A 3KRFB 2Z78A 3TFNA 2ZCOA 1KIYA 4KPDA 5A0IA 4F6XA 3EFQA 4H5DF 3ZCDA 3PYBA 3ZOUA 3NRIA 3WCHA 3M0GA 3TFVA 3WEFA 1YYUA 3N3LF 4RXDA 4DHDA 3V66A 4DZWA 4NFKF 2AZJA 4E9UA 1WL3A 5DJPF 2AETA 3ICNA 4GA3A 3LOMA 3ZMBA 3G4FA 4PVXF 3EGTA 4JZBA 5IMPA 3WCJA 5AYPA 5IVGA 3QKCA 4KVYA 5ERNA 5H9DA 4E1EA 3VJ9A 3LSNA 3KBKA 1YQ7A 5A0KA 1HX9A 4RXEA 5DW7A 4KFAA 3WEGA 1RQIA 1KIZA 2Z7IA 3CP6A 4KVDA 4LTZA 5B0JA 4LZCA 5E8HA 4OKMA 4QXSF 5AHUB 5IK6A 3SDRA 4PVYF 4LLSA 5IL3A 5DJRF 2ZCSA 3NF2A 4NFIF 4DEMF 3ID0A 4LTVA 5HN8A 3N46F 1V4IA 4EA2A 1PS1A 4KUXA 4UMJA 4N9UA 2F89F 2ZCRA 1VG4A 3OACA 3Q1OA 5IKHA 2Z50A 3Q2ZA 3KB9A 1UBWA 2AELA 2FORA 4OKZA 5AELA 2E8XA 3WEJA 3QQVA 2Z4XA 4MC3A 3KRCA 3OACB 3ICKA 4JXYA 4WK5A 2Z52A 2F9KF 3DYGA 4MC0A 4NKEA 3P8RA 3VJCA 3ACWA 4NFJF 3N5HF 4NG6A 3M01A 1DGPA 3WCBA 3KRCB 3BNXA 3MZVA 3KRFA 4DXJA 2Z4WA 3AQCB 3VJBA 3WEIA 5E8KA 5CG5A 3S4JA 5DIQF 3CKEA 3LJIA 3VJAA 2F8ZF 4LXWA 5B02A 3LG5A 3P5RA 1HM4A 2FTZA 2E8WA 1HXCA 2ZCQA 3LMDA 5HN7A 2F94F 3Q2QA 1YHLA 4KPJA 5B0LA 4K10A 2E91A 3CC9A 3KRAB 2E8VA 1WL2A 4KKMA 4P0WA 5EATA
chains in the Genus database with same CATH topology
5B0IA 3WCCA 4LA5A 5IM1A 4E9ZA 3V1VA 1N21A 3TS7A 3DYHA 3WCMA 2F8CF 5DJVF 1UBYA 5EAUA 4LOBA 5JA0F 2J5CA 2Q9YA 1YJ4A 1N20A 1V4JA 4KVIA 5ILZA 3LLWA 1EZFA 1JFGA 1HXAA 1N1ZA 3SAEA 2AEKA 3SDUA 4JZXA 4P0XA 2ONHA 4LPHF 3N0GA 5DHIA 2Q80A 5ER8A 1N24A 5A0JA 5HN9A 1V4EA 3ZMCA 3PH7A 4KQ5A 4LIXA 2OPNA 4RYPA 2E94A 3N1WF 2E93A 2F92F 5IMIA 2E4OA 1YYQA 3PYAA 4OMGA 3IBAA 3M9UA 5ILHA 2PS6A 3ACXA 3N45F 3SDVA 3W7FA 4GAXA 3OYRA 4JVJF 4ZQ8A 4F6VA 3TC1A 3SDTA 4JXNA 2OA6A 3WJKA 3AQBB 1HXGA 1N1BA 1UBVA 3IPIA 3BNYA 3PDEA 4EA0A 5JUZF 4FP4A 3LVSA 1WKZA 4KQSA 4LPGF 4LFEA 2F7MF 1YYRA 1N22A 5HNAA 3AE0A 2Q58A 3LEEA 3VJDA 2AZKA 3WSAA 4KK2A 4OMHA 3WJOA 5B0KA 4L2XF 1YHMA 4GP2A 3M02A 3B7LA 4OGUA 3NPRA 3APZA 1JFAA 5IL8A 2Z7HA 1FPSA 2P1CA 1WL1A 1WL0A 2ZY1A 3KRAA 4FJQA 5E8LA 5ILJA 5CG6A 5B00A 2VF6A 3KRPA 3ICMA 3G4DA 3ICZA 4KQUA 2PS8A 4RXCA 5IKAA 4DWGA 4KWDA 3WSBA 3TFPA 5ILDA 4XQRF 3N6KF 3PKOA 3KRPB 4JYXA 5IK9A 5C05A 5JV2F 4RXAA 3N3DA 3WC9A 4LZ0A 4P0VA 4EA1A 3ACYA 5AFXA 2RAHA 3WCIA 2E95A 1RQJA 4MC8A 4LA6A 3RYEA 3N1VF 5ILYA 4F62A 