5HN8A

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph-1182
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
358
structure length
321
Chain Sequence
LAFFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSDIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIDNLIYKKIEDISMLMGEYFQIHDDYLDSDIQNNKLTWPLIKTFELCPDKIIVKNYGKVIDSLYEQYKHYESYEKAQKAKILSAIELHHEGIEYVLKYLLEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyl pyrophosphate synthase, putative
publication title Dynamic Structure and Inhibition of a Malaria Drug Target: Geranylgeranyl Diphosphate Synthase.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 113
structure length 321
sequence length 358
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5hn8A00
5DW7A 4KKMA 5DJVF 5EATA 4P0VA 5DGMF 4LZ3A 3B7LA 2E95A 3WCJA 2E91A 1YYQA 4FP4A 3OABA 5ERNA 4F62A 2J1PA 1HX9A 3N1VF 1ZW5A 3VJEA 2Q9ZA 3RYEA 4NKFA 5IK9A 3BNYA 3N49F 4PVXF 1WL2A 3KRCB 3Q2QA 2AETA 3P41A 1YV5A 3NPKA 5ILKA 2J1OA 4N9UA 2Z4XA 4LXWA 5B00A 1VG7A 3Q30A 4LFGA 4JZBA 4DWGA 3KROB 5DJPF 4GP2A 4K10A 4LTZA 2E8UA 5E8KA 3WCCA 4H5CF 3KRPA 3AQCB 3P8RA 5ERMA 2O1OA 3CKEA 2E93A 3G4FA 2H8OA 3LDWA 3PYAA 4RNQA 4OKMA 3V1VA 3N5JF 5E8LA 5IL8A 3WCFA 3OACB 4NUAA 2ZCRA 3N5HF 5B0IA 3G4DA 2RAHA 3WJNA 4DXJA 5JUZF 3PYBA 4KVIA 3QKCA 4KK2A 3N0FA 5IMPA 3ICZA 3KRCA 3ID0A 5ILZA 2PS4A 4RXCA 4KPDA 4LTVA 4GP1A 3LGKA 4LA5A 5IMNA 4KQSA 3KRFA 4LLSA 4KUXA 4GAXA 4F6XA 4DZWA 5JV0F 3N3LF 4LOBA 1V4IA 3WCAA 1HXAA 5DIQF 4MC8A 2ZEVA 3WE9A 2I19A 3OABB 3ZOUA 1KIYA 3PKOA 2E4OA 2OPMA 1RTRA 3WJKA 5ILJA 5JV1F 3TS7A 4E9ZA 2E94A 4JVJF 2AZKA 3QQVA 4EA1A 3LGZB 4EA0A 4PVYF 2F92F 2Z7IA 5B02A 4JXYA 5B0LA 3VJ9A 3S4JA 4LZ0A 4LPGF 5B0KA 1RQIA 2AEKA 5E8HA 3KRPB 4E9UA 3ZCDA 2PS6A 4P0WA 3WCHA 3ICKA 3SDRA 1DGPA 5CG6A 3N1WF 3WEFA 4RXAA 3WEJA 3NPRA 1N21A 1WL0A 3M9UA 2Q9YA 3BNXA 2Z52A 5CG5A 2ONGA 5IKAA 2F9KF 5A0IA 5A0KA 1WMWA 3MAVA 4LA6A 4P0XA 1VG3A 2FORA 1N24A 3V1XA 4KWDA 5B0JA 3SDQA 3OYRA 4OMGA 3ZMCA 3RMGA 1YYUA 3DYFA 2E8VA 1DI1A 1WY0A 2PS8A 2J5CA 1JFAA 3KRFB 1V4JA 5DHIA 1WKZA 2AZLA 4JYXA 1EZFA 4KVWA 4GA3A 3Q1OA 5A0JA 1UBXA 