3VJEA

Crystal structure of the y248a mutant of c(30) carotenoid dehydrosqualene synthase from staphylococcus aureus in complex with zaragozic acid a
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIAIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Binding modes of zaragozic acid A to human squalene synthase and staphylococcal dehydrosqualene synthase
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 113
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2011-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3vjeA00
5JV0F 2ZCSA 5IL8A 5DGNF 4NFIF 4KKMA 3P8LA 1VG7A 2F89F 3OYRA 3ICMA 1YHMA 4KQSA 5IMIA 1V4IA 4OKMA 1DI1A 2Q9YA 2AZLA 2F7MF 5EATA 3V1VA 3VJAA 3KRAA 4KUXA 3LZ9A 4KQUA 5KSXF 2E92A 1YHLA 5DJVF 4LXWA 3LK5A 5DHKA 3TC1A 3KRFB 1WMWA 5IKHA 2VF6A 4JYXA 1FPSA 4NFKF 1VG4A 3LG5A 3RBMA 3KBKA 5B0KA 2Z52A 3EFQA 4LZ0A 5IMPA 2O1OA 3N0GA 5IVGA 3WEHA 3OACB 4PVXF 2FTZA 4MC3A 4ZQ8A 4FP4A 3Q1OA 4F6XA 3KRPB 4RXEA 4EA0A 4OMGA 3WCCA 3N6KF 3P8RA 4XQSF 4LFGA 3ACWA 3WCIA 5CG5A 5ILHA 1N22A 4P0VA 2ZCOA 2PS6A 4OMHA 3WEKA 5HN9A 3VJDA 3ZMBA 3SDQA 2PS4A 4JXNA 2Q9ZA 3KB9A 4JZBA 3WSBA 2ZEVA 3Q30A 2Z4ZA 3WJNA 3MZVA 5DGMF 3N5HF 5IK0A 4H5EF 3UCAA 3V1XA 1HM7A 1UBYA 4DI5A 4N1ZF 4KFAA 2E8UA 3SAEA 5JUZF 3KRCA 2AZKA 2Z7HA 3PKOA 4RXCA 1YYQA 1VG2A 3KRFA 1PS1A 5ILZA 5IM1A 5IMNA 4LFVF 5B0JA 3SDVA 2Q58A 3M0GA 3N0FA 4E9UA 5HNAA 2DH4A 4H5DF 3WSAA 5ILYA 2AETA 3S9VA 4LLSA 3OABB 3LJIA 3AQCB 3LSNA 3CC9A 4P0WA 2E94A 5B0LA 4NG6A 3KRPA 3P5RA 3BNYA 4NUAA 1N1BA 5I1UA 4RNQA 1UBVA 5IN8A 1RTRA 4KPJA 3KROB 2F94F 3N45F 3DYFA 3WCHA 4L2XF 3N1WF 2FORA 1UBXA 5ER8A 4LTZA 3P41A 5H9DA 1KIZA 3Q2QA 3AE0A 4KVYA 3ADZA 3TFVA 1N20A 4LOBA 2Z4YA 4RXDA 2ZCQA 5AFXA 3ACXA 2OA6A 4KVWA 3IPIA 3LOMA 2OGDA 5ILJA 3LLWA 4EA2A 4NKFA 2J1OA 3B7LA 4F62A 5C05A 2E4OA 5HN8A 3PYAA 4KK2A 1V4KA 2PS5A 5EROA 3WE9A 4LZCA 2E95A 3NPKA 3WCMA 2ZY1A 4KVIA 3WCEA 2OPMA 5DHIA 3TFPA 3NF2A 1V4HA 4QXSF 3AQBB 3WCGA 2Q80A 1ZW5A 3VJ8A 3M00A 3PYBA 3KRAB 1RQJA 3AQ0A 2P1CA 5E8HA 5DGSF 2E91A 3ZCDA 3TFNA 2H8OA 3VJ9A 3N1VF 3WEFA 4GA3A 4LTVA 3VJCA 1WKZA 4OGUA 3OABA 3LEEA 5ERNA 1WL3A 5JA0F 3RYWA 3LDWA 2ONHA 5ILDA 3LGZB 3EGTA 1HXCA 2ONGA 5DW7A 2E8VA 4XQTF 2Z7IA 2J5CA 4KPDA 5JV1F 3SDTA 4UMJA 4RYPA 5E8LA 2Z4VA 1WL2A 2E8TA 3RMGA 3KROA 3N3LF 3V66A 2RAHA 3ICKA 2EWGA 3WC9A 4DHDA 1YV5A 5B01A 3M9UA 5E8KA 3BNXA 3PDEA 3DYHA 2F8ZF 5B02A 1YYRA 3N5JF 2E8XA 4XQRF 3W7FA 5ERMA 4GP1A 5B00A 3SDUA 2AELA 3VJEA 2Z50A 3OACA 4JVJF 2ZEUA 3G4FA 1HXGA 5IK6A 1YYSA 3APZA 5CG6A 5ILIA 4FJQA 5AYPA 5ILKA 3LVSA 5IK9A 4H5CF 4GP2A 3N49F 3PH7A 4GAXA 5B0MA 2F9KF 1WL0A 3WEGA 3ACYA 3WEJA 4QPFA 3CP6A 4LFEA 3WCBA 3SDRA 5JV2F 4LA5A 3VJBA 5DJPF 3NRIA 3LGKA 5EAUA 4E1EA 1N21A 3KRCB 4PVYF 2E93A 4KQ5A 4RXAA 2AEKA 5IKAA 5A0IA 3M01A 2I19A 4HD1A 1EZFA 4LPHF 5AHUB 4E9ZA 4DWBA 2F8CF 3WCDA 3ASXA 3CKEA 2ZCRA 3ID0A 