2PS7A 1WY0A 4LZ3A 2ZEUA 2O1OA 3WCGA 3WCAA 1VG3A 3ZL6A 4LFVF 3RMGA 4Q23A 2QISA 3N0FA 3S9VA 1RTRA 4DI5A 3Q30A 5DZ2A 2AZLA 4NUAA 1HM7A 2ONGA 5JV0F 4LFGA 1VG6A 2Z4YA 3DYFA 5IK0A 3KROA 2E92A 3NPKA 4H5EF 1WMWA 1DI1A 4LUUA 2E8TA 3RYWA 2DH4A 3LZ9A 3ADZA 3ASXA 2OGDA 3WEKA 2E90A 1YYTA 3KROB 5IMNA 3LGZB 3N49F 3UCAA 3WE9A 3P8LA 4RNQA 4HD1A 2PS4A 2J1OA 3V1XA 4H5CF 5B0MA 2EWGA 2Q9ZA 2H8OA 1VG2A 2J1PA 3P41A 3SDQA 5ERMA 3VJEA 3WJNA 3LDWA 5JV1F 3WEHA 2PS5A 2Z4VA 4XQTF 4DWBA 4NKFA 4QPFA 3OABA 3LK5A 2E8UA 3P5PA 1V4KA 1YYSA 3EZ3A 3LGKA 3N5JF 5DHKA 1V4HA 1YV5A 5DGNF 5I1UA 3OABB 4LLTA 1ZW5A 3M00A 2OPMA 4GP1A 3VJ8A 5EROA 1N23A 1VG7A 5IN8A 1YHKA 2I19A 2Z4ZA 3RBMA 1UBXA 5DGMF 4XQSF 5DGSF 3MAVA 3WCLA 2ZEVA 3WCFA 4N1ZF 5ILIA 3WCEA 3WCDA 4KVWA 5B01A 5ILKA 5KSXF 3AQ0A 5EASA 5B03A 3KRFB 2Z78A 3TFNA 2ZCOA 1KIYA 4KPDA 5A0IA 4F6XA 3EFQA 4H5DF 3ZCDA 3PYBA 3ZOUA 3NRIA 3WCHA 3M0GA 3TFVA 3WEFA 1YYUA 3N3LF 4RXDA 4DHDA 3V66A 4DZWA 4NFKF 2AZJA 4E9UA 1WL3A 5DJPF 2AETA 3ICNA 4GA3A 3LOMA 3ZMBA 3G4FA 4PVXF 3EGTA 4JZBA 5IMPA 3WCJA 5AYPA 5IVGA 3QKCA 4KVYA 5ERNA 5H9DA 4E1EA 3VJ9A 3LSNA 3KBKA 1YQ7A 5A0KA 1HX9A 4RXEA 5DW7A 4KFAA 3WEGA 1RQIA 1KIZA 2Z7IA 3CP6A 4KVDA 4LTZA 5B0JA 4LZCA 5E8HA 4OKMA 4QXSF 5AHUB 5IK6A 3SDRA 4PVYF 4LLSA 5IL3A 5DJRF 2ZCSA 3NF2A 4NFIF 4DEMF 3ID0A 4LTVA 5HN8A 3N46F 1V4IA 4EA2A 1PS1A 4KUXA 4UMJA 4N9UA 2F89F 2ZCRA 1VG4A 3OACA 3Q1OA 5IKHA 2Z50A 3Q2ZA 3KB9A 1UBWA 2AELA 2FORA 4OKZA 5AELA 2E8XA 3WEJA 3QQVA 2Z4XA 4MC3A 3KRCA 3OACB 3ICKA 4JXYA 4WK5A 2Z52A 2F9KF 3DYGA 4MC0A 4NKEA 3P8RA 3VJCA 3ACWA 4NFJF 3N5HF 4NG6A 3M01A 1DGPA 3WCBA 3KRCB 3BNXA 3MZVA 3KRFA 4DXJA 2Z4WA 3AQCB 3VJBA 3WEIA 5E8KA 5CG5A 3S4JA 5DIQF 3CKEA 3LJIA 3VJAA 2F8ZF 4LXWA 5B02A 3LG5A 3P5RA 1HM4A 2FTZA 2E8WA 1HXCA 2ZCQA 3LMDA 5HN7A 2F94F 3Q2QA 1YHLA 4KPJA 5B0LA 4K10A 2E91A 3CC9A 3KRAB 2E8VA 1WL2A 4KKMA 4P0WA 5EATA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B0I A;  3WCC A;  4LA5 A;  5IM1 A;  4E9Z A;  3V1V A;  1N21 A;  3TS7 A;  3DYH A;  3WCM A;  2F8C F;  5DJV F;  1UBY A;  5EAU A;  4LOB A;  5JA0 F;  2J5C A;  2Q9Y A;  1YJ4 A;  1N20 A;  1V4J A;  4KVI A;  5ILZ A;  3LLW A;  1EZF A;  1JFG A;  1HXA A;  