2P1CA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-210
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
367
structure length
357
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Farnesyl pyrophosphate synthase
publication title Structures of a potent phenylalkyl bisphosphonate inhibitor bound to farnesyl and geranylgeranyl diphosphate synthases.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 146
structure length 357
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2007-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2p1cA00
3WCJA 3N45F 5B0LA 1FPSA 2F9KF 3OACB 3ZL6A 4JYXA 2E8VA 3Q2ZA 4KQUA 3LG5A 5EASA 3LOMA 4FJQA 1UBVA 1N24A 4OMGA 4GAXA 5B0MA 3LGKA 3WCAA 2Z52A 4LZ3A 3ZMCA 2E92A 3VJEA 5A0JA 3NRIA 5B0JA 3KROA 2AZJA 4LA6A 1WL0A 3AQCB 4GA3A 3Q2QA 3M02A 4F62A 2ONHA 3W7FA 1UBYA 4RYPA 1JFGA 3WCDA 3N5HF 1YHMA 4NKEA 3WCHA 4P0WA 4RXDA 2PS4A 5B03A 4PVXF 3RYEA 2J1OA 4LTZA 4MC8A 4XQRF 4JZBA 3MAVA 1WL2A 5IK0A 1HX9A 4EA0A 5DZ2A 3LLWA 5ILYA 4GP2A 3ASXA 2RAHA 2Z7HA 3TFNA 3WCFA 5IMPA 5EAUA 4JXNA 1DI1A 4LFGA 1UBWA 1YV5A 3NF2A 3PH7A 4KPJA 3RMGA 4WK5A 4LLTA 3G4DA 2ONGA 3EFQA 3ADZA 5A0KA 4HD1A 4KVYA 4NUAA 5JA0F 5ILHA 1HXGA 2AZKA 3B7LA 4KWDA 2ZCQA 4FP4A 4DEMF 3P5RA 3WCEA 3PKOA 1ZW5A 2E4OA 2J5CA 3G4FA 1KIYA 3OACA 4F6XA 1HM4A 3QQVA 2Z4VA 4F6VA 2EWGA 1V4HA 3IBAA 3KRAA 4JZXA 1EZFA 4LLSA 5ILDA 3WCGA 4NG6A 5DJRF 1RQJA 3OABB 2F8CF 5E8LA 4H5CF 4KQ5A 2P1CA 1N22A 2PS5A 2F92F 3VJCA 3VJBA 3LVSA 5IL8A 4LPGF 4XQSF 3SDVA 3ACXA 5DJPF 3KRAB 5KSXF 1YYTA 3NPRA 3AQBB 5DGNF 5IVGA 5IMNA 4LIXA 3SAEA 3MZVA 3WEJA 5IKAA 3QKCA 4N9UA 2AZLA 3WC9A 5IK9A 1N1BA 2E94A 1PS1A 3LK5A 1WY0A 4RXCA 1V4JA 2O1OA 4N1ZF 3N1VF 2OPNA 4KVWA 3OYRA 1WKZA 3Q30A 4QPFA 4L2XF 4QXSF 3ID0A 4OKMA 5CG6A 3KRCB 3WE9A 3BNYA 3VJ9A 2VF6A 5ILJA 5JV2F 1HM7A 3VJ8A 3N0FA 1WL1A 2E8UA 3V1VA 1N21A 2Z50A 4OKZA 4DWGA 4UMJA 4P0XA 3ZMBA 4EA2A 4LA5A 4GP1A 3KBKA 3CP6A 5IK6A 5DGMF 3PYAA 3P8RA 2ZEVA 3KRFB 3NPKA 5A0IA 4LOBA 3LGZB 3UCAA 2ZCRA 4E9UA 5B0IA 5HN7A 5HN8A 4OGUA 5ILIA 3DYFA 3N0GA 3SDTA 4P0VA 2F7MF 1V4EA 3LSNA 4LFVF 5DGSF 5ERMA 3OABA 5DIQF 1RTRA 5AYPA 3WJOA 3BNXA 1JFAA 2F8ZF 1WMWA 3CKEA 4RXEA 3ZCDA 3LJIA 5ERNA 4E1EA 1YJ4A 5AFXA 2F89F 2F94F 5IM1A 2Z4WA 1YQ7A 3N46F 3ZOUA 3LZ9A 2J1PA 2Z78A 4MC3A 2E8WA 4LUUA 3WCCA 5ILKA 2E8XA 3N49F 1YYRA 2Q58A 3ICMA 3WSBA 4LZ0A 2AEKA 5E8HA 4E9ZA 2OA6A 2OPMA 4KK2A 3AQ0A 1N1ZA 5B0KA 3WSAA 4NFIF 5IL3A 3WCLA 4K10A 1YHKA 2Z4ZA 4JVJF 1YYSA 5JUZF 3KRPA 2AELA 3LMDA 2Z4XA 3APZA 4RXAA 5H9DA 4LXWA 3S9VA 4DWBA 3ICNA 2E95A 4KUXA 3KB9A 5EATA 2ZEUA 3N1WF 4DI5A 1YYUA 1VG7A 3P8LA 5E8KA 3DYHA 2Q80A 5JV0F 3KRCA 4KPDA 5JV1F 3SDQA 3AE0A 3V66A 1V4IA 3WEKA 2FTZA 2FORA 2PS8A 2E90A 1DGPA 3KRPB 2ZCOA 4LZCA 4LFEA 2DH4A 1KIZA 3N3DA 4JXYA 4LTVA 3RBMA 3S4JA 5IN8A 4H5DF 3ACWA 5CG5A 3DYGA 4MC0A 4DXJA 3EGTA 3WJKA 1YYQA 5HNAA 3WEIA 