3Q2ZA 5HN7A 1N24A 3P5PA 1N1ZA 3WEIA 3EZ3A 2J1PA 5EASA 2E8WA 1V4JA 2Z4WA 3S4JA 3ZMCA 3ZOUA 1VG6A 4LLTA 4WK5A 2E90A 4LPGF 3G4DA 3WJOA 4DZWA 3N3DA 5DZ2A 4LA6A 1WL1A 3N46F 1V4EA 1JFAA 4N9UA 4K10A 1VG3A 4LUUA 4NFJF 2PS7A 2PS8A 3WCLA 4KWDA 5A0KA 4JXYA 4MC0A 1YJ4A 3WCFA 4NKEA 1UBWA 2AZJA 3TS7A 3WJKA 3LMDA 5DJRF 4F6VA 4DEMF 5AELA 1YHKA 4LZ3A 1JFGA 1RQIA 2F92F 2Z78A 3QQVA 1YYTA 1WY0A 3DYGA 4P0XA 5IL3A 5DIQF 2Z4XA 4OKZA 3IBAA 3RYEA 5A0JA 1N23A 1YYUA 1HXAA 2OPNA 5B03A 4KVDA 3MAVA 1HM4A 3ICNA 4DWGA 4DXJA 3NPRA 1YQ7A 1DGPA 4MC8A 1KIYA 3WCJA 2QISA 4Q23A 4LIXA 5B0IA 3QKCA 1HX9A 4EA1A 4JZXA 3WCAA 3ZL6A 3M02A 3ICZA
chains in the Genus database with same CATH superfamily
5JV0F 2ZCSA 5IL8A 5DGNF 4NFIF 4KKMA 3P8LA 1VG7A 2F89F 3OYRA 3ICMA 1YHMA 4KQSA 5IMIA 1V4IA 4OKMA 1DI1A 2Q9YA 2AZLA 2F7MF 5EATA 3V1VA 3VJAA 3KRAA 4KUXA 3LZ9A 4KQUA 5KSXF 2E92A 1YHLA 5DJVF 4LXWA 3LK5A 5DHKA 3TC1A 3KRFB 1WMWA 5IKHA 2VF6A 4JYXA 1FPSA 4NFKF 1VG4A 3LG5A 3RBMA 3KBKA 5B0KA 2Z52A 3EFQA 4LZ0A 5IMPA 2O1OA 3N0GA 5IVGA 3WEHA 3OACB 4PVXF 2FTZA 4MC3A 4ZQ8A 4FP4A 3Q1OA 4F6XA 3KRPB 4RXEA 4EA0A 4OMGA 3WCCA 3N6KF 3P8RA 4XQSF 4LFGA 3ACWA 3WCIA 5CG5A 5ILHA 1N22A 4P0VA 2ZCOA 2PS6A 4OMHA 3WEKA 5HN9A 3VJDA 3ZMBA 3SDQA 2PS4A 4JXNA 2Q9ZA 3KB9A 4JZBA 3WSBA 2ZEVA 3Q30A 2Z4ZA 3WJNA 3MZVA 5DGMF 3N5HF 5IK0A 4H5EF 3UCAA 3V1XA 1HM7A 1UBYA 4DI5A 4N1ZF 4KFAA 2E8UA 3SAEA 5JUZF 3KRCA 2AZKA 2Z7HA 3PKOA 4RXCA 1YYQA 1VG2A 3KRFA 1PS1A 5ILZA 5IM1A 5IMNA 4LFVF 5B0JA 3SDVA 2Q58A 3M0GA 3N0FA 4E9UA 5HNAA 2DH4A 4H5DF 3WSAA 5ILYA 2AETA 3S9VA 4LLSA 3OABB 3LJIA 3AQCB 3LSNA 3CC9A 4P0WA 2E94A 5B0LA 4NG6A 3KRPA 3P5RA 3BNYA 4NUAA 1N1BA 5I1UA 4RNQA 1UBVA 5IN8A 1RTRA 4KPJA 3KROB 2F94F 3N45F 3DYFA 3WCHA 4L2XF 3N1WF 2FORA 1UBXA 5ER8A 4LTZA 3P41A 5H9DA 1KIZA 3Q2QA 3AE0A 4KVYA 3ADZA 3TFVA 1N20A 4LOBA 2Z4YA 4RXDA 2ZCQA 5AFXA 3ACXA 2OA6A 4KVWA 3IPIA 3LOMA 2OGDA 5ILJA 3LLWA 4EA2A 4NKFA 2J1OA 3B7LA 4F62A 5C05A 2E4OA 5HN8A 3PYAA 4KK2A 1V4KA 2PS5A 5EROA 3WE9A 4LZCA 2E95A 3NPKA 3WCMA 2ZY1A 4KVIA 3WCEA 2OPMA 5DHIA 3TFPA 3NF2A 1V4HA 4QXSF 3AQBB 3WCGA 2Q80A 1ZW5A 3VJ8A 3M00A 3PYBA 3KRAB 1RQJA 3AQ0A 2P1CA 5E8HA 5DGSF 2E91A 3ZCDA 3TFNA 2H8OA 3VJ9A 3N1VF 3WEFA 4GA3A 4LTVA 3VJCA 1WKZA 4OGUA 3OABA 3LEEA 5ERNA 1WL3A 5JA0F 3RYWA 3LDWA 2ONHA 5ILDA 3LGZB 3EGTA 1HXCA 2ONGA 5DW7A 2E8VA 4XQTF 2Z7IA 2J5CA 4KPDA 5JV1F 3SDTA 4UMJA 4RYPA 5E8LA 2Z4VA 1WL2A 2E8TA 3RMGA 3KROA 3N3LF 3V66A 2RAHA 3ICKA 2EWGA 3WC9A 4DHDA 1YV5A 5B01A 3M9UA 5E8KA 3BNXA 3PDEA 3DYHA 2F8ZF 5B02A 1YYRA 3N5JF 2E8XA 4XQRF 3W7FA 5ERMA 4GP1A 5B00A 3SDUA 2AELA 3VJEA 2Z50A 3OACA 4JVJF 2ZEUA 3G4FA 1HXGA 5IK6A 1YYSA 3APZA 5CG6A 5ILIA 4FJQA 5AYPA 5ILKA 3LVSA 5IK9A 4H5CF 4GP2A 3N49F 3PH7A 4GAXA 5B0MA 2F9KF 1WL0A 3WEGA 3ACYA 3WEJA 4QPFA 3CP6A 4LFEA 3WCBA 3SDRA 5JV2F 4LA5A 3VJBA 5DJPF 3NRIA 3LGKA 5EAUA 4E1EA 1N21A 3KRCB 