3VJEA

Crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIAIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Binding modes of zaragozic acid A to human squalene synthase and staphylococcal dehydrosqualene synthase
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase/transferase inhibitor
total genus 113
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3vjeA00
3LGZB 4OKMA 3KRFA 3MZVA 3KRPA 3WCIA 2Q9YA 4KFAA 2PS5A 3P41A 3WCEA 4LOBA 3WJKA 1VG6A 1HXAA 3LZ9A 3VJ8A 2ZEUA 4MC8A 3WJOA 2P1CA 3V1XA 4DEMF 1VG3A 2F92F 2J1PA 1VG2A 5H9DA 3LK5A 2ZCRA 4WK5A 2OGDA 4N1ZF 4JZBA 3G4DA 1V4IA 3ACYA 2Z78A 3TFVA 3VJBA 2EWGA 3NF2A 1YYRA 3QKCA 1HX9A 4HD1A 4DZWA 4LZ3A 4NFIF 5KSXF 3G4FA 3M01A 4KVWA 2E94A 1KIZA 3SDUA 3WSAA 2Z4WA 2AZKA 4PVXF 2AELA 2E8XA 3N5JF 2F9KF 4H5DF 3WSBA 1UBWA 1WKZA 2QISA 2ZCOA 2I19A 5ILYA 2AETA 5B0KA 5JV2F 1N20A 1DGPA 5JV1F 3N0GA 3PDEA 3KRFB 5IMPA 3KRPB 5EROA 5A0KA 2DH4A 3APZA 1N1ZA 3W7FA 3N46F 5A0IA 4GA3A 3V66A 4RYPA 3N3LF 3EFQA 5IK9A 4F6XA 5DGMF 4KVYA 3N1WF 4F6VA 3OABA 2Z52A 4F62A 2Z4VA 5HN7A 2F8ZF 3EZ3A 1HM7A 2E95A 3AQ0A 3N6KF 4DWBA 4Q23A 4EA1A 3LVSA 4JZXA 2E93A 5JA0F 1YYUA 4NG6A 3LLWA 1V4JA 3SAEA 3WEHA 3SDTA 3TFNA 4OMHA 4P0VA 4H5CF 4GP2A 3BNYA 4LUUA 3AQCB 5AELA 5AHUB 2E91A 3VJDA 3P8RA 2ONGA 4LLTA 3CC9A 5DW7A 4NKEA 4NUAA 4NFKF 1JFGA 5ILZA 2AEKA 5EASA 4RXCA 1YQ7A 4LLSA 3ADZA 4E1EA 1HM4A 4JVJF 1ZW5A 5AFXA 1N21A 4KKMA 1EZFA 1FPSA 4H5EF 2F89F 1JFAA 1WMWA 1YYQA 4FP4A 4XQRF 3WCLA 3OABB 3PYAA 2OPMA 3SDQA 3ICZA 4LA6A 3LDWA 3M02A 1YYTA 5DGSF 4K10A 5CG5A 2E90A 4KQ5A 3DYHA 1YHMA 3P5PA 5EAUA 3Q30A 2Z4YA 4GP1A 2Q80A 1WY0A 4GAXA 5B00A 2F8CF 5ILIA 3WCJA 1VG4A 2E8VA 5DIQF 5ILJA 3BNXA 4E9ZA 5DHKA 4LZCA 5IN8A 5JV0F 4LIXA 3ACWA 2E8WA 3TFPA 5CG6A 3KBKA 1WL2A 4LFEA 3AE0A 3WEFA 4PVYF 3ID0A 4XQSF 3Q2ZA 4JYXA 3ACXA 4KQSA 3OACA 3P8LA 2Q9ZA 3PH7A 5IVGA 5B02A 3CP6A 2Q58A 3V1VA 1V4EA 1YJ4A 4DHDA 2Z4XA 3LEEA 3WEGA 1WL1A 4KUXA 4KVDA 2Z7HA 1RQJA 3S9VA 4N9UA 5E8HA 1RTRA 5I1UA 5ILDA 3Q2QA 1N23A 1UBYA 3M9UA 2O1OA 5B01A 3WCHA 4RNQA 5HN8A 2H8OA 4E9UA 3N1VF 3ZMCA 5AYPA 3N49F 3N0FA 5DJVF 1DI1A 4UMJA 3ZOUA 1HXCA 3WE9A 3M00A 1YHLA 3EGTA 3ICNA 5DJRF 3LSNA 4DI5A 4L2XF 3ZCDA 5DJPF 3PYBA 5E8LA 3S4JA 2ZEVA 3UCAA 4ZQ8A 3WCGA 4LFGA 4LPGF 2F7MF 5ER8A 3LG5A 3ZL6A 1N22A 1RQIA 3RYEA 5ERMA 5IK0A 5HN9A 3KRCA 3KRAA 4LA5A 4P0XA 2F94F 4KWDA 2AZLA 2J1OA 4KPJA 1KIYA 4KQUA 2Z7IA 1YHKA 2PS7A 2VF6A 1WL0A 3LOMA 1VG7A 2OPNA 3VJCA 4MC3A 3KROA 4NKFA 5DHIA 5IL8A 3NPKA 3B7LA 3WCBA 4DWGA 3TS7A 5DGNF 1PS1A 3IBAA 5IMIA 3DYFA 3P5RA 3WCDA 2FTZA 4EA0A 4LPHF 5IL3A 4NFJF 2PS6A 2PS8A 3AQBB 2E4OA 3LGKA 5ILKA 3WCCA 4RXAA 4XQTF 1UBXA 5DZ2A 5IM1A 4LZ0A 3M0GA 3RMGA 4DXJA 2E8TA 4JXYA 5A0JA 4JXNA 4OKZA 3KRCB 2ONHA 2AZJA 3KRAB 3VJ9A 4EA2A 3IPIA 4KVIA 5EATA 3LJIA 2PS4A 3MAVA 5C05A 3Q1OA 5IMNA 4FJQA 5ILHA 3WCMA 