3M00A 1V4KA 4KQSA 1YHLA 3KRFA 3TC1A 1VG4A 4OMHA 2I19A 4NKFA 3V1XA 1WL3A 4Q23A 4KFAA 2PS7A 3RYWA 4DHDA 3TFPA 2E8TA 3WEHA 2PS6A 1VG2A 2Q9YA 5I1UA 3WJNA 3KROB 4ZQ8A 2Z4YA 5DW7A 5IMIA 3WEFA 3N6KF 3N5JF 1VG3A 3TS7A 1N20A 3N3LF 3LDWA 2E91A 5DJVF 3PDEA 3SDRA 3EZ3A 3ICZA 5B00A 5EROA 4KVIA 4DZWA 3M9UA 4KVDA 3IPIA 5B02A 2E93A 4XQTF 1N23A 4NFKF 2OGDA 3WEGA 2Q9ZA 5ILZA 1RQIA 5AHUB 3VJDA 3TFVA 3Q1OA 3VJAA 4H5EF 3PYBA 5ER8A 5IKHA 2H8OA 2AETA 4NFJF 5DHIA 1VG6A 3P5PA 3ICKA 5B01A 5HN9A 3SDUA 1HXAA 3WCMA 4EA1A 2QISA 4LPHF 1UBXA 3M01A 4KKMA 5AELA 1HXCA 3WCIA 2ZCSA 3M0GA 5DHKA 5C05A 3CC9A 4RNQA 3P41A 3WCBA 3ACYA 3LEEA 4PVYF 2Z7IA 2ZY1A
chains in the Genus database with same CATH superfamily
3WCJA 3N45F 5B0LA 1FPSA 2F9KF 3OACB 3ZL6A 4JYXA 2E8VA 3Q2ZA 4KQUA 3LG5A 5EASA 3LOMA 4FJQA 1UBVA 1N24A 4OMGA 4GAXA 5B0MA 3LGKA 3WCAA 2Z52A 4LZ3A 3ZMCA 2E92A 3VJEA 5A0JA 3NRIA 5B0JA 3KROA 2AZJA 4LA6A 1WL0A 3AQCB 4GA3A 3Q2QA 3M02A 4F62A 2ONHA 3W7FA 1UBYA 4RYPA 1JFGA 3WCDA 3N5HF 1YHMA 4NKEA 3WCHA 4P0WA 4RXDA 2PS4A 5B03A 4PVXF 3RYEA 2J1OA 4LTZA 4MC8A 4XQRF 4JZBA 3MAVA 1WL2A 5IK0A 1HX9A 4EA0A 5DZ2A 3LLWA 5ILYA 4GP2A 3ASXA 2RAHA 2Z7HA 3TFNA 3WCFA 5IMPA 5EAUA 4JXNA 1DI1A 4LFGA 1UBWA 1YV5A 3NF2A 3PH7A 4KPJA 3RMGA 4WK5A 4LLTA 3G4DA 2ONGA 3EFQA 3ADZA 5A0KA 4HD1A 4KVYA 4NUAA 5JA0F 5ILHA 1HXGA 2AZKA 3B7LA 4KWDA 2ZCQA 4FP4A 4DEMF 3P5RA 3WCEA 3PKOA 1ZW5A 2E4OA 2J5CA 3G4FA 1KIYA 3OACA 4F6XA 1HM4A 3QQVA 2Z4VA 4F6VA 2EWGA 1V4HA 3IBAA 3KRAA 4JZXA 1EZFA 4LLSA 5ILDA 3WCGA 4NG6A 5DJRF 1RQJA 3OABB 2F8CF 5E8LA 4H5CF 4KQ5A 2P1CA 1N22A 2PS5A 2F92F 3VJCA 3VJBA 3LVSA 5IL8A 4LPGF 4XQSF 3SDVA 3ACXA 5DJPF 3KRAB 5KSXF 1YYTA 3NPRA 3AQBB 5DGNF 5IVGA 5IMNA 4LIXA 3SAEA 3MZVA 3WEJA 5IKAA 3QKCA 4N9UA 2AZLA 3WC9A 5IK9A 1N1BA 2E94A 1PS1A 3LK5A 1WY0A 4RXCA 1V4JA 2O1OA 4N1ZF 3N1VF 2OPNA 4KVWA 3OYRA 1WKZA 3Q30A 4QPFA 4L2XF 4QXSF 3ID0A 4OKMA 5CG6A 3KRCB 3WE9A 3BNYA 3VJ9A 2VF6A 5ILJA 5JV2F 1HM7A 3VJ8A 3N0FA 1WL1A 2E8UA 3V1VA 1N21A 2Z50A 4OKZA 4DWGA 4UMJA 4P0XA 3ZMBA 4EA2A 4LA5A 4GP1A 3KBKA 3CP6A 5IK6A 5DGMF 3PYAA 3P8RA 2ZEVA 3KRFB 3NPKA 5A0IA 4LOBA 3LGZB 3UCAA 2ZCRA 4E9UA 5B0IA 5HN7A 5HN8A 4OGUA 5ILIA 3DYFA 3N0GA 3SDTA 4P0VA 2F7MF 1V4EA 3LSNA 4LFVF 5DGSF 5ERMA 3OABA 5DIQF 1RTRA 5AYPA 3WJOA 3BNXA 1JFAA 2F8ZF 1WMWA 3CKEA 4RXEA 3ZCDA 3LJIA 5ERNA 4E1EA 1YJ4A 5AFXA 2F89F 2F94F 5IM1A 2Z4WA 1YQ7A 3N46F 3ZOUA 3LZ9A 2J1PA 2Z78A 4MC3A 2E8WA 4LUUA 3WCCA 5ILKA 2E8XA 3N49F 1YYRA 2Q58A 3ICMA 3WSBA 4LZ0A 2AEKA 5E8HA 4E9ZA 2OA6A 2OPMA 4KK2A 3AQ0A 1N1ZA 5B0KA 3WSAA 4NFIF 5IL3A 3WCLA 4K10A 1YHKA 2Z4ZA 4JVJF 1YYSA 5JUZF 3KRPA 2AELA 3LMDA 2Z4XA 3APZA 4RXAA 5H9DA 4LXWA 3S9VA 4DWBA 3ICNA 2E95A 4KUXA 3KB9A 5EATA 2ZEUA 3N1WF 4DI5A 1YYUA 1VG7A 3P8LA 5E8KA 3DYHA 2Q80A 5JV0F 3KRCA 4KPDA 5JV1F 3SDQA 3AE0A 3V66A 1V4IA 3WEKA 2FTZA 2FORA 2PS8A 2E90A 1DGPA 3KRPB 2ZCOA 4LZCA 