4PVYF 2E93A 4KQ5A 4RXAA 2AEKA 5IKAA 5A0IA 3M01A 2I19A 4HD1A 1EZFA 4LPHF 5AHUB 4E9ZA 4DWBA 2F8CF 3WCDA 3ASXA 3CKEA 2ZCRA 3ID0A 3Q2ZA 5HN7A 1N24A 3P5PA 1N1ZA 3WEIA 3EZ3A 2J1PA 5EASA 2E8WA 1V4JA 2Z4WA 3S4JA 3ZMCA 3ZOUA 1VG6A 4LLTA 4WK5A 2E90A 4LPGF 3G4DA 3WJOA 4DZWA 3N3DA 5DZ2A 4LA6A 1WL1A 3N46F 1V4EA 1JFAA 4N9UA 4K10A 1VG3A 4LUUA 4NFJF 2PS7A 2PS8A 3WCLA 4KWDA 5A0KA 4JXYA 4MC0A 1YJ4A 3WCFA 4NKEA 1UBWA 2AZJA 3TS7A 3WJKA 3LMDA 5DJRF 4F6VA 4DEMF 5AELA 1YHKA 4LZ3A 1JFGA 1RQIA 2F92F 2Z78A 3QQVA 1YYTA 1WY0A 3DYGA 4P0XA 5IL3A 5DIQF 2Z4XA 4OKZA 3IBAA 3RYEA 5A0JA 1N23A 1YYUA 1HXAA 2OPNA 5B03A 4KVDA 3MAVA 1HM4A 3ICNA 4DWGA 4DXJA 3NPRA 1YQ7A 1DGPA 4MC8A 1KIYA 3WCJA 2QISA 4Q23A 4LIXA 5B0IA 3QKCA 1HX9A 4EA1A 4JZXA 3WCAA 3ZL6A 3M02A 3ICZA
chains in the Genus database with same CATH topology
5JV0F 2ZCSA 5IL8A 5DGNF 4NFIF 4KKMA 3P8LA 1VG7A 2F89F 3OYRA 3ICMA 1YHMA 4KQSA 5IMIA 1V4IA 4OKMA 1DI1A 2Q9YA 2AZLA 2F7MF 5EATA 3V1VA 3VJAA 3KRAA 4KUXA 3LZ9A 4KQUA 5KSXF 2E92A 1YHLA 5DJVF 4LXWA 3LK5A 5DHKA 3TC1A 3KRFB 1WMWA 5IKHA 2VF6A 4JYXA 1FPSA 4NFKF 1VG4A 3LG5A 3RBMA 3KBKA 5B0KA 2Z52A 3EFQA 4LZ0A 5IMPA 2O1OA 3N0GA 5IVGA 3WEHA 3OACB 4PVXF 2FTZA 4MC3A 4ZQ8A 4FP4A 3Q1OA 4F6XA 3KRPB 4RXEA 4EA0A 4OMGA 3WCCA 3N6KF 3P8RA 4XQSF 4LFGA 3ACWA 3WCIA 5CG5A 5ILHA 1N22A 4P0VA 2ZCOA 2PS6A 4OMHA 3WEKA 5HN9A 3VJDA 3ZMBA 3SDQA 2PS4A 4JXNA 2Q9ZA 3KB9A 4JZBA 3WSBA 2ZEVA 3Q30A 2Z4ZA 3WJNA 3MZVA 5DGMF 3N5HF 5IK0A 4H5EF 3UCAA 3V1XA 1HM7A 1UBYA 4DI5A 4N1ZF 4KFAA 2E8UA 3SAEA 5JUZF 3KRCA 2AZKA 2Z7HA 3PKOA 4RXCA 1YYQA 1VG2A 3KRFA 1PS1A 5ILZA 5IM1A 5IMNA 4LFVF 5B0JA 3SDVA 2Q58A 3M0GA 3N0FA 4E9UA 5HNAA 2DH4A 4H5DF 3WSAA 5ILYA 2AETA 3S9VA 4LLSA 3OABB 3LJIA 3AQCB 3LSNA 3CC9A 4P0WA 2E94A 5B0LA 4NG6A 3KRPA 3P5RA 3BNYA 4NUAA 1N1BA 5I1UA 4RNQA 1UBVA 5IN8A 1RTRA 4KPJA 3KROB 2F94F 3N45F 3DYFA 3WCHA 4L2XF 3N1WF 2FORA 1UBXA 5ER8A 4LTZA 3P41A 5H9DA 1KIZA 3Q2QA 3AE0A 4KVYA 3ADZA 3TFVA 1N20A 4LOBA 2Z4YA 4RXDA 2ZCQA 5AFXA 3ACXA 2OA6A 4KVWA 3IPIA 3LOMA 2OGDA 5ILJA 3LLWA 4EA2A 4NKFA 2J1OA 3B7LA 4F62A 5C05A 2E4OA 5HN8A 3PYAA 4KK2A 1V4KA 2PS5A 5EROA 3WE9A 4LZCA 2E95A 3NPKA 3WCMA 2ZY1A 4KVIA 3WCEA 2OPMA 5DHIA 3TFPA 3NF2A 1V4HA 4QXSF 3AQBB 3WCGA 2Q80A 1ZW5A 3VJ8A 3M00A 3PYBA 3KRAB 1RQJA 3AQ0A 2P1CA 5E8HA 5DGSF 2E91A 3ZCDA 3TFNA 2H8OA 3VJ9A 3N1VF 3WEFA 4GA3A 4LTVA 3VJCA 1WKZA 4OGUA 3OABA 3LEEA 5ERNA 1WL3A 5JA0F 3RYWA 3LDWA 2ONHA 5ILDA 3LGZB 3EGTA 1HXCA 2ONGA 5DW7A 2E8VA 4XQTF 2Z7IA 2J5CA 4KPDA 5JV1F 3SDTA 4UMJA 4RYPA 5E8LA 2Z4VA 1WL2A 2E8TA 3RMGA 3KROA 3N3LF 3V66A 2RAHA 3ICKA 2EWGA 3WC9A 4DHDA 1YV5A 5B01A 3M9UA 5E8KA 3BNXA 3PDEA 3DYHA 2F8ZF 5B02A 1YYRA 3N5JF 2E8XA 4XQRF 3W7FA 5ERMA 4GP1A 5B00A 3SDUA 2AELA 3VJEA 2Z50A 3OACA 4JVJF 2ZEUA 3G4FA 1HXGA 5IK6A 1YYSA 3APZA 5CG6A 5ILIA 4FJQA 5AYPA 5ILKA 3LVSA 5IK9A 4H5CF 4GP2A 3N49F 3PH7A 4GAXA 5B0MA 2F9KF 