1N1Z A;  3SAE A;  2AEK A;  3SDU A;  4JZX A;  4P0X A;  2ONH A;  4LPH F;  3N0G A;  5DHI A;  2Q80 A;  5ER8 A;  1N24 A;  5A0J A;  5HN9 A;  1V4E A;  3ZMC A;  3PH7 A;  4KQ5 A;  4LIX A;  2OPN A;  4RYP A;  2E94 A;  3N1W F;  2E93 A;  2F92 F;  5IMI A;  2E4O A;  1YYQ A;  3PYA A;  4OMG A;  3IBA A;  3M9U A;  5ILH A;  2PS6 A;  3ACX A;  3N45 F;  3SDV A;  3W7F A;  4GAX A;  3OYR A;  4JVJ F;  4ZQ8 A;  4F6V A;  3TC1 A;  3SDT A;  4JXN A;  2OA6 A;  3WJK A;  3AQB B;  1HXG A;  1N1B A;  1UBV A;  3IPI A;  3BNY A;  3PDE A;  4EA0 A;  5JUZ F;  4FP4 A;  3LVS A;  1WKZ A;  4KQS A;  4LPG F;  4LFE A;  2F7M F;  1YYR A;  1N22 A;  5HNA A;  3AE0 A;  2Q58 A;  3LEE A;  3VJD A;  2AZK A;  3WSA A;  4KK2 A;  4OMH A;  3WJO A;  5B0K A;  4L2X F;  1YHM A;  4GP2 A;  3M02 A;  3B7L A;  4OGU A;  3NPR A;  3APZ A;  1JFA A;  5IL8 A;  2Z7H A;  1FPS A;  2P1C A;  1WL1 A;  1WL0 A;  2ZY1 A;  3KRA A;  4FJQ A;  5E8L A;  5ILJ A;  5CG6 A;  5B00 A;  2VF6 A;  3KRP A;  3ICM A;  3G4D A;  3ICZ A;  4KQU A;  2PS8 A;  4RXC A;  5IKA A;  4DWG A;  4KWD A;  3WSB A;  3TFP A;  5ILD A;  4XQR F;  3N6K F;  3PKO A;  3KRP B;  4JYX A;  5IK9 A;  5C05 A;  5JV2 F;  4RXA A;  3N3D A;  3WC9 A;  4LZ0 A;  4P0V A;  4EA1 A;  3ACY A;  5AFX A;  2RAH A;  3WCI A;  2E95 A;  1RQJ A;  4MC8 A;  4LA6 A;  3RYE A;  3N1V F;  5ILY A;  4F62 A;  2PS7 A;  1WY0 A;  4LZ3 A;  2ZEU A;  2O1O A;  3WCG A;  3WCA A;  1VG3 A;  3ZL6 A;  4LFV F;  3RMG A;  4Q23 A;  2QIS A;  3N0F A;  3S9V A;  1RTR A;  4DI5 A;  3Q30 A;  5DZ2 A;  2AZL A;  4NUA A;  1HM7 A;  2ONG A;  5JV0 F;  4LFG A;  1VG6 A;  2Z4Y A;  3DYF A;  5IK0 A;  3KRO A;  2E92 A;  3NPK A;  4H5E F;  1WMW A;  1DI1 A;  4LUU A;  2E8T A;  3RYW A;  2DH4 A;  3LZ9 A;  3ADZ A;  3ASX A;  2OGD A;  3WEK A;  2E90 A;  1YYT A;  3KRO B;  5IMN A;  3LGZ B;  3N49 F;  3UCA A;  3WE9 A;  3P8L A;  4RNQ A;  4HD1 A;  2PS4 A;  2J1O A;  3V1X A;  4H5C F;  5B0M A;  2EWG A;  2Q9Z A;  2H8O A;  1VG2 A;  2J1P A;  3P41 A;  3SDQ A;  5ERM A;  3VJE A;  3WJN A;  3LDW A;  5JV1 F;  3WEH A;  2PS5 A;  2Z4V A;  4XQT F;  4DWB A;  4NKF A;  4QPF A;  3OAB A;  3LK5 A;  2E8U A;  3P5P A;  1V4K A;  1YYS A;  3EZ3 A;  3LGK A;  3N5J F;  5DHK A;  1V4H A;  