4LFEA 2DH4A 1KIZA 3N3DA 4JXYA 4LTVA 3RBMA 3S4JA 5IN8A 4H5DF 3ACWA 5CG5A 3DYGA 4MC0A 4DXJA 3EGTA 3WJKA 1YYQA 5HNAA 3WEIA 3M00A 1V4KA 4KQSA 1YHLA 3KRFA 3TC1A 1VG4A 4OMHA 2I19A 4NKFA 3V1XA 1WL3A 4Q23A 4KFAA 2PS7A 3RYWA 4DHDA 3TFPA 2E8TA 3WEHA 2PS6A 1VG2A 2Q9YA 5I1UA 3WJNA 3KROB 4ZQ8A 2Z4YA 5DW7A 5IMIA 3WEFA 3N6KF 3N5JF 1VG3A 3TS7A 1N20A 3N3LF 3LDWA 2E91A 5DJVF 3PDEA 3SDRA 3EZ3A 3ICZA 5B00A 5EROA 4KVIA 4DZWA 3M9UA 4KVDA 3IPIA 5B02A 2E93A 4XQTF 1N23A 4NFKF 2OGDA 3WEGA 2Q9ZA 5ILZA 1RQIA 5AHUB 3VJDA 3TFVA 3Q1OA 3VJAA 4H5EF 3PYBA 5ER8A 5IKHA 2H8OA 2AETA 4NFJF 5DHIA 1VG6A 3P5PA 3ICKA 5B01A 5HN9A 3SDUA 1HXAA 3WCMA 4EA1A 2QISA 4LPHF 1UBXA 3M01A 4KKMA 5AELA 1HXCA 3WCIA 2ZCSA 3M0GA 5DHKA 5C05A 3CC9A 4RNQA 3P41A 3WCBA 3ACYA 3LEEA 4PVYF 2Z7IA 2ZY1A
chains in the Genus database with same CATH topology
3WCJA 3N45F 5B0LA 1FPSA 2F9KF 3OACB 3ZL6A 4JYXA 2E8VA 3Q2ZA 4KQUA 3LG5A 5EASA 3LOMA 4FJQA 1UBVA 1N24A 4OMGA 4GAXA 5B0MA 3LGKA 3WCAA 2Z52A 4LZ3A 3ZMCA 2E92A 3VJEA 5A0JA 3NRIA 5B0JA 3KROA 2AZJA 4LA6A 1WL0A 3AQCB 4GA3A 3Q2QA 3M02A 4F62A 2ONHA 3W7FA 1UBYA 4RYPA 1JFGA 3WCDA 3N5HF 1YHMA 4NKEA 3WCHA 4P0WA 4RXDA 2PS4A 5B03A 4PVXF 3RYEA 2J1OA 4LTZA 4MC8A 4XQRF 4JZBA 3MAVA 1WL2A 5IK0A 1HX9A 4EA0A 5DZ2A 3LLWA 5ILYA 4GP2A 3ASXA 2RAHA 2Z7HA 3TFNA 3WCFA 5IMPA 5EAUA 4JXNA 1DI1A 4LFGA 1UBWA 1YV5A 3NF2A 3PH7A 4KPJA 3RMGA 4WK5A 4LLTA 3G4DA 2ONGA 3EFQA 3ADZA 5A0KA 4HD1A 4KVYA 4NUAA 5JA0F 5ILHA 1HXGA 2AZKA 3B7LA 4KWDA 2ZCQA 4FP4A 4DEMF 3P5RA 3WCEA 3PKOA 1ZW5A 2E4OA 2J5CA 3G4FA 1KIYA 3OACA 4F6XA 1HM4A 3QQVA 2Z4VA 4F6VA 2EWGA 1V4HA 3IBAA 3KRAA 4JZXA 1EZFA 4LLSA 5ILDA 3WCGA 4NG6A 5DJRF 1RQJA 3OABB 2F8CF 5E8LA 4H5CF 4KQ5A 2P1CA 1N22A 2PS5A 2F92F 3VJCA 3VJBA 3LVSA 5IL8A 4LPGF 4XQSF 3SDVA 3ACXA 5DJPF 3KRAB 5KSXF 1YYTA 3NPRA 3AQBB 5DGNF 5IVGA 5IMNA 4LIXA 3SAEA 3MZVA 3WEJA 5IKAA 3QKCA 4N9UA 2AZLA 3WC9A 5IK9A 1N1BA 2E94A 1PS1A 3LK5A 1WY0A 4RXCA 1V4JA 2O1OA 4N1ZF 3N1VF 2OPNA 4KVWA 3OYRA 1WKZA 3Q30A 4QPFA 4L2XF 4QXSF 3ID0A 4OKMA 5CG6A 3KRCB 3WE9A 3BNYA 3VJ9A 2VF6A 5ILJA 5JV2F 1HM7A 3VJ8A 3N0FA 1WL1A 2E8UA 3V1VA 1N21A 2Z50A 4OKZA 4DWGA 4UMJA 4P0XA 3ZMBA 4EA2A 4LA5A 4GP1A 3KBKA 3CP6A 5IK6A 5DGMF 3PYAA 3P8RA 2ZEVA 3KRFB 3NPKA 5A0IA 4LOBA 3LGZB 3UCAA 2ZCRA 4E9UA 5B0IA 5HN7A 5HN8A 4OGUA 5ILIA 3DYFA 3N0GA 3SDTA 4P0VA 2F7MF 1V4EA 3LSNA 4LFVF 5DGSF 5ERMA 3OABA 5DIQF 1RTRA 5AYPA 3WJOA 3BNXA 1JFAA 2F8ZF 1WMWA 3CKEA 4RXEA 3ZCDA 3LJIA 5ERNA 4E1EA 1YJ4A 5AFXA 2F89F 2F94F 5IM1A 2Z4WA 1YQ7A 3N46F 3ZOUA 3LZ9A 2J1PA 2Z78A 4MC3A 2E8WA 4LUUA 3WCCA 5ILKA 2E8XA 3N49F 1YYRA 2Q58A 3ICMA 3WSBA 4LZ0A 2AEKA 5E8HA 4E9ZA 2OA6A 2OPMA 4KK2A 3AQ0A 1N1ZA 5B0KA 3WSAA 4NFIF 5IL3A 3WCLA 4K10A 1YHKA 2Z4ZA 4JVJF 1YYSA 5JUZF 3KRPA 2AELA 3LMDA 2Z4XA 3APZA 4RXAA 5H9DA 4LXWA 3S9VA 4DWBA 3ICNA 2E95A 4KUXA 3KB9A 5EATA 2ZEUA 3N1WF 4DI5A 1YYUA 1VG7A 3P8LA 