2E92A 3WCFA 3SDRA 4RXDA 5B0JA 4QXSF 3KROB 3WEIA 3QQVA 5IKAA 5B03A 5B0LA 5B0MA 3NPRA 5E8KA 2J5CA 4KPDA 3ZMBA 1HXGA 5HNAA 2ZY1A 4OGUA 3WC9A 2OA6A 2ZCSA 3RYWA 1YYSA 4KK2A 3DYGA 3WCAA 2E8UA 5ERNA 2FORA 2Z50A 3WJNA 2ZCQA 3WEKA 3NRIA 3TC1A 1YV5A 3VJEA 3RBMA 1WL3A 4LFVF 3ICKA 3CKEA 1N24A 2RAHA 5IKHA 4P0WA 3ICMA 4LTZA 4LXWA 5JUZF 4LTVA 5IK6A 3WEJA 3OACB 1N1BA 4RXEA 3N5HF 3N45F 3ASXA 3PKOA 1V4HA 2Z4ZA 3KB9A 1UBVA 3OYRA 3N3DA 4OMGA 5B0IA 4QPFA 3LMDA 3VJAA 3SDVA 1V4KA 4MC0A
chains in the Genus database with same CATH superfamily
3LGZB 4OKMA 3KRFA 3MZVA 3KRPA 3WCIA 2Q9YA 4KFAA 2PS5A 3P41A 3WCEA 4LOBA 3WJKA 1VG6A 1HXAA 3LZ9A 3VJ8A 2ZEUA 4MC8A 3WJOA 2P1CA 3V1XA 4DEMF 1VG3A 2F92F 2J1PA 1VG2A 5H9DA 3LK5A 2ZCRA 4WK5A 2OGDA 4N1ZF 4JZBA 3G4DA 1V4IA 3ACYA 2Z78A 3TFVA 3VJBA 2EWGA 3NF2A 1YYRA 3QKCA 1HX9A 4HD1A 4DZWA 4LZ3A 4NFIF 5KSXF 3G4FA 3M01A 4KVWA 2E94A 1KIZA 3SDUA 3WSAA 2Z4WA 2AZKA 4PVXF 2AELA 2E8XA 3N5JF 2F9KF 4H5DF 3WSBA 1UBWA 1WKZA 2QISA 2ZCOA 2I19A 5ILYA 2AETA 5B0KA 5JV2F 1N20A 1DGPA 5JV1F 3N0GA 3PDEA 3KRFB 5IMPA 3KRPB 5EROA 5A0KA 2DH4A 3APZA 1N1ZA 3W7FA 3N46F 5A0IA 4GA3A 3V66A 4RYPA 3N3LF 3EFQA 5IK9A 4F6XA 5DGMF 4KVYA 3N1WF 4F6VA 3OABA 2Z52A 4F62A 2Z4VA 5HN7A 2F8ZF 3EZ3A 1HM7A 2E95A 3AQ0A 3N6KF 4DWBA 4Q23A 4EA1A 3LVSA 4JZXA 2E93A 5JA0F 1YYUA 4NG6A 3LLWA 1V4JA 3SAEA 3WEHA 3SDTA 3TFNA 4OMHA 4P0VA 4H5CF 4GP2A 3BNYA 4LUUA 3AQCB 5AELA 5AHUB 2E91A 3VJDA 3P8RA 2ONGA 4LLTA 3CC9A 5DW7A 4NKEA 4NUAA 4NFKF 1JFGA 5ILZA 2AEKA 5EASA 4RXCA 1YQ7A 4LLSA 3ADZA 4E1EA 1HM4A 4JVJF 1ZW5A 5AFXA 1N21A 4KKMA 1EZFA 1FPSA 4H5EF 2F89F 1JFAA 1WMWA 1YYQA 4FP4A 4XQRF 3WCLA 3OABB 3PYAA 2OPMA 3SDQA 3ICZA 4LA6A 3LDWA 3M02A 1YYTA 5DGSF 4K10A 5CG5A 2E90A 4KQ5A 3DYHA 1YHMA 3P5PA 5EAUA 3Q30A 2Z4YA 4GP1A 2Q80A 1WY0A 4GAXA 5B00A 2F8CF 5ILIA 3WCJA 1VG4A 2E8VA 5DIQF 5ILJA 3BNXA 4E9ZA 5DHKA 4LZCA 5IN8A 5JV0F 4LIXA 3ACWA 2E8WA 3TFPA 5CG6A 3KBKA 1WL2A 4LFEA 3AE0A 3WEFA 4PVYF 3ID0A 4XQSF 3Q2ZA 4JYXA 3ACXA 4KQSA 3OACA 3P8LA 2Q9ZA 3PH7A 5IVGA 5B02A 3CP6A 2Q58A 3V1VA 1V4EA 1YJ4A 4DHDA 2Z4XA 3LEEA 3WEGA 1WL1A 4KUXA 4KVDA 2Z7HA 1RQJA 3S9VA 4N9UA 5E8HA 1RTRA 5I1UA 5ILDA 3Q2QA 1N23A 1UBYA 3M9UA 2O1OA 5B01A 3WCHA 4RNQA 5HN8A 2H8OA 4E9UA 3N1VF 3ZMCA 5AYPA 3N49F 3N0FA 5DJVF 1DI1A 4UMJA 3ZOUA 1HXCA 3WE9A 3M00A 1YHLA 3EGTA 3ICNA 5DJRF 3LSNA 4DI5A 4L2XF 3ZCDA 5DJPF 3PYBA 5E8LA 3S4JA 2ZEVA 3UCAA 4ZQ8A 3WCGA 4LFGA 4LPGF 2F7MF 5ER8A 3LG5A 3ZL6A 1N22A 1RQIA 3RYEA 5ERMA 5IK0A 5HN9A 3KRCA 3KRAA 4LA5A 4P0XA 2F94F 4KWDA 2AZLA 2J1OA 4KPJA 1KIYA 4KQUA 2Z7IA 1YHKA 2PS7A 2VF6A 1WL0A 3LOMA 1VG7A 2OPNA 3VJCA 4MC3A 3KROA 4NKFA 5DHIA 5IL8A 3NPKA 3B7LA 3WCBA 4DWGA 3TS7A 5DGNF 1PS1A 3IBAA 5IMIA 3DYFA 3P5RA 3WCDA 2FTZA 4EA0A 4LPHF 5IL3A 4NFJF 2PS6A 2PS8A 3AQBB 2E4OA 3LGKA 5ILKA 3WCCA 4RXAA 4XQTF 1UBXA 5DZ2A 5IM1A 4LZ0A 3M0GA 3RMGA 4DXJA 