1YV5 A;  5DGN F;  5I1U A;  3OAB B;  4LLT A;  1ZW5 A;  3M00 A;  2OPM A;  4GP1 A;  3VJ8 A;  5ERO A;  1N23 A;  1VG7 A;  5IN8 A;  1YHK A;  2I19 A;  2Z4Z A;  3RBM A;  1UBX A;  5DGM F;  4XQS F;  5DGS F;  3MAV A;  3WCL A;  2ZEV A;  3WCF A;  4N1Z F;  5ILI A;  3WCE A;  3WCD A;  4KVW A;  5B01 A;  5ILK A;  5KSX F;  3AQ0 A;  5EAS A;  5B03 A;  3KRF B;  2Z78 A;  3TFN A;  2ZCO A;  1KIY A;  4KPD A;  5A0I A;  4F6X A;  3EFQ A;  4H5D F;  3ZCD A;  3PYB A;  3ZOU A;  3NRI A;  3WCH A;  3M0G A;  3TFV A;  3WEF A;  1YYU A;  3N3L F;  4RXD A;  4DHD A;  3V66 A;  4DZW A;  4NFK F;  2AZJ A;  4E9U A;  1WL3 A;  5DJP F;  2AET A;  3ICN A;  4GA3 A;  3LOM A;  3ZMB A;  3G4F A;  4PVX F;  3EGT A;  4JZB A;  5IMP A;  3WCJ A;  5AYP A;  5IVG A;  3QKC A;  4KVY A;  5ERN A;  5H9D A;  4E1E A;  3VJ9 A;  3LSN A;  3KBK A;  1YQ7 A;  5A0K A;  1HX9 A;  4RXE A;  5DW7 A;  4KFA A;  3WEG A;  1RQI A;  1KIZ A;  2Z7I A;  3CP6 A;  4KVD A;  4LTZ A;  5B0J A;  4LZC A;  5E8H A;  4OKM A;  4QXS F;  5AHU B;  5IK6 A;  3SDR A;  4PVY F;  4LLS A;  5IL3 A;  5DJR F;  2ZCS A;  3NF2 A;  4NFI F;  4DEM F;  3ID0 A;  4LTV A;  5HN8 A;  3N46 F;  1V4I A;  4EA2 A;  1PS1 A;  4KUX A;  4UMJ A;  4N9U A;  2F89 F;  2ZCR A;  1VG4 A;  3OAC A;  3Q1O A;  5IKH A;  2Z50 A;  3Q2Z A;  3KB9 A;  1UBW A;  2AEL A;  2FOR A;  4OKZ A;  5AEL A;  2E8X A;  3WEJ A;  3QQV A;  2Z4X A;  4MC3 A;  3KRC A;  3OAC B;  3ICK A;  4JXY A;  4WK5 A;  2Z52 A;  2F9K F;  3DYG A;  4MC0 A;  4NKE A;  3P8R A;  3VJC A;  3ACW A;  4NFJ F;  3N5H F;  4NG6 A;  3M01 A;  1DGP A;  3WCB A;  3KRC B;  3BNX A;  3MZV A;  3KRF A;  4DXJ A;  2Z4W A;  3AQC B;  3VJB A;  3WEI A;  5E8K A;  5CG5 A;  3S4J A;  5DIQ F;  3CKE A;  3LJI A;  3VJA A;  2F8Z F;  4LXW A;  5B02 A;  3LG5 A;  3P5R A;  1HM4 A;  2FTZ A;  2E8W A;  1HXC A;  2ZCQ A;  3LMD A;  5HN7 A;  2F94 F;  3Q2Q A;  1YHL A;  4KPJ A;  5B0L A;  4K10 A;  2E91 A;  3CC9 A;  3KRA B;  2E8V A;  1WL2 A;  4KKM A;  4P0W A;  5EAT A; 
#chains in the Genus database with same CATH topology