5E8KA 3DYHA 2Q80A 5JV0F 3KRCA 4KPDA 5JV1F 3SDQA 3AE0A 3V66A 1V4IA 3WEKA 2FTZA 2FORA 2PS8A 2E90A 1DGPA 3KRPB 2ZCOA 4LZCA 4LFEA 2DH4A 1KIZA 3N3DA 4JXYA 4LTVA 3RBMA 3S4JA 5IN8A 4H5DF 3ACWA 5CG5A 3DYGA 4MC0A 4DXJA 3EGTA 3WJKA 1YYQA 5HNAA 3WEIA 3M00A 1V4KA 4KQSA 1YHLA 3KRFA 3TC1A 1VG4A 4OMHA 2I19A 4NKFA 3V1XA 1WL3A 4Q23A 4KFAA 2PS7A 3RYWA 4DHDA 3TFPA 2E8TA 3WEHA 2PS6A 1VG2A 2Q9YA 5I1UA 3WJNA 3KROB 4ZQ8A 2Z4YA 5DW7A 5IMIA 3WEFA 3N6KF 3N5JF 1VG3A 3TS7A 1N20A 3N3LF 3LDWA 2E91A 5DJVF 3PDEA 3SDRA 3EZ3A 3ICZA 5B00A 5EROA 4KVIA 4DZWA 3M9UA 4KVDA 3IPIA 5B02A 2E93A 4XQTF 1N23A 4NFKF 2OGDA 3WEGA 2Q9ZA 5ILZA 1RQIA 5AHUB 3VJDA 3TFVA 3Q1OA 3VJAA 4H5EF 3PYBA 5ER8A 5IKHA 2H8OA 2AETA 4NFJF 5DHIA 1VG6A 3P5PA 3ICKA 5B01A 5HN9A 3SDUA 1HXAA 3WCMA 4EA1A 2QISA 4LPHF 1UBXA 3M01A 4KKMA 5AELA 1HXCA 3WCIA 2ZCSA 3M0GA 5DHKA 5C05A 3CC9A 4RNQA 3P41A 3WCBA 3ACYA 3LEEA 4PVYF 2Z7IA 2ZY1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCJ A;  3N45 F;  5B0L A;  1FPS A;  2F9K F;  3OAC B;  3ZL6 A;  4JYX A;  2E8V A;  3Q2Z A;  4KQU A;  3LG5 A;  5EAS A;  3LOM A;  4FJQ A;  1UBV A;  1N24 A;  4OMG A;  4GAX A;  5B0M A;  3LGK A;  3WCA A;  2Z52 A;  4LZ3 A;  3ZMC A;  2E92 A;  3VJE A;  5A0J A;  3NRI A;  5B0J A;  3KRO A;  2AZJ A;  4LA6 A;  1WL0 A;  3AQC B;  4GA3 A;  3Q2Q A;  3M02 A;  4F62 A;  2ONH A;  3W7F A;  1UBY A;  4RYP A;  1JFG A;  3WCD A;  3N5H F;  1YHM A;  4NKE A;  3WCH A;  4P0W A;  4RXD A;  2PS4 A;  5B03 A;  4PVX F;  3RYE A;  2J1O A;  4LTZ A;  4MC8 A;  4XQR F;  4JZB A;  3MAV A;  1WL2 A;  5IK0 A;  1HX9 A;  4EA0 A;  5DZ2 A;  3LLW A;  5ILY A;  4GP2 A;  3ASX A;  2RAH A;  2Z7H A;  3TFN A;  3WCF A;  5IMP A;  5EAU A;  4JXN A;  1DI1 A;  4LFG A;  1UBW A;  1YV5 A;  3NF2 A;  3PH7 A;  4KPJ A;  3RMG A;  4WK5 A;  4LLT A;  3G4D A;  2ONG A;  3EFQ A;  3ADZ A;  5A0K A;  4HD1 A;  4KVY A;  4NUA A;  5JA0 F;  5ILH A;  1HXG A;  2AZK A;  3B7L A;  4KWD A;  2ZCQ A;  4FP4 A;  4DEM F;  3P5R A;  3WCE A;  3PKO A;  1ZW5 A;  2E4O A;  2J5C A;  3G4F A;  1KIY A;  3OAC A;  4F6X A;  1HM4 A;  3QQV A;  2Z4V A;  4F6V A;  2EWG A;  1V4H A;  3IBA A;  3KRA A;  4JZX A;  1EZF A;  4LLS A;  5ILD A;  3WCG A;  4NG6 A;  5DJR F;  1RQJ A;  3OAB B;  2F8C F;  5E8L A;  4H5C F;  4KQ5 A;  2P1C A;  1N22 A;  2PS5 A;  2F92 F;  3VJC A;  3VJB A;  3LVS A;  5IL8 A;  4LPG F;  4XQS F;  3SDV A;  3ACX A;  5DJP F;  3KRA B;  5KSX F;  1YYT A;  3NPR A;  3AQB B;  5DGN F;  5IVG A;  5IMN A;  4LIX A;  3SAE A;  3MZV A;  3WEJ A;  5IKA A;  3QKC A;  4N9U A;  2AZL A;  3WC9 A;  5IK9 A;  1N1B A;  2E94 A;  1PS1 A;  3LK5 A;  1WY0 A;  4RXC A;  1V4J A;  2O1O A;  4N1Z F;  3N1V F;  2OPN A;  4KVW A;  3OYR A;  1WKZ A;  3Q30 A;  4QPF A;  4L2X F;  4QXS F;  3ID0 A;  4OKM A;  5CG6 A;  3KRC B;  3WE9 A;  3BNY A;  3VJ9 A;  2VF6 A;  5ILJ A;  5JV2 F;  1HM7 A;  3VJ8 A;  3N0F A;  1WL1 A;  2E8U A;  3V1V A;  1N21 