2E8TA 4JXYA 5A0JA 4JXNA 4OKZA 3KRCB 2ONHA 2AZJA 3KRAB 3VJ9A 4EA2A 3IPIA 4KVIA 5EATA 3LJIA 2PS4A 3MAVA 5C05A 3Q1OA 5IMNA 4FJQA 5ILHA 3WCMA 2E92A 3WCFA 3SDRA 4RXDA 5B0JA 4QXSF 3KROB 3WEIA 3QQVA 5IKAA 5B03A 5B0LA 5B0MA 3NPRA 5E8KA 2J5CA 4KPDA 3ZMBA 1HXGA 5HNAA 2ZY1A 4OGUA 3WC9A 2OA6A 2ZCSA 3RYWA 1YYSA 4KK2A 3DYGA 3WCAA 2E8UA 5ERNA 2FORA 2Z50A 3WJNA 2ZCQA 3WEKA 3NRIA 3TC1A 1YV5A 3VJEA 3RBMA 1WL3A 4LFVF 3ICKA 3CKEA 1N24A 2RAHA 5IKHA 4P0WA 3ICMA 4LTZA 4LXWA 5JUZF 4LTVA 5IK6A 3WEJA 3OACB 1N1BA 4RXEA 3N5HF 3N45F 3ASXA 3PKOA 1V4HA 2Z4ZA 3KB9A 1UBVA 3OYRA 3N3DA 4OMGA 5B0IA 4QPFA 3LMDA 3VJAA 3SDVA 1V4KA 4MC0A
chains in the Genus database with same CATH topology
3LGZB 4OKMA 3KRFA 3MZVA 3KRPA 3WCIA 2Q9YA 4KFAA 2PS5A 3P41A 3WCEA 4LOBA 3WJKA 1VG6A 1HXAA 3LZ9A 3VJ8A 2ZEUA 4MC8A 3WJOA 2P1CA 3V1XA 4DEMF 1VG3A 2F92F 2J1PA 1VG2A 5H9DA 3LK5A 2ZCRA 4WK5A 2OGDA 4N1ZF 4JZBA 3G4DA 1V4IA 3ACYA 2Z78A 3TFVA 3VJBA 2EWGA 3NF2A 1YYRA 3QKCA 1HX9A 4HD1A 4DZWA 4LZ3A 4NFIF 5KSXF 3G4FA 3M01A 4KVWA 2E94A 1KIZA 3SDUA 3WSAA 2Z4WA 2AZKA 4PVXF 2AELA 2E8XA 3N5JF 2F9KF 4H5DF 3WSBA 1UBWA 1WKZA 2QISA 2ZCOA 2I19A 5ILYA 2AETA 5B0KA 5JV2F 1N20A 1DGPA 5JV1F 3N0GA 3PDEA 3KRFB 5IMPA 3KRPB 5EROA 5A0KA 2DH4A 3APZA 1N1ZA 3W7FA 3N46F 5A0IA 4GA3A 3V66A 4RYPA 3N3LF 3EFQA 5IK9A 4F6XA 5DGMF 4KVYA 3N1WF 4F6VA 3OABA 2Z52A 4F62A 2Z4VA 5HN7A 2F8ZF 3EZ3A 1HM7A 2E95A 3AQ0A 3N6KF 4DWBA 4Q23A 4EA1A 3LVSA 4JZXA 2E93A 5JA0F 1YYUA 4NG6A 3LLWA 1V4JA 3SAEA 3WEHA 3SDTA 3TFNA 4OMHA 4P0VA 4H5CF 4GP2A 3BNYA 4LUUA 3AQCB 5AELA 5AHUB 2E91A 3VJDA 3P8RA 2ONGA 4LLTA 3CC9A 5DW7A 4NKEA 4NUAA 4NFKF 1JFGA 5ILZA 2AEKA 5EASA 4RXCA 1YQ7A 4LLSA 3ADZA 4E1EA 1HM4A 4JVJF 1ZW5A 5AFXA 1N21A 4KKMA 1EZFA 1FPSA 4H5EF 2F89F 1JFAA 1WMWA 1YYQA 4FP4A 4XQRF 3WCLA 3OABB 3PYAA 2OPMA 3SDQA 3ICZA 4LA6A 3LDWA 3M02A 1YYTA 5DGSF 4K10A 5CG5A 2E90A 4KQ5A 3DYHA 1YHMA 3P5PA 5EAUA 3Q30A 2Z4YA 4GP1A 2Q80A 1WY0A 4GAXA 5B00A 2F8CF 5ILIA 3WCJA 1VG4A 2E8VA 5DIQF 5ILJA 3BNXA 4E9ZA 5DHKA 4LZCA 5IN8A 5JV0F 4LIXA 3ACWA 2E8WA 3TFPA 5CG6A 3KBKA 1WL2A 4LFEA 3AE0A 3WEFA 4PVYF 3ID0A 4XQSF 3Q2ZA 4JYXA 3ACXA 4KQSA 3OACA 3P8LA 2Q9ZA 3PH7A 5IVGA 5B02A 3CP6A 2Q58A 3V1VA 1V4EA 1YJ4A 4DHDA 2Z4XA 3LEEA 3WEGA 1WL1A 4KUXA 4KVDA 2Z7HA 1RQJA 3S9VA 4N9UA 5E8HA 1RTRA 5I1UA 5ILDA 3Q2QA 1N23A 1UBYA 3M9UA 2O1OA 5B01A 3WCHA 4RNQA 5HN8A 2H8OA 4E9UA 3N1VF 3ZMCA 5AYPA 3N49F 3N0FA 5DJVF 1DI1A 4UMJA 3ZOUA 1HXCA 3WE9A 3M00A 1YHLA 3EGTA 3ICNA 5DJRF 3LSNA 4DI5A 4L2XF 3ZCDA 5DJPF 3PYBA 5E8LA 3S4JA 2ZEVA 3UCAA 4ZQ8A 3WCGA 4LFGA 4LPGF 2F7MF 5ER8A 3LG5A 3ZL6A 1N22A 1RQIA 3RYEA 5ERMA 5IK0A 5HN9A 3KRCA 3KRAA 4LA5A 4P0XA 2F94F 4KWDA 2AZLA 2J1OA 4KPJA 1KIYA 4KQUA 2Z7IA 1YHKA 2PS7A 2VF6A 1WL0A 3LOMA 1VG7A 2OPNA 3VJCA 4MC3A 3KROA 4NKFA 5DHIA 5IL8A 3NPKA 3B7LA 3WCBA 4DWGA 3TS7A 5DGNF 1PS1A 3IBAA 5IMIA 