 5B0I A;  3WCC A;  4LA5 A;  5IM1 A;  4E9Z A;  3V1V A;  1N21 A;  3TS7 A;  3DYH A;  3WCM A;  2F8C F;  5DJV F;  1UBY A;  5EAU A;  4LOB A;  5JA0 F;  2J5C A;  2Q9Y A;  1YJ4 A;  1N20 A;  1V4J A;  4KVI A;  5ILZ A;  3LLW A;  1EZF A;  1JFG A;  1HXA A;  1N1Z A;  3SAE A;  2AEK A;  3SDU A;  4JZX A;  4P0X A;  2ONH A;  4LPH F;  3N0G A;  5DHI A;  2Q80 A;  5ER8 A;  1N24 A;  5A0J A;  5HN9 A;  1V4E A;  3ZMC A;  3PH7 A;  4KQ5 A;  4LIX A;  2OPN A;  4RYP A;  2E94 A;  3N1W F;  2E93 A;  2F92 F;  5IMI A;  2E4O A;  1YYQ A;  3PYA A;  4OMG A;  3IBA A;  3M9U A;  5ILH A;  2PS6 A;  3ACX A;  3N45 F;  3SDV A;  3W7F A;  4GAX A;  3OYR A;  4JVJ F;  4ZQ8 A;  4F6V A;  3TC1 A;  3SDT A;  4JXN A;  2OA6 A;  3WJK A;  3AQB B;  1HXG A;  1N1B A;  1UBV A;  3IPI A;  3BNY A;  3PDE A;  4EA0 A;  5JUZ F;  4FP4 A;  3LVS A;  1WKZ A;  4KQS A;  4LPG F;  4LFE A;  2F7M F;  1YYR A;  1N22 A;  5HNA A;  3AE0 A;  2Q58 A;  3LEE A;  3VJD A;  2AZK A;  3WSA A;  4KK2 A;  4OMH A;  3WJO A;  5B0K A;  4L2X F;  1YHM A;  4GP2 A;  3M02 A;  3B7L A;  4OGU A;  3NPR A;  3APZ A;  1JFA A;  5IL8 A;  2Z7H A;  1FPS A;  2P1C A;  1WL1 A;  1WL0 A;  2ZY1 A;  3KRA A;  4FJQ A;  5E8L A;  5ILJ A;  5CG6 A;  5B00 A;  2VF6 A;  3KRP A;  3ICM A;  3G4D A;  3ICZ A;  4KQU A;  2PS8 A;  4RXC A;  5IKA A;  4DWG A;  4KWD A;  3WSB A;  3TFP A;  5ILD A;  4XQR F;  3N6K F;  3PKO A;  3KRP B;  4JYX A;  5IK9 A;  5C05 A;  5JV2 F;  4RXA A;  3N3D A;  3WC9 A;  4LZ0 A;  4P0V A;  4EA1 A;  3ACY A;  5AFX A;  2RAH A;  3WCI A;  2E95 A;  1RQJ A;  4MC8 A;  4LA6 A;  3RYE A;  3N1V F;  5ILY A;  4F62 A;  2PS7 A;  1WY0 A;  4LZ3 A;  2ZEU A;  2O1O A;  3WCG A;  3WCA A;  1VG3 A;  3ZL6 A;  4LFV F;  3RMG A;  4Q23 A;  2QIS A;  3N0F A;  3S9V A;  1RTR A;  4DI5 A;  3Q30 A;  5DZ2 A;  2AZL A;  4NUA A;  1HM7 A;  2ONG A;  5JV0 F;  4LFG A;  1VG6 A;  2Z4Y A;  3DYF A;  5IK0 A;  3KRO A;  2E92 A;  3NPK A;  4H5E F;  1WMW A;  1DI1 A;  4LUU A;  2E8T A;  3RYW A;  2DH4 A;  3LZ9 A;  3ADZ A;  3ASX A;  2OGD A;  3WEK A;  2E90 A;  1YYT A;  3KRO B;  5IMN A;  3LGZ B;  3N49 F;  3UCA A;  3WE9 A;  3P8L A;  4RNQ A;  4HD1 A;  2PS4 A;  2J1O A;  3V1X A;  4H5C F;  5B0M A;  2EWG A;  2Q9Z A;  2H8O A;  1VG2 A;  2J1P A;  3P41 A;  3SDQ A;  5ERM A;  3VJE A;  3WJN A;  3LDW A;  5JV1 F;  3WEH A;  2PS5 A;  2Z4V A;  4XQT F;  4DWB A;  4NKF A;  4QPF A;  3OAB A;  3LK5 