A;  2Z50 A;  4OKZ A;  4DWG A;  4UMJ A;  4P0X A;  3ZMB A;  4EA2 A;  4LA5 A;  4GP1 A;  3KBK A;  3CP6 A;  5IK6 A;  5DGM F;  3PYA A;  3P8R A;  2ZEV A;  3KRF B;  3NPK A;  5A0I A;  4LOB A;  3LGZ B;  3UCA A;  2ZCR A;  4E9U A;  5B0I A;  5HN7 A;  5HN8 A;  4OGU A;  5ILI A;  3DYF A;  3N0G A;  3SDT A;  4P0V A;  2F7M F;  1V4E A;  3LSN A;  4LFV F;  5DGS F;  5ERM A;  3OAB A;  5DIQ F;  1RTR A;  5AYP A;  3WJO A;  3BNX A;  1JFA A;  2F8Z F;  1WMW A;  3CKE A;  4RXE A;  3ZCD A;  3LJI A;  5ERN A;  4E1E A;  1YJ4 A;  5AFX A;  2F89 F;  2F94 F;  5IM1 A;  2Z4W A;  1YQ7 A;  3N46 F;  3ZOU A;  3LZ9 A;  2J1P A;  2Z78 A;  4MC3 A;  2E8W A;  4LUU A;  3WCC A;  5ILK A;  2E8X A;  3N49 F;  1YYR A;  2Q58 A;  3ICM A;  3WSB A;  4LZ0 A;  2AEK A;  5E8H A;  4E9Z A;  2OA6 A;  2OPM A;  4KK2 A;  3AQ0 A;  1N1Z A;  5B0K A;  3WSA A;  4NFI F;  5IL3 A;  3WCL A;  4K10 A;  1YHK A;  2Z4Z A;  4JVJ F;  1YYS A;  5JUZ F;  3KRP A;  2AEL A;  3LMD A;  2Z4X A;  3APZ A;  4RXA A;  5H9D A;  4LXW A;  3S9V A;  4DWB A;  3ICN A;  2E95 A;  4KUX A;  3KB9 A;  5EAT A;  2ZEU A;  3N1W F;  4DI5 A;  1YYU A;  1VG7 A;  3P8L A;  5E8K A;  3DYH A;  2Q80 A;  5JV0 F;  3KRC A;  4KPD A;  5JV1 F;  3SDQ A;  3AE0 A;  3V66 A;  1V4I A;  3WEK A;  2FTZ A;  2FOR A;  2PS8 A;  2E90 A;  1DGP A;  3KRP B;  2ZCO A;  4LZC A;  4LFE A;  2DH4 A;  1KIZ A;  3N3D A;  4JXY A;  4LTV A;  3RBM A;  3S4J A;  5IN8 A;  4H5D F;  3ACW A;  5CG5 A;  3DYG A;  4MC0 A;  4DXJ A;  3EGT A;  3WJK A;  1YYQ A;  5HNA A;  3WEI A;  3M00 A;  1V4K A;  4KQS A;  1YHL A;  3KRF A;  3TC1 A;  1VG4 A;  4OMH A;  2I19 A;  4NKF A;  3V1X A;  1WL3 A;  4Q23 A;  4KFA A;  2PS7 A;  3RYW A;  4DHD A;  3TFP A;  2E8T A;  3WEH A;  2PS6 A;  1VG2 A;  2Q9Y A;  5I1U A;  3WJN A;  3KRO B;  4ZQ8 A;  2Z4Y A;  5DW7 A;  5IMI A;  3WEF A;  3N6K F;  3N5J F;  1VG3 A;  3TS7 A;  1N20 A;  3N3L F;  3LDW A;  2E91 A;  5DJV F;  3PDE A;  3SDR A;  3EZ3 A;  3ICZ A;  5B00 A;  5ERO A;  4KVI A;  4DZW A;  3M9U A;  4KVD A;  3IPI A;  5B02 A;  2E93 A;  4XQT F;  1N23 A;  4NFK F;  2OGD A;  3WEG A;  2Q9Z A;  5ILZ A;  1RQI A;  5AHU B;  3VJD A;  3TFV A;  3Q1O A;  3VJA A;  4H5E F;  3PYB A;  5ER8 A;  5IKH A;  2H8O A;  2AET A;  4NFJ F;  5DHI A;  1VG6 A;  3P5P A;  3ICK A;  5B01 A;  5HN9 A;  3SDU A;  1HXA A;  3WCM A;  4EA1 A;  2QIS A;  4LPH F;  1UBX A;  3M01 A;  4KKM A;  5AEL A;  1HXC A;  3WCI A;  2ZCS A;  3M0G A;  5DHK A;  5C05 A;  3CC9 A;  4RNQ A;  3P41 A;  3WCB A;  3ACY A;  3LEE A;  4PVY F;  2Z7I A;  2ZY1 A; 
#chains in the Genus database with same CATH topology