3DYFA 3P5RA 3WCDA 2FTZA 4EA0A 4LPHF 5IL3A 4NFJF 2PS6A 2PS8A 3AQBB 2E4OA 3LGKA 5ILKA 3WCCA 4RXAA 4XQTF 1UBXA 5DZ2A 5IM1A 4LZ0A 3M0GA 3RMGA 4DXJA 2E8TA 4JXYA 5A0JA 4JXNA 4OKZA 3KRCB 2ONHA 2AZJA 3KRAB 3VJ9A 4EA2A 3IPIA 4KVIA 5EATA 3LJIA 2PS4A 3MAVA 5C05A 3Q1OA 5IMNA 4FJQA 5ILHA 3WCMA 2E92A 3WCFA 3SDRA 4RXDA 5B0JA 4QXSF 3KROB 3WEIA 3QQVA 5IKAA 5B03A 5B0LA 5B0MA 3NPRA 5E8KA 2J5CA 4KPDA 3ZMBA 1HXGA 5HNAA 2ZY1A 4OGUA 3WC9A 2OA6A 2ZCSA 3RYWA 1YYSA 4KK2A 3DYGA 3WCAA 2E8UA 5ERNA 2FORA 2Z50A 3WJNA 2ZCQA 3WEKA 3NRIA 3TC1A 1YV5A 3VJEA 3RBMA 1WL3A 4LFVF 3ICKA 3CKEA 1N24A 2RAHA 5IKHA 4P0WA 3ICMA 4LTZA 4LXWA 5JUZF 4LTVA 5IK6A 3WEJA 3OACB 1N1BA 4RXEA 3N5HF 3N45F 3ASXA 3PKOA 1V4HA 2Z4ZA 3KB9A 1UBVA 3OYRA 3N3DA 4OMGA 5B0IA 4QPFA 3LMDA 3VJAA 3SDVA 1V4KA 4MC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGZ B;  4OKM A;  3KRF A;  3MZV A;  3KRP A;  3WCI A;  2Q9Y A;  4KFA A;  2PS5 A;  3P41 A;  3WCE A;  4LOB A;  3WJK A;  1VG6 A;  1HXA A;  3LZ9 A;  3VJ8 A;  2ZEU A;  4MC8 A;  3WJO A;  2P1C A;  3V1X A;  4DEM F;  1VG3 A;  2F92 F;  2J1P A;  1VG2 A;  5H9D A;  3LK5 A;  2ZCR A;  4WK5 A;  2OGD A;  4N1Z F;  4JZB A;  3G4D A;  1V4I A;  3ACY A;  2Z78 A;  3TFV A;  3VJB A;  2EWG A;  3NF2 A;  1YYR A;  3QKC A;  1HX9 A;  4HD1 A;  4DZW A;  4LZ3 A;  4NFI F;  5KSX F;  3G4F A;  3M01 A;  4KVW A;  2E94 A;  1KIZ A;  3SDU A;  3WSA A;  2Z4W A;  2AZK A;  4PVX F;  2AEL A;  2E8X A;  3N5J F;  2F9K F;  4H5D F;  3WSB A;  1UBW A;  1WKZ A;  2QIS A;  2ZCO A;  2I19 A;  5ILY A;  2AET A;  5B0K A;  5JV2 F;  1N20 A;  1DGP A;  5JV1 F;  3N0G A;  3PDE A;  3KRF B;  5IMP A;  3KRP B;  5ERO A;  5A0K A;  2DH4 A;  3APZ A;  1N1Z A;  3W7F A;  3N46 F;  5A0I A;  4GA3 A;  3V66 A;  4RYP A;  3N3L F;  3EFQ A;  5IK9 A;  4F6X A;  5DGM F;  4KVY A;  3N1W F;  4F6V A;  3OAB A;  2Z52 A;  4F62 A;  2Z4V A;  5HN7 A;  2F8Z F;  3EZ3 A;  1HM7 A;  2E95 A;  3AQ0 A;  3N6K F;  4DWB A;  4Q23 A;  4EA1 A;  3LVS A;  4JZX A;  2E93 A;  5JA0 F;  1YYU A;  4NG6 A;  3LLW A;  1V4J A;  3SAE A;  3WEH A;  3SDT A;  3TFN A;  4OMH A;  4P0V A;  4H5C F;  4GP2 A;  3BNY A;  4LUU A;  3AQC B;  5AEL A;  5AHU B;  2E91 A;  3VJD A;  3P8R A;  2ONG A;  4LLT A;  3CC9 A;  5DW7 A;  4NKE A;  4NUA A;  4NFK F;  1JFG A;  5ILZ A;  2AEK A;  5EAS A;  4RXC A;  1YQ7 A;  4LLS A;  3ADZ A;  4E1E A;  1HM4 A;  4JVJ F;  1ZW5 A;  5AFX A;  1N21 A;  4KKM A;  1EZF A;  1FPS A;  4H5E F;  2F89 F;  1JFA A;  1WMW A;  1YYQ A;  4FP4 A;  4XQR F;  3WCL A;  3OAB B;  3PYA A;  2OPM A;  3SDQ A;  3ICZ A;  4LA6 A;  3LDW A;  3M02 A;  1YYT A;  5DGS F;  4K10 A;  5CG5 A;  2E90 A;  4KQ5 A;  3DYH A;  1YHM A;  3P5P A;  5EAU A;  3Q30 A;  2Z4Y A;  4GP1 A;  2Q80 A;  1WY0 A;  4GAX A;  5B00 A;  2F8C F;  5ILI A;  3WCJ A;  1VG4 A;  2E8V A;  5DIQ F;  5ILJ A;  3BNX A;  4E9Z A;  5DHK A;  4LZC A;  5IN8 A;  5JV0 F;  4LIX