A;  2E8U A;  3P5P A;  1V4K A;  1YYS A;  3EZ3 A;  3LGK A;  3N5J F;  5DHK A;  1V4H A;  1YV5 A;  5DGN F;  5I1U A;  3OAB B;  4LLT A;  1ZW5 A;  3M00 A;  2OPM A;  4GP1 A;  3VJ8 A;  5ERO A;  1N23 A;  1VG7 A;  5IN8 A;  1YHK A;  2I19 A;  2Z4Z A;  3RBM A;  1UBX A;  5DGM F;  4XQS F;  5DGS F;  3MAV A;  3WCL A;  2ZEV A;  3WCF A;  4N1Z F;  5ILI A;  3WCE A;  3WCD A;  4KVW A;  5B01 A;  5ILK A;  5KSX F;  3AQ0 A;  5EAS A;  5B03 A;  3KRF B;  2Z78 A;  3TFN A;  2ZCO A;  1KIY A;  4KPD A;  5A0I A;  4F6X A;  3EFQ A;  4H5D F;  3ZCD A;  3PYB A;  3ZOU A;  3NRI A;  3WCH A;  3M0G A;  3TFV A;  3WEF A;  1YYU A;  3N3L F;  4RXD A;  4DHD A;  3V66 A;  4DZW A;  4NFK F;  2AZJ A;  4E9U A;  1WL3 A;  5DJP F;  2AET A;  3ICN A;  4GA3 A;  3LOM A;  3ZMB A;  3G4F A;  4PVX F;  3EGT A;  4JZB A;  5IMP A;  3WCJ A;  5AYP A;  5IVG A;  3QKC A;  4KVY A;  5ERN A;  5H9D A;  4E1E A;  3VJ9 A;  3LSN A;  3KBK A;  1YQ7 A;  5A0K A;  1HX9 A;  4RXE A;  5DW7 A;  4KFA A;  3WEG A;  1RQI A;  1KIZ A;  2Z7I A;  3CP6 A;  4KVD A;  4LTZ A;  5B0J A;  4LZC A;  5E8H A;  4OKM A;  4QXS F;  5AHU B;  5IK6 A;  3SDR A;  4PVY F;  4LLS A;  5IL3 A;  5DJR F;  2ZCS A;  3NF2 A;  4NFI F;  4DEM F;  3ID0 A;  4LTV A;  5HN8 A;  3N46 F;  1V4I A;  4EA2 A;  1PS1 A;  4KUX A;  4UMJ A;  4N9U A;  2F89 F;  2ZCR A;  1VG4 A;  3OAC A;  3Q1O A;  5IKH A;  2Z50 A;  3Q2Z A;  3KB9 A;  1UBW A;  2AEL A;  2FOR A;  4OKZ A;  5AEL A;  2E8X A;  3WEJ A;  3QQV A;  2Z4X A;  4MC3 A;  3KRC A;  3OAC B;  3ICK A;  4JXY A;  4WK5 A;  2Z52 A;  2F9K F;  3DYG A;  4MC0 A;  4NKE A;  3P8R A;  3VJC A;  3ACW A;  4NFJ F;  3N5H F;  4NG6 A;  3M01 A;  1DGP A;  3WCB A;  3KRC B;  3BNX A;  3MZV A;  3KRF A;  4DXJ A;  2Z4W A;  3AQC B;  3VJB A;  3WEI A;  5E8K A;  5CG5 A;  3S4J A;  5DIQ F;  3CKE A;  3LJI A;  3VJA A;  2F8Z F;  4LXW A;  5B02 A;  3LG5 A;  3P5R A;  1HM4 A;  2FTZ A;  2E8W A;  1HXC A;  2ZCQ A;  3LMD A;  5HN7 A;  2F94 F;  3Q2Q A;  1YHL A;  4KPJ A;  5B0L A;  4K10 A;  2E91 A;  3CC9 A;  3KRA B;  2E8V A;  1WL2 A;  4KKM A;  4P0W A;  5EAT A; 
#chains in the Genus database with same CATH homology