 3WCJ A;  3N45 F;  5B0L A;  1FPS A;  2F9K F;  3OAC B;  3ZL6 A;  4JYX A;  2E8V A;  3Q2Z A;  4KQU A;  3LG5 A;  5EAS A;  3LOM A;  4FJQ A;  1UBV A;  1N24 A;  4OMG A;  4GAX A;  5B0M A;  3LGK A;  3WCA A;  2Z52 A;  4LZ3 A;  3ZMC A;  2E92 A;  3VJE A;  5A0J A;  3NRI A;  5B0J A;  3KRO A;  2AZJ A;  4LA6 A;  1WL0 A;  3AQC B;  4GA3 A;  3Q2Q A;  3M02 A;  4F62 A;  2ONH A;  3W7F A;  1UBY A;  4RYP A;  1JFG A;  3WCD A;  3N5H F;  1YHM A;  4NKE A;  3WCH A;  4P0W A;  4RXD A;  2PS4 A;  5B03 A;  4PVX F;  3RYE A;  2J1O A;  4LTZ A;  4MC8 A;  4XQR F;  4JZB A;  3MAV A;  1WL2 A;  5IK0 A;  1HX9 A;  4EA0 A;  5DZ2 A;  3LLW A;  5ILY A;  4GP2 A;  3ASX A;  2RAH A;  2Z7H A;  3TFN A;  3WCF A;  5IMP A;  5EAU A;  4JXN A;  1DI1 A;  4LFG A;  1UBW A;  1YV5 A;  3NF2 A;  3PH7 A;  4KPJ A;  3RMG A;  4WK5 A;  4LLT A;  3G4D A;  2ONG A;  3EFQ A;  3ADZ A;  5A0K A;  4HD1 A;  4KVY A;  4NUA A;  5JA0 F;  5ILH A;  1HXG A;  2AZK A;  3B7L A;  4KWD A;  2ZCQ A;  4FP4 A;  4DEM F;  3P5R A;  3WCE A;  3PKO A;  1ZW5 A;  2E4O A;  2J5C A;  3G4F A;  1KIY A;  3OAC A;  4F6X A;  1HM4 A;  3QQV A;  2Z4V A;  4F6V A;  2EWG A;  1V4H A;  3IBA A;  3KRA A;  4JZX A;  1EZF A;  4LLS A;  5ILD A;  3WCG A;  4NG6 A;  5DJR F;  1RQJ A;  3OAB B;  2F8C F;  5E8L A;  4H5C F;  4KQ5 A;  2P1C A;  1N22 A;  2PS5 A;  2F92 F;  3VJC A;  3VJB A;  3LVS A;  5IL8 A;  4LPG F;  4XQS F;  3SDV A;  3ACX A;  5DJP F;  3KRA B;  5KSX F;  1YYT A;  3NPR A;  3AQB B;  5DGN F;  5IVG A;  5IMN A;  4LIX A;  3SAE A;  3MZV A;  3WEJ A;  5IKA A;  3QKC A;  4N9U A;  2AZL A;  3WC9 A;  5IK9 A;  1N1B A;  2E94 A;  1PS1 A;  3LK5 A;  1WY0 A;  4RXC A;  1V4J A;  2O1O A;  4N1Z F;  3N1V F;  2OPN A;  4KVW A;  3OYR A;  1WKZ A;  3Q30 A;  4QPF A;  4L2X F;  4QXS F;  3ID0 A;  4OKM A;  5CG6 A;  3KRC B;  3WE9 A;  3BNY A;  3VJ9 A;  2VF6 A;  5ILJ A;  5JV2 F;  1HM7 A;  3VJ8 A;  3N0F A;  1WL1 A;  2E8U A;  3V1V A;  1N21 A;  2Z50 A;  4OKZ A;  4DWG A;  4UMJ A;  4P0X A;  3ZMB A;  4EA2 A;  4LA5 A;  4GP1 A;  3KBK A;  3CP6 A;  5IK6 A;  5DGM F;  3PYA A;  3P8R A;  2ZEV A;  3KRF B;  3NPK A;  5A0I A;  4LOB A;  3LGZ B;  3UCA A;  2ZCR A;  4E9U A;  5B0I A;  5HN7 A;  5HN8 A;  4OGU A;  5ILI A;  3DYF A;  3N0G A;  3SDT A;  4P0V A;  2F7M F;  1V4E A;  3LSN A;  4LFV F;  5DGS F;  5ERM A;  3OAB A;  5DIQ F;  1RTR A;  5AYP A;  3WJO A;  3BNX A;  1JFA A;  2F8Z F;  1WMW A;  3CKE A;  4RXE A;  3ZCD A;  3LJI A;  5ERN A;  4E1E A;  1YJ4 A;  5AFX A;  2F89 F;  2F94 F;  5IM1 A;  2Z4W A;  1YQ7 A;  3N46 F;  3ZOU A;  3LZ9 A;  2J1P A;  2Z78 A;  4MC3 A;  2E8W A;  4LUU A;  3WCC A;  5ILK A;  2E8X A;  3N49 F;  1YYR A;  2Q58 A;  3ICM A;  3WSB A;  4LZ0 A;  2AEK A;  5E8H A;  4E9Z A;  2OA6 A;  2OPM A;  4KK2 A;  3AQ0 A;  1N1Z A;  5B0K A;  3WSA A;  4NFI F;  5IL3 A;  3WCL A;  4K10 A;  1YHK A;  2Z4Z A;  4JVJ F;  1YYS A;  5JUZ F;  3KRP A;  2AEL A;  3LMD A;  2Z4X A;  3APZ A;  4RXA A;  5H9D A;  4LXW A;  3S9V A;  4DWB A;  3ICN A;  2E95 A;  4KUX A;  3KB9 A;  5EAT A;  2ZEU A;  3N1W F;  4DI5 A;  1YYU A;  1VG7 A;  3P8L A;  5E8K A;  3DYH A;  2Q80 A;  5JV0 F;  3KRC A;  4KPD A;  5JV1 F;  3SDQ A;  3AE0 A;  3V66 A;  1V4I A;  3WEK A;  2FTZ A;  2FOR A;  2PS8 A;  2E90 