1WL0A 3WEGA 3ACYA 3WEJA 4QPFA 3CP6A 4LFEA 3WCBA 3SDRA 5JV2F 4LA5A 3VJBA 5DJPF 3NRIA 3LGKA 5EAUA 4E1EA 1N21A 3KRCB 4PVYF 2E93A 4KQ5A 4RXAA 2AEKA 5IKAA 5A0IA 3M01A 2I19A 4HD1A 1EZFA 4LPHF 5AHUB 4E9ZA 4DWBA 2F8CF 3WCDA 3ASXA 3CKEA 2ZCRA 3ID0A 3Q2ZA 5HN7A 1N24A 3P5PA 1N1ZA 3WEIA 3EZ3A 2J1PA 5EASA 2E8WA 1V4JA 2Z4WA 3S4JA 3ZMCA 3ZOUA 1VG6A 4LLTA 4WK5A 2E90A 4LPGF 3G4DA 3WJOA 4DZWA 3N3DA 5DZ2A 4LA6A 1WL1A 3N46F 1V4EA 1JFAA 4N9UA 4K10A 1VG3A 4LUUA 4NFJF 2PS7A 2PS8A 3WCLA 4KWDA 5A0KA 4JXYA 4MC0A 1YJ4A 3WCFA 4NKEA 1UBWA 2AZJA 3TS7A 3WJKA 3LMDA 5DJRF 4F6VA 4DEMF 5AELA 1YHKA 4LZ3A 1JFGA 1RQIA 2F92F 2Z78A 3QQVA 1YYTA 1WY0A 3DYGA 4P0XA 5IL3A 5DIQF 2Z4XA 4OKZA 3IBAA 3RYEA 5A0JA 1N23A 1YYUA 1HXAA 2OPNA 5B03A 4KVDA 3MAVA 1HM4A 3ICNA 4DWGA 4DXJA 3NPRA 1YQ7A 1DGPA 4MC8A 1KIYA 3WCJA 2QISA 4Q23A 4LIXA 5B0IA 3QKCA 1HX9A 4EA1A 4JZXA 3WCAA 3ZL6A 3M02A 3ICZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JV0 F;  2ZCS A;  5IL8 A;  5DGN F;  4NFI F;  4KKM A;  3P8L A;  1VG7 A;  2F89 F;  3OYR A;  3ICM A;  1YHM A;  4KQS A;  5IMI A;  1V4I A;  4OKM A;  1DI1 A;  2Q9Y A;  2AZL A;  2F7M F;  5EAT A;  3V1V A;  3VJA A;  3KRA A;  4KUX A;  3LZ9 A;  4KQU A;  5KSX F;  2E92 A;  1YHL A;  5DJV F;  4LXW A;  3LK5 A;  5DHK A;  3TC1 A;  3KRF B;  1WMW A;  5IKH A;  2VF6 A;  4JYX A;  1FPS A;  4NFK F;  1VG4 A;  3LG5 A;  3RBM A;  3KBK A;  5B0K A;  2Z52 A;  3EFQ A;  4LZ0 A;  5IMP A;  2O1O A;  3N0G A;  5IVG A;  3WEH A;  3OAC B;  4PVX F;  2FTZ A;  4MC3 A;  4ZQ8 A;  4FP4 A;  3Q1O A;  4F6X A;  3KRP B;  4RXE A;  4EA0 A;  4OMG A;  3WCC A;  3N6K F;  3P8R A;  4XQS F;  4LFG A;  3ACW A;  3WCI A;  5CG5 A;  5ILH A;  1N22 A;  4P0V A;  2ZCO A;  2PS6 A;  4OMH A;  3WEK A;  5HN9 A;  3VJD A;  3ZMB A;  3SDQ A;  2PS4 A;  4JXN A;  2Q9Z A;  3KB9 A;  4JZB A;  3WSB A;  2ZEV A;  3Q30 A;  2Z4Z A;  3WJN A;  3MZV A;  5DGM F;  3N5H F;  5IK0 A;  4H5E F;  3UCA A;  3V1X A;  1HM7 A;  1UBY A;  4DI5 A;  4N1Z F;  4KFA A;  2E8U A;  3SAE A;  5JUZ F;  3KRC A;  2AZK A;  2Z7H A;  3PKO A;  4RXC A;  1YYQ A;  1VG2 A;  3KRF A;  1PS1 A;  5ILZ A;  5IM1 A;  5IMN A;  4LFV F;  5B0J A;  3SDV A;  2Q58 A;  3M0G A;  3N0F A;  4E9U A;  5HNA A;  2DH4 A;  4H5D F;  3WSA A;  5ILY A;  2AET A;  3S9V A;  4LLS A;  3OAB B;  3LJI A;  3AQC B;  3LSN A;  3CC9 A;  4P0W A;  2E94 A;  5B0L A;  4NG6 A;  3KRP A;  3P5R A;  3BNY A;  4NUA A;  1N1B A;  5I1U A;  4RNQ A;  1UBV A;  5IN8 A;  1RTR A;  4KPJ A;  3KRO B;  2F94 F;  3N45 F;  3DYF A;  3WCH A;  4L2X F;  3N1W F;  2FOR A;  1UBX A;  5ER8 A;  4LTZ A;  3P41 A;  5H9D A;  1KIZ A;  3Q2Q A;  3AE0 A;  4KVY A;  3ADZ A;  3TFV A;  1N20 A;  4LOB A;  2Z4Y A;  4RXD A;  2ZCQ A;  5AFX A;  3ACX A;  2OA6 A;  4KVW A;  3IPI A;  3LOM A;  2OGD A;  5ILJ A;  3LLW A;  4EA2 A;  4NKF A;  2J1O A;  3B7L A;  4F62 A;  5C05 A;  2E4O A;  5HN8 A;  3PYA A;  4KK2 A;  1V4K