A;  3ACW A;  2E8W A;  3TFP A;  5CG6 A;  3KBK A;  1WL2 A;  4LFE A;  3AE0 A;  3WEF A;  4PVY F;  3ID0 A;  4XQS F;  3Q2Z A;  4JYX A;  3ACX A;  4KQS A;  3OAC A;  3P8L A;  2Q9Z A;  3PH7 A;  5IVG A;  5B02 A;  3CP6 A;  2Q58 A;  3V1V A;  1V4E A;  1YJ4 A;  4DHD A;  2Z4X A;  3LEE A;  3WEG A;  1WL1 A;  4KUX A;  4KVD A;  2Z7H A;  1RQJ A;  3S9V A;  4N9U A;  5E8H A;  1RTR A;  5I1U A;  5ILD A;  3Q2Q A;  1N23 A;  1UBY A;  3M9U A;  2O1O A;  5B01 A;  3WCH A;  4RNQ A;  5HN8 A;  2H8O A;  4E9U A;  3N1V F;  3ZMC A;  5AYP A;  3N49 F;  3N0F A;  5DJV F;  1DI1 A;  4UMJ A;  3ZOU A;  1HXC A;  3WE9 A;  3M00 A;  1YHL A;  3EGT A;  3ICN A;  5DJR F;  3LSN A;  4DI5 A;  4L2X F;  3ZCD A;  5DJP F;  3PYB A;  5E8L A;  3S4J A;  2ZEV A;  3UCA A;  4ZQ8 A;  3WCG A;  4LFG A;  4LPG F;  2F7M F;  5ER8 A;  3LG5 A;  3ZL6 A;  1N22 A;  1RQI A;  3RYE A;  5ERM A;  5IK0 A;  5HN9 A;  3KRC A;  3KRA A;  4LA5 A;  4P0X A;  2F94 F;  4KWD A;  2AZL A;  2J1O A;  4KPJ A;  1KIY A;  4KQU A;  2Z7I A;  1YHK A;  2PS7 A;  2VF6 A;  1WL0 A;  3LOM A;  1VG7 A;  2OPN A;  3VJC A;  4MC3 A;  3KRO A;  4NKF A;  5DHI A;  5IL8 A;  3NPK A;  3B7L A;  3WCB A;  4DWG A;  3TS7 A;  5DGN F;  1PS1 A;  3IBA A;  5IMI A;  3DYF A;  3P5R A;  3WCD A;  2FTZ A;  4EA0 A;  4LPH F;  5IL3 A;  4NFJ F;  2PS6 A;  2PS8 A;  3AQB B;  2E4O A;  3LGK A;  5ILK A;  3WCC A;  4RXA A;  4XQT F;  1UBX A;  5DZ2 A;  5IM1 A;  4LZ0 A;  3M0G A;  3RMG A;  4DXJ A;  2E8T A;  4JXY A;  5A0J A;  4JXN A;  4OKZ A;  3KRC B;  2ONH A;  2AZJ A;  3KRA B;  3VJ9 A;  4EA2 A;  3IPI A;  4KVI A;  5EAT A;  3LJI A;  2PS4 A;  3MAV A;  5C05 A;  3Q1O A;  5IMN A;  4FJQ A;  5ILH A;  3WCM A;  2E92 A;  3WCF A;  3SDR A;  4RXD A;  5B0J A;  4QXS F;  3KRO B;  3WEI A;  3QQV A;  5IKA A;  5B03 A;  5B0L A;  5B0M A;  3NPR A;  5E8K A;  2J5C A;  4KPD A;  3ZMB A;  1HXG A;  5HNA A;  2ZY1 A;  4OGU A;  3WC9 A;  2OA6 A;  2ZCS A;  3RYW A;  1YYS A;  4KK2 A;  3DYG A;  3WCA A;  2E8U A;  5ERN A;  2FOR A;  2Z50 A;  3WJN A;  2ZCQ A;  3WEK A;  3NRI A;  3TC1 A;  1YV5 A;  3VJE A;  3RBM A;  1WL3 A;  4LFV F;  3ICK A;  3CKE A;  1N24 A;  2RAH A;  5IKH A;  4P0W A;  3ICM A;  4LTZ A;  4LXW A;  5JUZ F;  4LTV A;  5IK6 A;  3WEJ A;  3OAC B;  1N1B A;  4RXE A;  3N5H F;  3N45 F;  3ASX A;  3PKO A;  1V4H A;  2Z4Z A;  3KB9 A;  1UBV A;  3OYR A;  3N3D A;  4OMG A;  5B0I A;  4QPF A;  3LMD A;  3VJA A;  3SDV A;  1V4K A;  4MC0 A; 
#chains in the Genus database with same CATH topology