 5B0I A;  3WCC A;  4LA5 A;  5IM1 A;  4E9Z A;  3V1V A;  1N21 A;  3TS7 A;  3DYH A;  3WCM A;  2F8C F;  5DJV F;  1UBY A;  5EAU A;  4LOB A;  5JA0 F;  2J5C A;  2Q9Y A;  1YJ4 A;  1N20 A;  1V4J A;  4KVI A;  5ILZ A;  3LLW A;  1EZF A;  1JFG A;  1HXA A;  1N1Z A;  3SAE A;  2AEK A;  3SDU A;  4JZX A;  4P0X A;  2ONH A;  4LPH F;  3N0G A;  5DHI A;  2Q80 A;  5ER8 A;  1N24 A;  5A0J A;  5HN9 A;  1V4E A;  3ZMC A;  3PH7 A;  4KQ5 A;  4LIX A;  2OPN A;  4RYP A;  2E94 A;  3N1W F;  2E93 A;  2F92 F;  5IMI A;  2E4O A;  1YYQ A;  3PYA A;  4OMG A;  3IBA A;  3M9U A;  5ILH A;  2PS6 A;  3ACX A;  3N45 F;  3SDV A;  3W7F A;  4GAX A;  3OYR A;  4JVJ F;  4ZQ8 A;  4F6V A;  3TC1 A;  3SDT A;  4JXN A;  2OA6 A;  3WJK A;  3AQB B;  1HXG A;  1N1B A;  1UBV A;  3IPI A;  3BNY A;  3PDE A;  4EA0 A;  5JUZ F;  4FP4 A;  3LVS A;  1WKZ A;  4KQS A;  4LPG F;  4LFE A;  2F7M F;  1YYR A;  1N22 A;  5HNA A;  3AE0 A;  2Q58 A;  3LEE A;  3VJD A;  2AZK A;  3WSA A;  4KK2 A;  4OMH A;  3WJO A;  5B0K A;  4L2X F;  1YHM A;  4GP2 A;  3M02 A;  3B7L A;  4OGU A;  3NPR A;  3APZ A;  1JFA A;  5IL8 A;  2Z7H A;  1FPS A;  2P1C A;  1WL1 A;  1WL0 A;  2ZY1 A;  3KRA A;  4FJQ A;  5E8L A;  5ILJ A;  5CG6 A;  5B00 A;  2VF6 A;  3KRP A;  3ICM A;  3G4D A;  3ICZ A;  4KQU A;  2PS8 A;  4RXC A;  5IKA A;  4DWG A;  4KWD A;  3WSB A;  3TFP A;  5ILD A;  4XQR F;  3N6K F;  3PKO A;  3KRP B;  4JYX A;  5IK9 A;  5C05 A;  5JV2 F;  4RXA A;  3N3D A;  3WC9 A;  4LZ0 A;  4P0V A;  4EA1 A;  3ACY A;  5AFX A;  2RAH A;  3WCI A;  2E95 A;  1RQJ A;  4MC8 A;  4LA6 A;  3RYE A;  3N1V F;  5ILY A;  4F62 A;  2PS7 A;  1WY0 A;  4LZ3 A;  2ZEU A;  2O1O A;  3WCG A;  3WCA A;  1VG3 A;  3ZL6 A;  4LFV F;  3RMG A;  4Q23 A;  2QIS A;  3N0F A;  3S9V A;  1RTR A;  4DI5 A;  3Q30 A;  5DZ2 A;  2AZL A;  4NUA A;  1HM7 A;  2ONG A;  5JV0 F;  4LFG A;  1VG6 A;  2Z4Y A;  3DYF A;  5IK0 A;  3KRO A;  2E92 A;  3NPK A;  4H5E F;  1WMW A;  1DI1 A;  4LUU A;  2E8T A;  3RYW A;  2DH4 A;  3LZ9 A;  3ADZ A;  3ASX A;  2OGD A;  3WEK A;  2E90 A;  1YYT A;  3KRO B;  5IMN A;  3LGZ B;  3N49 F;  3UCA A;  3WE9 A;  3P8L A;  4RNQ A;  4HD1 A;  2PS4 A;  2J1O A;  3V1X A;  4H5C F;  5B0M A;  2EWG A;  2Q9Z A;  2H8O A;  1VG2 A;  2J1P A;  3P41 A;  3SDQ A;  5ERM A;  3VJE A;  3WJN A;  3LDW A;  5JV1 