3LOMA 4HD1A 1HXGA 1V4EA 1N1ZA 1PS1A 3NF2A 2OGDA 3VJCA 3ICMA 5ILYA 3LJIA 2PS5A 5IMIA 1N1BA 3IBAA 3S9VA 2F7MF 2ZCSA 3IPIA 2FTZA 3ACWA 3KRAA 3M02A 3TFPA 2Q58A 1N22A 3PH7A 5HNAA 3AE0A 1HM7A 3CC9A 4LFEA 1YYRA 5EROA 4KVYA 1UBVA 3CP6A 5DHKA 1VG4A 4LIXA 1UBWA 4DWBA 3N45F 2Z4ZA 5KSXF 5IN8A 3KB9A 4NG6A 4Q23A 1RQJA 4DI5A 3TFNA 3ACXA 5IK0A 4LZCA 5DGSF 4N1ZF 5AFXA 2F94F 5IVGA 3P5RA 2AELA 1N23A 1WL3A 5DGNF 3M00A 5AHUB 5ILIA 3SDUA 3RYWA 5B03A 1KIZA 2EWGA 5C05A 2ZEUA 3LK5A 4NKEA 3WCGA 4XQSF 5IK6A 3Q2ZA 2ZCOA 3TC1A 5JV2F 2Z4WA 4OKZA 5IL3A 4RYPA 3LLWA 3P8LA 3WJOA 2E8XA 3N0GA 3M01A 4FJQA 3DYGA 3VJDA 2E8TA 4UMJA 1V4HA 3W7FA 3LEEA 5HN8A 3SDVA 4H5EF 1YJ4A 5AYPA 4JZXA 3WSBA 2F8ZF 4L2XF 3DYHA 3EGTA 3KRAB 5HN9A 3UCAA 4LUUA 3ASXA 4XQTF 3WC9A 1YYTA 1YHMA 3MZVA 2Z50A 5H9DA 4OGUA 2E90A 1N20A 1HM4A 5B0MA 2AZJA 2E92A 3WEIA 5ILDA 5DZ2A 5EASA 4JXNA 3N46F 2Z78A 5JA0F 1YYSA 2DH4A 2ZY1A 3M0GA 4E1EA 4KVDA 3LZ9A 5HN7A 3TFVA 2ONHA 3VJ8A 1VG2A 1YHKA 3EZ3A 4RXDA 3LG5A 2QISA 4MC0A 3ACYA 2VF6A 3WEKA 1VG6A 3WCDA 5ILHA 3WCEA 1YHLA 4NFJF 2Z7HA 4NFKF 4QPFA 1FPSA 2OA6A 5I1UA 4XQRF 3WEHA 3V66A 3N6KF 4QXSF 4LLTA 3APZA 3P5PA 2P1CA 3WEGA 4KQUA 3SAEA 3ADZA 4KQ5A 3AQ0A 5IM1A 1V4KA 2F89F 3ICNA 3WCBA 3EFQA 1YQ7A 3KROA 4KPJA 3RBMA 4ZQ8A 4NFIF 3WSAA 3VJAA 3NRIA 4LPHF 3SDTA 1JFGA 4F6VA 3LVSA 4OMHA 4DHDA 5ER8A 3ZL6A 2PS7A 2Z4VA 3LSNA 5DJRF 3WCMA 3OACA 3VJBA 2E8WA 3AQBB 4DEMF 4H5DF 4RXEA 4EA2A 4KFAA 3KBKA 1WL1A 3N3DA 2ZCQA 1HXCA 2F8CF 2Z4YA 5IKHA 4WK5A 2Q80A 5B01A 3PDEA 3WCLA 5AELA 2OPNA 1UBYA 5EAUA 3LMDA 3WCIA 4MC3A 3ZMBA 4LFVF
chains in the Genus database with same CATH superfamily
5DW7A 4KKMA 5DJVF 5EATA 4P0VA 5DGMF 4LZ3A 3B7LA 2E95A 3WCJA 2E91A 1YYQA 4FP4A 3OABA 5ERNA 4F62A 2J1PA 1HX9A 3N1VF 1ZW5A 3VJEA 2Q9ZA 3RYEA 4NKFA 5IK9A 3BNYA 3N49F 4PVXF 1WL2A 3KRCB 3Q2QA 2AETA 3P41A 1YV5A 3NPKA 5ILKA 2J1OA 4N9UA 2Z4XA 4LXWA 5B00A 1VG7A 3Q30A 4LFGA 4JZBA 4DWGA 3KROB 5DJPF 4GP2A 4K10A 4LTZA 2E8UA 5E8KA 3WCCA 4H5CF 3KRPA 3AQCB 3P8RA 5ERMA 2O1OA 3CKEA 2E93A 3G4FA 2H8OA 3LDWA 3PYAA 4RNQA 4OKMA 3V1VA 3N5JF 5E8LA 5IL8A 3WCFA 3OACB 4NUAA 2ZCRA 3N5HF 5B0IA 