A;  2PS5 A;  5ERO A;  3WE9 A;  4LZC A;  2E95 A;  3NPK A;  3WCM A;  2ZY1 A;  4KVI A;  3WCE A;  2OPM A;  5DHI A;  3TFP A;  3NF2 A;  1V4H A;  4QXS F;  3AQB B;  3WCG A;  2Q80 A;  1ZW5 A;  3VJ8 A;  3M00 A;  3PYB A;  3KRA B;  1RQJ A;  3AQ0 A;  2P1C A;  5E8H A;  5DGS F;  2E91 A;  3ZCD A;  3TFN A;  2H8O A;  3VJ9 A;  3N1V F;  3WEF A;  4GA3 A;  4LTV A;  3VJC A;  1WKZ A;  4OGU A;  3OAB A;  3LEE A;  5ERN A;  1WL3 A;  5JA0 F;  3RYW A;  3LDW A;  2ONH A;  5ILD A;  3LGZ B;  3EGT A;  1HXC A;  2ONG A;  5DW7 A;  2E8V A;  4XQT F;  2Z7I A;  2J5C A;  4KPD A;  5JV1 F;  3SDT A;  4UMJ A;  4RYP A;  5E8L A;  2Z4V A;  1WL2 A;  2E8T A;  3RMG A;  3KRO A;  3N3L F;  3V66 A;  2RAH A;  3ICK A;  2EWG A;  3WC9 A;  4DHD A;  1YV5 A;  5B01 A;  3M9U A;  5E8K A;  3BNX A;  3PDE A;  3DYH A;  2F8Z F;  5B02 A;  1YYR A;  3N5J F;  2E8X A;  4XQR F;  3W7F A;  5ERM A;  4GP1 A;  5B00 A;  3SDU A;  2AEL A;  3VJE A;  2Z50 A;  3OAC A;  4JVJ F;  2ZEU A;  3G4F A;  1HXG A;  5IK6 A;  1YYS A;  3APZ A;  5CG6 A;  5ILI A;  4FJQ A;  5AYP A;  5ILK A;  3LVS A;  5IK9 A;  4H5C F;  4GP2 A;  3N49 F;  3PH7 A;  4GAX A;  5B0M A;  2F9K F;  1WL0 A;  3WEG A;  3ACY A;  3WEJ A;  4QPF A;  3CP6 A;  4LFE A;  3WCB A;  3SDR A;  5JV2 F;  4LA5 A;  3VJB A;  5DJP F;  3NRI A;  3LGK A;  5EAU A;  4E1E A;  1N21 A;  3KRC B;  4PVY F;  2E93 A;  4KQ5 A;  4RXA A;  2AEK A;  5IKA A;  5A0I A;  3M01 A;  2I19 A;  4HD1 A;  1EZF A;  4LPH F;  5AHU B;  4E9Z A;  4DWB A;  2F8C F;  3WCD A;  3ASX A;  3CKE A;  2ZCR A;  3ID0 A;  3Q2Z A;  5HN7 A;  1N24 A;  3P5P A;  1N1Z A;  3WEI A;  3EZ3 A;  2J1P A;  5EAS A;  2E8W A;  1V4J A;  2Z4W A;  3S4J A;  3ZMC A;  3ZOU A;  1VG6 A;  4LLT A;  4WK5 A;  2E90 A;  4LPG F;  3G4D A;  3WJO A;  4DZW A;  3N3D A;  5DZ2 A;  4LA6 A;  1WL1 A;  3N46 F;  1V4E A;  1JFA A;  4N9U A;  4K10 A;  1VG3 A;  4LUU A;  4NFJ F;  2PS7 A;  2PS8 A;  3WCL A;  4KWD A;  5A0K A;  4JXY A;  4MC0 A;  1YJ4 A;  3WCF A;  4NKE A;  1UBW A;  2AZJ A;  3TS7 A;  3WJK A;  3LMD A;  5DJR F;  4F6V A;  4DEM F;  5AEL A;  1YHK A;  4LZ3 A;  1JFG A;  1RQI A;  2F92 F;  2Z78 A;  3QQV A;  1YYT A;  1WY0 A;  3DYG A;  4P0X A;  5IL3 A;  5DIQ F;  2Z4X A;  4OKZ A;  3IBA A;  3RYE A;  5A0J A;  1N23 A;  1YYU A;  1HXA A;  2OPN A;  5B03 A;  4KVD A;  3MAV A;  1HM4 A;  3ICN A;  4DWG A;  4DXJ A;  3NPR A;  1YQ7 A;  1DGP A;  4MC8 A;  1KIY A;  3WCJ A;  2QIS A;  4Q23 A;  4LIX A;  5B0I A;  3QKC A;  1HX9 A;  4EA1 A;  4JZX A;  3WCA A;  3ZL6 A;  3M02 A;  3ICZ A; 
#chains in the Genus database with same CATH topology