 3LGZ B;  4OKM A;  3KRF A;  3MZV A;  3KRP A;  3WCI A;  2Q9Y A;  4KFA A;  2PS5 A;  3P41 A;  3WCE A;  4LOB A;  3WJK A;  1VG6 A;  1HXA A;  3LZ9 A;  3VJ8 A;  2ZEU A;  4MC8 A;  3WJO A;  2P1C A;  3V1X A;  4DEM F;  1VG3 A;  2F92 F;  2J1P A;  1VG2 A;  5H9D A;  3LK5 A;  2ZCR A;  4WK5 A;  2OGD A;  4N1Z F;  4JZB A;  3G4D A;  1V4I A;  3ACY A;  2Z78 A;  3TFV A;  3VJB A;  2EWG A;  3NF2 A;  1YYR A;  3QKC A;  1HX9 A;  4HD1 A;  4DZW A;  4LZ3 A;  4NFI F;  5KSX F;  3G4F A;  3M01 A;  4KVW A;  2E94 A;  1KIZ A;  3SDU A;  3WSA A;  2Z4W A;  2AZK A;  4PVX F;  2AEL A;  2E8X A;  3N5J F;  2F9K F;  4H5D F;  3WSB A;  1UBW A;  1WKZ A;  2QIS A;  2ZCO A;  2I19 A;  5ILY A;  2AET A;  5B0K A;  5JV2 F;  1N20 A;  1DGP A;  5JV1 F;  3N0G A;  3PDE A;  3KRF B;  5IMP A;  3KRP B;  5ERO A;  5A0K A;  2DH4 A;  3APZ A;  1N1Z A;  3W7F A;  3N46 F;  5A0I A;  4GA3 A;  3V66 A;  4RYP A;  3N3L F;  3EFQ A;  5IK9 A;  4F6X A;  5DGM F;  4KVY A;  3N1W F;  4F6V A;  3OAB A;  2Z52 A;  4F62 A;  2Z4V A;  5HN7 A;  2F8Z F;  3EZ3 A;  1HM7 A;  2E95 A;  3AQ0 A;  3N6K F;  4DWB A;  4Q23 A;  4EA1 A;  3LVS A;  4JZX A;  2E93 A;  5JA0 F;  1YYU A;  4NG6 A;  3LLW A;  1V4J A;  3SAE A;  3WEH A;  3SDT A;  3TFN A;  4OMH A;  4P0V A;  4H5C F;  4GP2 A;  3BNY A;  4LUU A;  3AQC B;  5AEL A;  5AHU B;  2E91 A;  3VJD A;  3P8R A;  2ONG A;  4LLT A;  3CC9 A;  5DW7 A;  4NKE A;  4NUA A;  4NFK F;  1JFG A;  5ILZ A;  2AEK A;  5EAS A;  4RXC A;  1YQ7 A;  4LLS A;  3ADZ A;  4E1E A;  1HM4 A;  4JVJ F;  1ZW5 A;  5AFX A;  1N21 A;  4KKM A;  1EZF A;  1FPS A;  4H5E F;  2F89 F;  1JFA A;  1WMW A;  1YYQ A;  4FP4 A;  4XQR F;  3WCL A;  3OAB B;  3PYA A;  2OPM A;  3SDQ A;  3ICZ A;  4LA6 A;  3LDW A;  3M02 A;  1YYT A;  5DGS F;  4K10 A;  5CG5 A;  2E90 A;  4KQ5 A;  3DYH A;  1YHM A;  3P5P A;  5EAU A;  3Q30 A;  2Z4Y A;  4GP1 A;  2Q80 A;  1WY0 A;  4GAX A;  5B00 A;  2F8C F;  5ILI A;  3WCJ A;  1VG4 A;  2E8V A;  5DIQ F;  5ILJ A;  3BNX A;  4E9Z A;  5DHK A;  4LZC A;  5IN8 A;  5JV0 F;  4LIX A;  3ACW A;  2E8W A;  3TFP A;  5CG6 A;  3KBK A;  1WL2 A;  4LFE A;  3AE0 A;  3WEF A;  4PVY F;  3ID0 A;  4XQS F;  3Q2Z A;  4JYX A;  3ACX A;  4KQS A;  3OAC A;  3P8L A;  2Q9Z A;  3PH7 A;  5IVG A;  5B02 A;  3CP6 A;  2Q58 A;  3V1V A;  1V4E A;  1YJ4 A;  4DHD A;  2Z4X A;  3LEE A;  3WEG A;  1WL1 A;  4KUX A;  4KVD A;  2Z7H A;  1RQJ A;  3S9V A;  4N9U A;  5E8H A;  1RTR A;  5I1U A;  5ILD A;  3Q2Q A;  1N23 A;  1UBY A;  3M9U A;  2O1O A;  5B01 A;  3WCH A;  4RNQ A;  5HN8 A;  2H8O A;  4E9U A;  3N1V F;  3ZMC A;  5AYP A;  3N49 F;  3N0F A;  5DJV F;  1DI1 A;  4UMJ A;  3ZOU A;  1HXC A;  3WE9 A;  3M00 A;  1YHL A;  3EGT A;  3ICN A;  5DJR F;  3LSN A;  4DI5 A;  4L2X F;  3ZCD A;  5DJP F;  3PYB A;  5E8L A;  3S4J A;  2ZEV A;  3UCA A;  4ZQ8 A;  3WCG A;  4LFG A;  4LPG F;  2F7M F;  5ER8 A;  3LG5 A;  3ZL6 A;  1N22 A;  1RQI A;  3RYE A;  5ERM A;  5IK0 A;  5HN9 A;  3KRC A;  3KRA A;  4LA5 A;  4P0X A;  2F94 F;  4KWD A;  2AZL A;  2J1O A;  4KPJ A;  1KIY A;  4KQU A;  2Z7I A;  1YHK A;  2PS7 A;  2VF6 A;  1WL0 A;  3LOM A;  1VG7 A;  2OPN A;  3VJC A;  4MC3 A;  3KRO A;  4NKF A;  5DHI A;  5IL8 A;  3NPK A;  3B7L A;  3WCB A;  4DWG A;  3TS7 A;  5DGN F;  1PS1 A;  3IBA A;  5IMI A;  3DYF A;  3P5R