A;  1DGP A;  3KRP B;  2ZCO A;  4LZC A;  4LFE A;  2DH4 A;  1KIZ A;  3N3D A;  4JXY A;  4LTV A;  3RBM A;  3S4J A;  5IN8 A;  4H5D F;  3ACW A;  5CG5 A;  3DYG A;  4MC0 A;  4DXJ A;  3EGT A;  3WJK A;  1YYQ A;  5HNA A;  3WEI A;  3M00 A;  1V4K A;  4KQS A;  1YHL A;  3KRF A;  3TC1 A;  1VG4 A;  4OMH A;  2I19 A;  4NKF A;  3V1X A;  1WL3 A;  4Q23 A;  4KFA A;  2PS7 A;  3RYW A;  4DHD A;  3TFP A;  2E8T A;  3WEH A;  2PS6 A;  1VG2 A;  2Q9Y A;  5I1U A;  3WJN A;  3KRO B;  4ZQ8 A;  2Z4Y A;  5DW7 A;  5IMI A;  3WEF A;  3N6K F;  3N5J F;  1VG3 A;  3TS7 A;  1N20 A;  3N3L F;  3LDW A;  2E91 A;  5DJV F;  3PDE A;  3SDR A;  3EZ3 A;  3ICZ A;  5B00 A;  5ERO A;  4KVI A;  4DZW A;  3M9U A;  4KVD A;  3IPI A;  5B02 A;  2E93 A;  4XQT F;  1N23 A;  4NFK F;  2OGD A;  3WEG A;  2Q9Z A;  5ILZ A;  1RQI A;  5AHU B;  3VJD A;  3TFV A;  3Q1O A;  3VJA A;  4H5E F;  3PYB A;  5ER8 A;  5IKH A;  2H8O A;  2AET A;  4NFJ F;  5DHI A;  1VG6 A;  3P5P A;  3ICK A;  5B01 A;  5HN9 A;  3SDU A;  1HXA A;  3WCM A;  4EA1 A;  2QIS A;  4LPH F;  1UBX A;  3M01 A;  4KKM A;  5AEL A;  1HXC A;  3WCI A;  2ZCS A;  3M0G A;  5DHK A;  5C05 A;  3CC9 A;  4RNQ A;  3P41 A;  3WCB A;  3ACY A;  3LEE A;  4PVY F;  2Z7I A;  2ZY1 A; 
#chains in the Genus database with same CATH homology
 3WCJ A;  3N45 F;  5B0L A;  1FPS A;  2F9K F;  3OAC B;  3ZL6 A;  4JYX A;  2E8V A;  3Q2Z A;  4KQU A;  3LG5 A;  5EAS A;  3LOM A;  4FJQ A;  1UBV A;  1N24 A;  4OMG A;  4GAX A;  5B0M A;  3LGK A;  3WCA A;  2Z52 A;  4LZ3 A;  3ZMC A;  2E92 A;  3VJE A;  5A0J A;  3NRI A;  5B0J A;  3KRO A;  2AZJ A;  4LA6 A;  1WL0 A;  3AQC B;  4GA3 A;  3Q2Q A;  3M02 A;  4F62 A;  2ONH A;  3W7F A;  1UBY A;  4RYP A;  1JFG A;  3WCD A;  3N5H F;  1YHM A;  4NKE A;  3WCH A;  4P0W A;  4RXD A;  2PS4 A;  5B03 A;  4PVX F;  3RYE A;  2J1O A;  4LTZ A;  4MC8 A;  4XQR F;  4JZB A;  3MAV A;  1WL2 A;  5IK0 A;  1HX9 A;  4EA0 A;  5DZ2 A;  3LLW A;  5ILY A;  4GP2 A;  3ASX A;  2RAH A;  2Z7H A;  3TFN A;  3WCF A;  5IMP A;  5EAU A;  4JXN A;  1DI1 A;  4LFG A;  1UBW A;  1YV5 A;  3NF2 A;  3PH7 A;  4KPJ A;  3RMG A;  4WK5 A;  4LLT A;  3G4D A;  2ONG A;  3EFQ A;  3ADZ A;  5A0K A;  4HD1 A;  4KVY A;  4NUA A;  5JA0 F;  5ILH A;  1HXG A;  2AZK A;  3B7L A;  4KWD A;  2ZCQ A;  4FP4 A;  4DEM F;  3P5R A;  3WCE A;  3PKO A;  1ZW5 A;  2E4O A;  2J5C A;  3G4F A;  1KIY A;  3OAC A;  4F6X A;  1HM4 A;  3QQV A;  2Z4V A;  4F6V A;  2EWG A;  1V4H A;  3IBA A;  3KRA A;  4JZX A;  1EZF A;  4LLS A;  5ILD A;  3WCG A;  4NG6 A;  5DJR F;  1RQJ A;  3OAB B;  2F8C F;  5E8L A;  4H5C F;  4KQ5 A;  2P1C A;  1N22 A;  2PS5 A;  2F92 F;  3VJC A;  3VJB A;  3LVS A;  5IL8 A;  4LPG F;  4XQS F;  3SDV A;  3ACX A;  5DJP F;  3KRA B;  5KSX F;  1YYT A;  3NPR A;  3AQB B;  5DGN F;  5IVG A;  5IMN A;  4LIX A;  3SAE A;  3MZV A;  3WEJ A;  5IKA A;  3QKC A;  4N9U A;  2AZL A;  3WC9 A;  5IK9 A;  1N1B A;  