 5JV0 F;  2ZCS A;  5IL8 A;  5DGN F;  4NFI F;  4KKM A;  3P8L A;  1VG7 A;  2F89 F;  3OYR A;  3ICM A;  1YHM A;  4KQS A;  5IMI A;  1V4I A;  4OKM A;  1DI1 A;  2Q9Y A;  2AZL A;  2F7M F;  5EAT A;  3V1V A;  3VJA A;  3KRA A;  4KUX A;  3LZ9 A;  4KQU A;  5KSX F;  2E92 A;  1YHL A;  5DJV F;  4LXW A;  3LK5 A;  5DHK A;  3TC1 A;  3KRF B;  1WMW A;  5IKH A;  2VF6 A;  4JYX A;  1FPS A;  4NFK F;  1VG4 A;  3LG5 A;  3RBM A;  3KBK A;  5B0K A;  2Z52 A;  3EFQ A;  4LZ0 A;  5IMP A;  2O1O A;  3N0G A;  5IVG A;  3WEH A;  3OAC B;  4PVX F;  2FTZ A;  4MC3 A;  4ZQ8 A;  4FP4 A;  3Q1O A;  4F6X A;  3KRP B;  4RXE A;  4EA0 A;  4OMG A;  3WCC A;  3N6K F;  3P8R A;  4XQS F;  4LFG A;  3ACW A;  3WCI A;  5CG5 A;  5ILH A;  1N22 A;  4P0V A;  2ZCO A;  2PS6 A;  4OMH A;  3WEK A;  5HN9 A;  3VJD A;  3ZMB A;  3SDQ A;  2PS4 A;  4JXN A;  2Q9Z A;  3KB9 A;  4JZB A;  3WSB A;  2ZEV A;  3Q30 A;  2Z4Z A;  3WJN A;  3MZV A;  5DGM F;  3N5H F;  5IK0 A;  4H5E F;  3UCA A;  3V1X A;  1HM7 A;  1UBY A;  4DI5 A;  4N1Z F;  4KFA A;  2E8U A;  3SAE A;  5JUZ F;  3KRC A;  2AZK A;  2Z7H A;  3PKO A;  4RXC A;  1YYQ A;  1VG2 A;  3KRF A;  1PS1 A;  5ILZ A;  5IM1 A;  5IMN A;  4LFV F;  5B0J A;  3SDV A;  2Q58 A;  3M0G A;  3N0F A;  4E9U A;  5HNA A;  2DH4 A;  4H5D F;  3WSA A;  5ILY A;  2AET A;  3S9V A;  4LLS A;  3OAB B;  3LJI A;  3AQC B;  3LSN A;  3CC9 A;  4P0W A;  2E94 A;  5B0L A;  4NG6 A;  3KRP A;  3P5R A;  3BNY A;  4NUA A;  1N1B A;  5I1U A;  4RNQ A;  1UBV A;  5IN8 A;  1RTR A;  4KPJ A;  3KRO B;  2F94 F;  3N45 F;  3DYF A;  3WCH A;  4L2X F;  3N1W F;  2FOR A;  1UBX A;  5ER8 A;  4LTZ A;  3P41 A;  5H9D A;  1KIZ A;  3Q2Q A;  3AE0 A;  4KVY A;  3ADZ A;  3TFV A;  1N20 A;  4LOB A;  2Z4Y A;  4RXD A;  2ZCQ A;  5AFX A;  3ACX A;  2OA6 A;  4KVW A;  3IPI A;  3LOM A;  2OGD A;  5ILJ A;  3LLW A;  4EA2 A;  4NKF A;  2J1O A;  3B7L A;  4F62 A;  5C05 A;  2E4O A;  5HN8 A;  3PYA A;  4KK2 A;  1V4K A;  2PS5 A;  5ERO A;  3WE9 A;  4LZC A;  2E95 A;  3NPK A;  3WCM A;  2ZY1 A;  4KVI A;  3WCE A;  2OPM A;  5DHI A;  3TFP A;  3NF2 A;  1V4H A;  4QXS F;  3AQB B;  3WCG A;  2Q80 A;  1ZW5 A;  3VJ8 A;  3M00 A;  3PYB A;  3KRA B;  1RQJ A;  3AQ0 A;  2P1C A;  5E8H A;  5DGS F;  2E91 A;  3ZCD A;  3TFN A;  2H8O A;  3VJ9 A;  3N1V F;  3WEF A;  4GA3 A;  4LTV A;  3VJC A;  1WKZ A;  4OGU A;  3OAB A;  3LEE A;  5ERN A;  1WL3 A;  5JA0 F;  3RYW A;  3LDW A;  2ONH A;  5ILD A;  3LGZ B;  3EGT A;  1HXC A;  2ONG A;  5DW7 A;  2E8V A;  4XQT F;  2Z7I A;  2J5C A;  4KPD A;  5JV1 F;  3SDT A;  4UMJ A;  4RYP A;  5E8L A;  2Z4V A;  1WL2 A;  2E8T A;  3RMG A;  3KRO A;  3N3L F;  3V66 A;  2RAH A;  3ICK A;  2EWG A;  3WC9 A;  4DHD A;  1YV5 A;  5B01 A;  3M9U A;  5E8K A;  3BNX A;  3PDE A;  3DYH A;  2F8Z F;  5B02 A;  1YYR A;  3N5J F;  2E8X A;  4XQR F;  3W7F A;  5ERM A;  4GP1 A;  5B00 A;  3SDU A;  2AEL A;  3VJE A;  2Z50 A;  3OAC A;  4JVJ F;  2ZEU A;  3G4F A;  1HXG A;  5IK6 A;  1YYS A;  3APZ A;  5CG6 A;  5ILI A;  4FJQ A;  5AYP A;  5ILK A;  3LVS A;  5IK9 A;  4H5C F;  4GP2 A;  3N49 F;  3PH7 A;  4GAX A;  5B0M A;  2F9K F;  1WL0 A;  3WEG A;  3ACY A;  3WEJ A;  4QPF A;  3CP6 A;  4LFE A;  3WCB A;  3SDR A;  5JV2 F;  4LA5 A;  3VJB A;  5DJP F;  