A;  3WCD A;  2FTZ A;  4EA0 A;  4LPH F;  5IL3 A;  4NFJ F;  2PS6 A;  2PS8 A;  3AQB B;  2E4O A;  3LGK A;  5ILK A;  3WCC A;  4RXA A;  4XQT F;  1UBX A;  5DZ2 A;  5IM1 A;  4LZ0 A;  3M0G A;  3RMG A;  4DXJ A;  2E8T A;  4JXY A;  5A0J A;  4JXN A;  4OKZ A;  3KRC B;  2ONH A;  2AZJ A;  3KRA B;  3VJ9 A;  4EA2 A;  3IPI A;  4KVI A;  5EAT A;  3LJI A;  2PS4 A;  3MAV A;  5C05 A;  3Q1O A;  5IMN A;  4FJQ A;  5ILH A;  3WCM A;  2E92 A;  3WCF A;  3SDR A;  4RXD A;  5B0J A;  4QXS F;  3KRO B;  3WEI A;  3QQV A;  5IKA A;  5B03 A;  5B0L A;  5B0M A;  3NPR A;  5E8K A;  2J5C A;  4KPD A;  3ZMB A;  1HXG A;  5HNA A;  2ZY1 A;  4OGU A;  3WC9 A;  2OA6 A;  2ZCS A;  3RYW A;  1YYS A;  4KK2 A;  3DYG A;  3WCA A;  2E8U A;  5ERN A;  2FOR A;  2Z50 A;  3WJN A;  2ZCQ A;  3WEK A;  3NRI A;  3TC1 A;  1YV5 A;  3VJE A;  3RBM A;  1WL3 A;  4LFV F;  3ICK A;  3CKE A;  1N24 A;  2RAH A;  5IKH A;  4P0W A;  3ICM A;  4LTZ A;  4LXW A;  5JUZ F;  4LTV A;  5IK6 A;  3WEJ A;  3OAC B;  1N1B A;  4RXE A;  3N5H F;  3N45 F;  3ASX A;  3PKO A;  1V4H A;  2Z4Z A;  3KB9 A;  1UBV A;  3OYR A;  3N3D A;  4OMG A;  5B0I A;  4QPF A;  3LMD A;  3VJA A;  3SDV A;  1V4K A;  4MC0 A; 
#chains in the Genus database with same CATH homology
 3LGZ B;  4OKM A;  3KRF A;  3MZV A;  3KRP A;  3WCI A;  2Q9Y A;  4KFA A;  2PS5 A;  3P41 A;  3WCE A;  4LOB A;  3WJK A;  1VG6 A;  1HXA A;  3LZ9 A;  3VJ8 A;  2ZEU A;  4MC8 A;  3WJO A;  2P1C A;  3V1X A;  4DEM F;  1VG3 A;  2F92 F;  2J1P A;  1VG2 A;  5H9D A;  3LK5 A;  2ZCR A;  4WK5 A;  2OGD A;  4N1Z F;  4JZB A;  3G4D A;  1V4I A;  3ACY A;  2Z78 A;  3TFV A;  3VJB A;  2EWG A;  3NF2 A;  1YYR A;  3QKC A;  1HX9 A;  4HD1 A;  4DZW A;  4LZ3 A;  4NFI F;  5KSX F;  3G4F A;  3M01 A;  4KVW A;  2E94 A;  1KIZ A;  3SDU A;  3WSA A;  2Z4W A;  2AZK A;  4PVX F;  2AEL A;  2E8X A;  3N5J F;  2F9K F;  4H5D F;  3WSB A;  1UBW A;  1WKZ A;  2QIS A;  2ZCO A;  2I19 A;  5ILY A;  2AET A;  5B0K A;  5JV2 F;  1N20 A;  1DGP A;  5JV1 F;  3N0G A;  3PDE A;  3KRF B;  5IMP A;  3KRP B;  5ERO A;  5A0K A;  2DH4 A;  3APZ A;  1N1Z A;  3W7F A;  3N46 F;  5A0I A;  4GA3 A;  3V66 A;  4RYP A;  3N3L F;  3EFQ A;  5IK9 A;  4F6X A;  5DGM F;  4KVY A;  3N1W F;  4F6V A;  3OAB A;  2Z52 A;  4F62 A;  2Z4V A;  5HN7 A;  2F8Z F;  3EZ3 A;  1HM7 A;  2E95 A;  3AQ0 A;  3N6K F;  4DWB A;  4Q23 A;  4EA1 A;  3LVS A;  4JZX A;  2E93 A;  5JA0 F;  1YYU A;  4NG6 A;  3LLW A;  1V4J A;  3SAE A;  3WEH A;  3SDT A;  3TFN A;  4OMH A;  4P0V A;  4H5C F;  4GP2 A;  3BNY A;  4LUU A;  3AQC B;  5AEL A;  5AHU B;  2E91 A;  3VJD A;  3P8R A;  2ONG A;  4LLT A;  3CC9 A;  5DW7 A;  4NKE A;  4NUA A;  4NFK F;  1JFG A;  5ILZ A;  2AEK A;  5EAS A;  4RXC A;  1YQ7 A;  4LLS A;  3ADZ A;  4E1E A;  1HM4 A;  4JVJ F;  1ZW5 A;  5AFX A;  1N21 A;  4KKM A;  1EZF A;  1FPS A;  4H5E F;  2F89 F;  1JFA A;  1WMW A;  1YYQ A;  4FP4 