F;  3WEH A;  2PS5 A;  2Z4V A;  4XQT F;  4DWB A;  4NKF A;  4QPF A;  3OAB A;  3LK5 A;  2E8U A;  3P5P A;  1V4K A;  1YYS A;  3EZ3 A;  3LGK A;  3N5J F;  5DHK A;  1V4H A;  1YV5 A;  5DGN F;  5I1U A;  3OAB B;  4LLT A;  1ZW5 A;  3M00 A;  2OPM A;  4GP1 A;  3VJ8 A;  5ERO A;  1N23 A;  1VG7 A;  5IN8 A;  1YHK A;  2I19 A;  2Z4Z A;  3RBM A;  1UBX A;  5DGM F;  4XQS F;  5DGS F;  3MAV A;  3WCL A;  2ZEV A;  3WCF A;  4N1Z F;  5ILI A;  3WCE A;  3WCD A;  4KVW A;  5B01 A;  5ILK A;  5KSX F;  3AQ0 A;  5EAS A;  5B03 A;  3KRF B;  2Z78 A;  3TFN A;  2ZCO A;  1KIY A;  4KPD A;  5A0I A;  4F6X A;  3EFQ A;  4H5D F;  3ZCD A;  3PYB A;  3ZOU A;  3NRI A;  3WCH A;  3M0G A;  3TFV A;  3WEF A;  1YYU A;  3N3L F;  4RXD A;  4DHD A;  3V66 A;  4DZW A;  4NFK F;  2AZJ A;  4E9U A;  1WL3 A;  5DJP F;  2AET A;  3ICN A;  4GA3 A;  3LOM A;  3ZMB A;  3G4F A;  4PVX F;  3EGT A;  4JZB A;  5IMP A;  3WCJ A;  5AYP A;  5IVG A;  3QKC A;  4KVY A;  5ERN A;  5H9D A;  4E1E A;  3VJ9 A;  3LSN A;  3KBK A;  1YQ7 A;  5A0K A;  1HX9 A;  4RXE A;  5DW7 A;  4KFA A;  3WEG A;  1RQI A;  1KIZ A;  2Z7I A;  3CP6 A;  4KVD A;  4LTZ A;  5B0J A;  4LZC A;  5E8H A;  4OKM A;  4QXS F;  5AHU B;  5IK6 A;  3SDR A;  4PVY F;  4LLS A;  5IL3 A;  5DJR F;  2ZCS A;  3NF2 A;  4NFI F;  4DEM F;  3ID0 A;  4LTV A;  5HN8 A;  3N46 F;  1V4I A;  4EA2 A;  1PS1 A;  4KUX A;  4UMJ A;  4N9U A;  2F89 F;  2ZCR A;  1VG4 A;  3OAC A;  3Q1O A;  5IKH A;  2Z50 A;  3Q2Z A;  3KB9 A;  1UBW A;  2AEL A;  2FOR A;  4OKZ A;  5AEL A;  2E8X A;  3WEJ A;  3QQV A;  2Z4X A;  4MC3 A;  3KRC A;  3OAC B;  3ICK A;  4JXY A;  4WK5 A;  2Z52 A;  2F9K F;  3DYG A;  4MC0 A;  4NKE A;  3P8R A;  3VJC A;  3ACW A;  4NFJ F;  3N5H F;  4NG6 A;  3M01 A;  1DGP A;  3WCB A;  3KRC B;  3BNX A;  3MZV A;  3KRF A;  4DXJ A;  2Z4W A;  3AQC B;  3VJB A;  3WEI A;  5E8K A;  5CG5 A;  3S4J A;  5DIQ F;  3CKE A;  3LJI A;  3VJA A;  2F8Z F;  4LXW A;  5B02 A;  3LG5 A;  3P5R A;  1HM4 A;  2FTZ A;  2E8W A;  1HXC A;  2ZCQ A;  3LMD A;  5HN7 A;  2F94 F;  3Q2Q A;  1YHL A;  4KPJ A;  5B0L A;  4K10 A;  2E91 A;  3CC9 A;  3KRA B;  2E8V A;  1WL2 A;  4KKM A;  4P0W A;  5EAT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...