3G4DA 2RAHA 3WJNA 4DXJA 5JUZF 3PYBA 4KVIA 3QKCA 4KK2A 3N0FA 5IMPA 3ICZA 3KRCA 3ID0A 5ILZA 2PS4A 4RXCA 4KPDA 4LTVA 4GP1A 3LGKA 4LA5A 5IMNA 4KQSA 3KRFA 4LLSA 4KUXA 4GAXA 4F6XA 4DZWA 5JV0F 3N3LF 4LOBA 1V4IA 3WCAA 1HXAA 5DIQF 4MC8A 2ZEVA 3WE9A 2I19A 3OABB 3ZOUA 1KIYA 3PKOA 2E4OA 2OPMA 1RTRA 3WJKA 5ILJA 5JV1F 3TS7A 4E9ZA 2E94A 4JVJF 2AZKA 3QQVA 4EA1A 3LGZB 4EA0A 4PVYF 2F92F 2Z7IA 5B02A 4JXYA 5B0LA 3VJ9A 3S4JA 4LZ0A 4LPGF 5B0KA 1RQIA 2AEKA 5E8HA 3KRPB 4E9UA 3ZCDA 2PS6A 4P0WA 3WCHA 3ICKA 3SDRA 1DGPA 5CG6A 3N1WF 3WEFA 4RXAA 3WEJA 3NPRA 1N21A 1WL0A 3M9UA 2Q9YA 3BNXA 2Z52A 5CG5A 2ONGA 5IKAA 2F9KF 5A0IA 5A0KA 1WMWA 3MAVA 4LA6A 4P0XA 1VG3A 2FORA 1N24A 3V1XA 4KWDA 5B0JA 3SDQA 3OYRA 4OMGA 3ZMCA 3RMGA 1YYUA 3DYFA 2E8VA 1DI1A 1WY0A 2PS8A 2J5CA 1JFAA 3KRFB 1V4JA 5DHIA 1WKZA 2AZLA 4JYXA 1EZFA 4KVWA 4GA3A 3Q1OA 5A0JA 1UBXA 3LOMA 4HD1A 1HXGA 1V4EA 1N1ZA 1PS1A 3NF2A 2OGDA 3VJCA 3ICMA 5ILYA 3LJIA 2PS5A 5IMIA 1N1BA 3IBAA 3S9VA 2F7MF 2ZCSA 3IPIA 2FTZA 3ACWA 3KRAA 3M02A 3TFPA 2Q58A 1N22A 3PH7A 5HNAA 3AE0A 1HM7A 3CC9A 4LFEA 1YYRA 5EROA 4KVYA 1UBVA 3CP6A 5DHKA 1VG4A 4LIXA 1UBWA 4DWBA 3N45F 2Z4ZA 5KSXF 5IN8A 3KB9A 4NG6A 4Q23A 1RQJA 4DI5A 3TFNA 3ACXA 5IK0A 4LZCA 5DGSF 4N1ZF 5AFXA 2F94F 5IVGA 3P5RA 2AELA 1N23A 1WL3A 5DGNF 3M00A 5AHUB 5ILIA 3SDUA 3RYWA 5B03A 1KIZA 2EWGA 5C05A 2ZEUA 3LK5A 4NKEA 3WCGA 4XQSF 5IK6A 3Q2ZA 2ZCOA 3TC1A 5JV2F 2Z4WA 4OKZA 5IL3A 4RYPA 3LLWA 3P8LA 3WJOA 2E8XA 3N0GA 3M01A 4FJQA 3DYGA 3VJDA 2E8TA 4UMJA 1V4HA 3W7FA 3LEEA 5HN8A 3SDVA 4H5EF 1YJ4A 5AYPA 4JZXA 3WSBA 2F8ZF 4L2XF 3DYHA 3EGTA 3KRAB 5HN9A 3UCAA 4LUUA 3ASXA 4XQTF 3WC9A 1YYTA 1YHMA 3MZVA 2Z50A 5H9DA 4OGUA 2E90A 1N20A 1HM4A 5B0MA 2AZJA 2E92A 3WEIA 5ILDA 5DZ2A 5EASA 4JXNA 3N46F 2Z78A 5JA0F 1YYSA 2DH4A 2ZY1A 3M0GA 4E1EA 4KVDA 3LZ9A 5HN7A 3TFVA 2ONHA 3VJ8A 1VG2A 1YHKA 3EZ3A 4RXDA 3LG5A 2QISA 4MC0A 3ACYA 2VF6A 3WEKA 1VG6A 3WCDA 5ILHA 3WCEA 1YHLA 4NFJF 2Z7HA 4NFKF 4QPFA 1FPSA 2OA6A 5I1UA 4XQRF 3WEHA 3V66A 3N6KF 4QXSF 4LLTA 3APZA 3P5PA 2P1CA 3WEGA 4KQUA 3SAEA 3ADZA 4KQ5A 3AQ0A 5IM1A 1V4KA 2F89F 3ICNA 3WCBA 3EFQA 1YQ7A 3KROA 4KPJA 3RBMA 4ZQ8A 4NFIF 3WSAA 3VJAA 3NRIA 4LPHF 3SDTA 1JFGA 4F6VA 3LVSA 4OMHA 4DHDA 5ER8A 3ZL6A 2PS7A 2Z4VA 3LSNA 5DJRF 3WCMA 3OACA 3VJBA 2E8WA 3AQBB 4DEMF 4H5DF 4RXEA 4EA2A 4KFAA 3KBKA 1WL1A 3N3DA 2ZCQA 1HXCA 2F8CF 2Z4YA 5IKHA 4WK5A 2Q80A 5B01A 3PDEA 3WCLA 5AELA 2OPNA 1UBYA 5EAUA 3LMDA 3WCIA 4MC3A 3ZMBA 4LFVF