A;  4XQR F;  3WCL A;  3OAB B;  3PYA A;  2OPM A;  3SDQ A;  3ICZ A;  4LA6 A;  3LDW A;  3M02 A;  1YYT A;  5DGS F;  4K10 A;  5CG5 A;  2E90 A;  4KQ5 A;  3DYH A;  1YHM A;  3P5P A;  5EAU A;  3Q30 A;  2Z4Y A;  4GP1 A;  2Q80 A;  1WY0 A;  4GAX A;  5B00 A;  2F8C F;  5ILI A;  3WCJ A;  1VG4 A;  2E8V A;  5DIQ F;  5ILJ A;  3BNX A;  4E9Z A;  5DHK A;  4LZC A;  5IN8 A;  5JV0 F;  4LIX A;  3ACW A;  2E8W A;  3TFP A;  5CG6 A;  3KBK A;  1WL2 A;  4LFE A;  3AE0 A;  3WEF A;  4PVY F;  3ID0 A;  4XQS F;  3Q2Z A;  4JYX A;  3ACX A;  4KQS A;  3OAC A;  3P8L A;  2Q9Z A;  3PH7 A;  5IVG A;  5B02 A;  3CP6 A;  2Q58 A;  3V1V A;  1V4E A;  1YJ4 A;  4DHD A;  2Z4X A;  3LEE A;  3WEG A;  1WL1 A;  4KUX A;  4KVD A;  2Z7H A;  1RQJ A;  3S9V A;  4N9U A;  5E8H A;  1RTR A;  5I1U A;  5ILD A;  3Q2Q A;  1N23 A;  1UBY A;  3M9U A;  2O1O A;  5B01 A;  3WCH A;  4RNQ A;  5HN8 A;  2H8O A;  4E9U A;  3N1V F;  3ZMC A;  5AYP A;  3N49 F;  3N0F A;  5DJV F;  1DI1 A;  4UMJ A;  3ZOU A;  1HXC A;  3WE9 A;  3M00 A;  1YHL A;  3EGT A;  3ICN A;  5DJR F;  3LSN A;  4DI5 A;  4L2X F;  3ZCD A;  5DJP F;  3PYB A;  5E8L A;  3S4J A;  2ZEV A;  3UCA A;  4ZQ8 A;  3WCG A;  4LFG A;  4LPG F;  2F7M F;  5ER8 A;  3LG5 A;  3ZL6 A;  1N22 A;  1RQI A;  3RYE A;  5ERM A;  5IK0 A;  5HN9 A;  3KRC A;  3KRA A;  4LA5 A;  4P0X A;  2F94 F;  4KWD A;  2AZL A;  2J1O A;  4KPJ A;  1KIY A;  4KQU A;  2Z7I A;  1YHK A;  2PS7 A;  2VF6 A;  1WL0 A;  3LOM A;  1VG7 A;  2OPN A;  3VJC A;  4MC3 A;  3KRO A;  4NKF A;  5DHI A;  5IL8 A;  3NPK A;  3B7L A;  3WCB A;  4DWG A;  3TS7 A;  5DGN F;  1PS1 A;  3IBA A;  5IMI A;  3DYF A;  3P5R A;  3WCD A;  2FTZ A;  4EA0 A;  4LPH F;  5IL3 A;  4NFJ F;  2PS6 A;  2PS8 A;  3AQB B;  2E4O A;  3LGK A;  5ILK A;  3WCC A;  4RXA A;  4XQT F;  1UBX A;  5DZ2 A;  5IM1 A;  4LZ0 A;  3M0G A;  3RMG A;  4DXJ A;  2E8T A;  4JXY A;  5A0J A;  4JXN A;  4OKZ A;  3KRC B;  2ONH A;  2AZJ A;  3KRA B;  3VJ9 A;  4EA2 A;  3IPI A;  4KVI A;  5EAT A;  3LJI A;  2PS4 A;  3MAV A;  5C05 A;  3Q1O A;  5IMN A;  4FJQ A;  5ILH A;  3WCM A;  2E92 A;  3WCF A;  3SDR A;  4RXD A;  5B0J A;  4QXS F;  3KRO B;  3WEI A;  3QQV A;  5IKA A;  5B03 A;  5B0L A;  5B0M A;  3NPR A;  5E8K A;  2J5C A;  4KPD A;  3ZMB A;  1HXG A;  5HNA A;  2ZY1 A;  4OGU A;  3WC9 A;  2OA6 A;  2ZCS A;  3RYW A;  1YYS A;  4KK2 A;  3DYG A;  3WCA A;  2E8U A;  5ERN A;  2FOR A;  2Z50 A;  3WJN A;  2ZCQ A;  3WEK A;  3NRI A;  3TC1 A;  1YV5 A;  3VJE A;  3RBM A;  1WL3 A;  4LFV F;  3ICK A;  3CKE A;  1N24 A;  2RAH A;  5IKH A;  4P0W A;  3ICM A;  4LTZ A;  4LXW A;  5JUZ F;  4LTV A;  5IK6 A;  3WEJ A;  3OAC B;  1N1B A;  4RXE A;  3N5H F;  3N45 F;  3ASX A;  3PKO A;  1V4H A;  2Z4Z A;  3KB9 A;  1UBV A;  3OYR A;  3N3D A;  4OMG A;  5B0I A;  4QPF A;  3LMD A;  3VJA A;  3SDV A;  1V4K A;  4MC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...