3NRI A;  3LGK A;  5EAU A;  4E1E A;  1N21 A;  3KRC B;  4PVY F;  2E93 A;  4KQ5 A;  4RXA A;  2AEK A;  5IKA A;  5A0I A;  3M01 A;  2I19 A;  4HD1 A;  1EZF A;  4LPH F;  5AHU B;  4E9Z A;  4DWB A;  2F8C F;  3WCD A;  3ASX A;  3CKE A;  2ZCR A;  3ID0 A;  3Q2Z A;  5HN7 A;  1N24 A;  3P5P A;  1N1Z A;  3WEI A;  3EZ3 A;  2J1P A;  5EAS A;  2E8W A;  1V4J A;  2Z4W A;  3S4J A;  3ZMC A;  3ZOU A;  1VG6 A;  4LLT A;  4WK5 A;  2E90 A;  4LPG F;  3G4D A;  3WJO A;  4DZW A;  3N3D A;  5DZ2 A;  4LA6 A;  1WL1 A;  3N46 F;  1V4E A;  1JFA A;  4N9U A;  4K10 A;  1VG3 A;  4LUU A;  4NFJ F;  2PS7 A;  2PS8 A;  3WCL A;  4KWD A;  5A0K A;  4JXY A;  4MC0 A;  1YJ4 A;  3WCF A;  4NKE A;  1UBW A;  2AZJ A;  3TS7 A;  3WJK A;  3LMD A;  5DJR F;  4F6V A;  4DEM F;  5AEL A;  1YHK A;  4LZ3 A;  1JFG A;  1RQI A;  2F92 F;  2Z78 A;  3QQV A;  1YYT A;  1WY0 A;  3DYG A;  4P0X A;  5IL3 A;  5DIQ F;  2Z4X A;  4OKZ A;  3IBA A;  3RYE A;  5A0J A;  1N23 A;  1YYU A;  1HXA A;  2OPN A;  5B03 A;  4KVD A;  3MAV A;  1HM4 A;  3ICN A;  4DWG A;  4DXJ A;  3NPR A;  1YQ7 A;  1DGP A;  4MC8 A;  1KIY A;  3WCJ A;  2QIS A;  4Q23 A;  4LIX A;  5B0I A;  3QKC A;  1HX9 A;  4EA1 A;  4JZX A;  3WCA A;  3ZL6 A;  3M02 A;  3ICZ A; 
#chains in the Genus database with same CATH homology
 5JV0 F;  2ZCS A;  5IL8 A;  5DGN F;  4NFI F;  4KKM A;  3P8L A;  1VG7 A;  2F89 F;  3OYR A;  3ICM A;  1YHM A;  4KQS A;  5IMI A;  1V4I A;  4OKM A;  1DI1 A;  2Q9Y A;  2AZL A;  2F7M F;  5EAT A;  3V1V A;  3VJA A;  3KRA A;  4KUX A;  3LZ9 A;  4KQU A;  5KSX F;  2E92 A;  1YHL A;  5DJV F;  4LXW A;  3LK5 A;  5DHK A;  3TC1 A;  3KRF B;  1WMW A;  5IKH A;  2VF6 A;  4JYX A;  1FPS A;  4NFK F;  1VG4 A;  3LG5 A;  3RBM A;  3KBK A;  5B0K A;  2Z52 A;  3EFQ A;  4LZ0 A;  5IMP A;  2O1O A;  3N0G A;  5IVG A;  3WEH A;  3OAC B;  4PVX F;  2FTZ A;  4MC3 A;  4ZQ8 A;  4FP4 A;  3Q1O A;  4F6X A;  3KRP B;  4RXE A;  4EA0 A;  4OMG A;  3WCC A;  3N6K F;  3P8R A;  4XQS F;  4LFG A;  3ACW A;  3WCI A;  5CG5 A;  5ILH A;  1N22 A;  4P0V A;  2ZCO A;  2PS6 A;  4OMH A;  3WEK A;  5HN9 A;  3VJD A;  3ZMB A;  3SDQ A;  2PS4 A;  4JXN A;  2Q9Z A;  3KB9 A;  4JZB A;  3WSB A;  2ZEV A;  3Q30 A;  2Z4Z A;  3WJN A;  3MZV A;  5DGM F;  3N5H F;  5IK0 A;  4H5E F;  3UCA A;  3V1X A;  1HM7 A;  1UBY A;  4DI5 A;  4N1Z F;  4KFA A;  2E8U A;  3SAE A;  5JUZ F;  3KRC A;  2AZK A;  2Z7H A;  3PKO A;  4RXC A;  1YYQ A;  1VG2 A;  3KRF A;  1PS1 A;  5ILZ A;  5IM1 A;  5IMN A;  4LFV F;  5B0J A;  3SDV A;  2Q58 A;  3M0G A;  3N0F A;  4E9U A;  5HNA A;  2DH4 A;  4H5D F;  3WSA A;  5ILY A;  2AET A;  3S9V A;  4LLS A;  3OAB B;  3LJI A;  3AQC B;  3LSN A;  3CC9 A;  4P0W A;  2E94 A;  5B0L A;  4NG6 A;  3KRP A;  3P5R A;  3BNY A;  4NUA A;  1N1B A;  5I1U A;  4RNQ A;  1UBV A;  5IN8 A;  1RTR A;  4KPJ A;  3KRO B;  2F94 F;  3N45 F;  3DYF A;  3WCH A;  4L2X F;  3N1W F;  2FOR A;  1UBX A;  5ER8 