2E94 A;  1PS1 A;  3LK5 A;  1WY0 A;  4RXC A;  1V4J A;  2O1O A;  4N1Z F;  3N1V F;  2OPN A;  4KVW A;  3OYR A;  1WKZ A;  3Q30 A;  4QPF A;  4L2X F;  4QXS F;  3ID0 A;  4OKM A;  5CG6 A;  3KRC B;  3WE9 A;  3BNY A;  3VJ9 A;  2VF6 A;  5ILJ A;  5JV2 F;  1HM7 A;  3VJ8 A;  3N0F A;  1WL1 A;  2E8U A;  3V1V A;  1N21 A;  2Z50 A;  4OKZ A;  4DWG A;  4UMJ A;  4P0X A;  3ZMB A;  4EA2 A;  4LA5 A;  4GP1 A;  3KBK A;  3CP6 A;  5IK6 A;  5DGM F;  3PYA A;  3P8R A;  2ZEV A;  3KRF B;  3NPK A;  5A0I A;  4LOB A;  3LGZ B;  3UCA A;  2ZCR A;  4E9U A;  5B0I A;  5HN7 A;  5HN8 A;  4OGU A;  5ILI A;  3DYF A;  3N0G A;  3SDT A;  4P0V A;  2F7M F;  1V4E A;  3LSN A;  4LFV F;  5DGS F;  5ERM A;  3OAB A;  5DIQ F;  1RTR A;  5AYP A;  3WJO A;  3BNX A;  1JFA A;  2F8Z F;  1WMW A;  3CKE A;  4RXE A;  3ZCD A;  3LJI A;  5ERN A;  4E1E A;  1YJ4 A;  5AFX A;  2F89 F;  2F94 F;  5IM1 A;  2Z4W A;  1YQ7 A;  3N46 F;  3ZOU A;  3LZ9 A;  2J1P A;  2Z78 A;  4MC3 A;  2E8W A;  4LUU A;  3WCC A;  5ILK A;  2E8X A;  3N49 F;  1YYR A;  2Q58 A;  3ICM A;  3WSB A;  4LZ0 A;  2AEK A;  5E8H A;  4E9Z A;  2OA6 A;  2OPM A;  4KK2 A;  3AQ0 A;  1N1Z A;  5B0K A;  3WSA A;  4NFI F;  5IL3 A;  3WCL A;  4K10 A;  1YHK A;  2Z4Z A;  4JVJ F;  1YYS A;  5JUZ F;  3KRP A;  2AEL A;  3LMD A;  2Z4X A;  3APZ A;  4RXA A;  5H9D A;  4LXW A;  3S9V A;  4DWB A;  3ICN A;  2E95 A;  4KUX A;  3KB9 A;  5EAT A;  2ZEU A;  3N1W F;  4DI5 A;  1YYU A;  1VG7 A;  3P8L A;  5E8K A;  3DYH A;  2Q80 A;  5JV0 F;  3KRC A;  4KPD A;  5JV1 F;  3SDQ A;  3AE0 A;  3V66 A;  1V4I A;  3WEK A;  2FTZ A;  2FOR A;  2PS8 A;  2E90 A;  1DGP A;  3KRP B;  2ZCO A;  4LZC A;  4LFE A;  2DH4 A;  1KIZ A;  3N3D A;  4JXY A;  4LTV A;  3RBM A;  3S4J A;  5IN8 A;  4H5D F;  3ACW A;  5CG5 A;  3DYG A;  4MC0 A;  4DXJ A;  3EGT A;  3WJK A;  1YYQ A;  5HNA A;  3WEI A;  3M00 A;  1V4K A;  4KQS A;  1YHL A;  3KRF A;  3TC1 A;  1VG4 A;  4OMH A;  2I19 A;  4NKF A;  3V1X A;  1WL3 A;  4Q23 A;  4KFA A;  2PS7 A;  3RYW A;  4DHD A;  3TFP A;  2E8T A;  3WEH A;  2PS6 A;  1VG2 A;  2Q9Y A;  5I1U A;  3WJN A;  3KRO B;  4ZQ8 A;  2Z4Y A;  5DW7 A;  5IMI A;  3WEF A;  3N6K F;  3N5J F;  1VG3 A;  3TS7 A;  1N20 A;  3N3L F;  3LDW A;  2E91 A;  5DJV F;  3PDE A;  3SDR A;  3EZ3 A;  3ICZ A;  5B00 A;  5ERO A;  4KVI A;  4DZW A;  3M9U A;  4KVD A;  3IPI A;  5B02 A;  2E93 A;  4XQT F;  1N23 A;  4NFK F;  2OGD A;  3WEG A;  2Q9Z A;  5ILZ A;  1RQI A;  5AHU B;  3VJD A;  3TFV A;  3Q1O A;  3VJA A;  4H5E F;  3PYB A;  5ER8 A;  5IKH A;  2H8O A;  2AET A;  4NFJ F;  5DHI A;  1VG6 A;  3P5P A;  3ICK A;  5B01 A;  5HN9 A;  3SDU A;  1HXA A;  3WCM A;  4EA1 A;  2QIS A;  4LPH F;  1UBX A;  3M01 A;  4KKM A;  5AEL A;  1HXC A;  3WCI A;  2ZCS A;  3M0G A;  5DHK A;  5C05 A;  3CC9 A;  4RNQ A;  3P41 A;  3WCB A;  3ACY A;  3LEE A;  4PVY F;  2Z7I A;  2ZY1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...