A;  4LTZ A;  3P41 A;  5H9D A;  1KIZ A;  3Q2Q A;  3AE0 A;  4KVY A;  3ADZ A;  3TFV A;  1N20 A;  4LOB A;  2Z4Y A;  4RXD A;  2ZCQ A;  5AFX A;  3ACX A;  2OA6 A;  4KVW A;  3IPI A;  3LOM A;  2OGD A;  5ILJ A;  3LLW A;  4EA2 A;  4NKF A;  2J1O A;  3B7L A;  4F62 A;  5C05 A;  2E4O A;  5HN8 A;  3PYA A;  4KK2 A;  1V4K A;  2PS5 A;  5ERO A;  3WE9 A;  4LZC A;  2E95 A;  3NPK A;  3WCM A;  2ZY1 A;  4KVI A;  3WCE A;  2OPM A;  5DHI A;  3TFP A;  3NF2 A;  1V4H A;  4QXS F;  3AQB B;  3WCG A;  2Q80 A;  1ZW5 A;  3VJ8 A;  3M00 A;  3PYB A;  3KRA B;  1RQJ A;  3AQ0 A;  2P1C A;  5E8H A;  5DGS F;  2E91 A;  3ZCD A;  3TFN A;  2H8O A;  3VJ9 A;  3N1V F;  3WEF A;  4GA3 A;  4LTV A;  3VJC A;  1WKZ A;  4OGU A;  3OAB A;  3LEE A;  5ERN A;  1WL3 A;  5JA0 F;  3RYW A;  3LDW A;  2ONH A;  5ILD A;  3LGZ B;  3EGT A;  1HXC A;  2ONG A;  5DW7 A;  2E8V A;  4XQT F;  2Z7I A;  2J5C A;  4KPD A;  5JV1 F;  3SDT A;  4UMJ A;  4RYP A;  5E8L A;  2Z4V A;  1WL2 A;  2E8T A;  3RMG A;  3KRO A;  3N3L F;  3V66 A;  2RAH A;  3ICK A;  2EWG A;  3WC9 A;  4DHD A;  1YV5 A;  5B01 A;  3M9U A;  5E8K A;  3BNX A;  3PDE A;  3DYH A;  2F8Z F;  5B02 A;  1YYR A;  3N5J F;  2E8X A;  4XQR F;  3W7F A;  5ERM A;  4GP1 A;  5B00 A;  3SDU A;  2AEL A;  3VJE A;  2Z50 A;  3OAC A;  4JVJ F;  2ZEU A;  3G4F A;  1HXG A;  5IK6 A;  1YYS A;  3APZ A;  5CG6 A;  5ILI A;  4FJQ A;  5AYP A;  5ILK A;  3LVS A;  5IK9 A;  4H5C F;  4GP2 A;  3N49 F;  3PH7 A;  4GAX A;  5B0M A;  2F9K F;  1WL0 A;  3WEG A;  3ACY A;  3WEJ A;  4QPF A;  3CP6 A;  4LFE A;  3WCB A;  3SDR A;  5JV2 F;  4LA5 A;  3VJB A;  5DJP F;  3NRI A;  3LGK A;  5EAU A;  4E1E A;  1N21 A;  3KRC B;  4PVY F;  2E93 A;  4KQ5 A;  4RXA A;  2AEK A;  5IKA A;  5A0I A;  3M01 A;  2I19 A;  4HD1 A;  1EZF A;  4LPH F;  5AHU B;  4E9Z A;  4DWB A;  2F8C F;  3WCD A;  3ASX A;  3CKE A;  2ZCR A;  3ID0 A;  3Q2Z A;  5HN7 A;  1N24 A;  3P5P A;  1N1Z A;  3WEI A;  3EZ3 A;  2J1P A;  5EAS A;  2E8W A;  1V4J A;  2Z4W A;  3S4J A;  3ZMC A;  3ZOU A;  1VG6 A;  4LLT A;  4WK5 A;  2E90 A;  4LPG F;  3G4D A;  3WJO A;  4DZW A;  3N3D A;  5DZ2 A;  4LA6 A;  1WL1 A;  3N46 F;  1V4E A;  1JFA A;  4N9U A;  4K10 A;  1VG3 A;  4LUU A;  4NFJ F;  2PS7 A;  2PS8 A;  3WCL A;  4KWD A;  5A0K A;  4JXY A;  4MC0 A;  1YJ4 A;  3WCF A;  4NKE A;  1UBW A;  2AZJ A;  3TS7 A;  3WJK A;  3LMD A;  5DJR F;  4F6V A;  4DEM F;  5AEL A;  1YHK A;  4LZ3 A;  1JFG A;  1RQI A;  2F92 F;  2Z78 A;  3QQV A;  1YYT A;  1WY0 A;  3DYG A;  4P0X A;  5IL3 A;  5DIQ F;  2Z4X A;  4OKZ A;  3IBA A;  3RYE A;  5A0J A;  1N23 A;  1YYU A;  1HXA A;  2OPN A;  5B03 A;  4KVD A;  3MAV A;  1HM4 A;  3ICN A;  4DWG A;  4DXJ A;  3NPR A;  1YQ7 A;  1DGP A;  4MC8 A;  1KIY A;  3WCJ A;  2QIS A;  4Q23 A;  4LIX A;  5B0I A;  3QKC A;  1HX9 A;  4EA1 A;  4JZX A;  3WCA A;  3ZL6 A;  3M02 A;  3ICZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...