chains in the Genus database with same CATH topology
5DW7A 4KKMA 5DJVF 5EATA 4P0VA 5DGMF 4LZ3A 3B7LA 2E95A 3WCJA 2E91A 1YYQA 4FP4A 3OABA 5ERNA 4F62A 2J1PA 1HX9A 3N1VF 1ZW5A 3VJEA 2Q9ZA 3RYEA 4NKFA 5IK9A 3BNYA 3N49F 4PVXF 1WL2A 3KRCB 3Q2QA 2AETA 3P41A 1YV5A 3NPKA 5ILKA 2J1OA 4N9UA 2Z4XA 4LXWA 5B00A 1VG7A 3Q30A 4LFGA 4JZBA 4DWGA 3KROB 5DJPF 4GP2A 4K10A 4LTZA 2E8UA 5E8KA 3WCCA 4H5CF 3KRPA 3AQCB 3P8RA 5ERMA 2O1OA 3CKEA 2E93A 3G4FA 2H8OA 3LDWA 3PYAA 4RNQA 4OKMA 3V1VA 3N5JF 5E8LA 5IL8A 3WCFA 3OACB 4NUAA 2ZCRA 3N5HF 5B0IA 3G4DA 2RAHA 3WJNA 4DXJA 5JUZF 3PYBA 4KVIA 3QKCA 4KK2A 3N0FA 5IMPA 3ICZA 3KRCA 3ID0A 5ILZA 2PS4A 4RXCA 4KPDA 4LTVA 4GP1A 3LGKA 4LA5A 5IMNA 4KQSA 3KRFA 4LLSA 4KUXA 4GAXA 4F6XA 4DZWA 5JV0F 3N3LF 4LOBA 1V4IA 3WCAA 1HXAA 5DIQF 4MC8A 2ZEVA 3WE9A 2I19A 3OABB 3ZOUA 1KIYA 3PKOA 2E4OA 2OPMA 1RTRA 3WJKA 5ILJA 5JV1F 3TS7A 4E9ZA 2E94A 4JVJF 2AZKA 3QQVA 4EA1A 3LGZB 4EA0A 4PVYF 2F92F 2Z7IA 5B02A 4JXYA 5B0LA 3VJ9A 3S4JA 4LZ0A 4LPGF 5B0KA 1RQIA 2AEKA 5E8HA 3KRPB 4E9UA 3ZCDA 2PS6A 4P0WA 3WCHA 3ICKA 3SDRA 1DGPA 5CG6A 3N1WF 3WEFA 4RXAA 3WEJA 3NPRA 1N21A 1WL0A 3M9UA 2Q9YA 3BNXA 2Z52A 5CG5A 2ONGA 5IKAA 2F9KF 5A0IA 5A0KA 1WMWA 3MAVA 4LA6A 4P0XA 1VG3A 2FORA 1N24A 3V1XA 4KWDA 5B0JA 3SDQA 3OYRA 4OMGA 3ZMCA 3RMGA 1YYUA 3DYFA 2E8VA 1DI1A 1WY0A 2PS8A 2J5CA 1JFAA 3KRFB 1V4JA 5DHIA 1WKZA 2AZLA 4JYXA 1EZFA 4KVWA 4GA3A 3Q1OA 5A0JA 1UBXA 3LOMA 4HD1A 1HXGA 1V4EA 1N1ZA 1PS1A 3NF2A 2OGDA 3VJCA 3ICMA 5ILYA 3LJIA 2PS5A 5IMIA 1N1BA 3IBAA 3S9VA 2F7MF 2ZCSA 3IPIA 2FTZA 3ACWA 3KRAA 3M02A 3TFPA 2Q58A 1N22A 3PH7A 5HNAA 3AE0A 1HM7A 3CC9A 4LFEA 1YYRA 5EROA 4KVYA 1UBVA 3CP6A 5DHKA 1VG4A 4LIXA 1UBWA 4DWBA 3N45F 2Z4ZA 5KSXF 5IN8A 3KB9A 4NG6A 4Q23A 1RQJA 4DI5A 3TFNA 3ACXA 5IK0A 4LZCA 5DGSF 4N1ZF 5AFXA 2F94F 5IVGA 3P5RA 2AELA 1N23A 1WL3A 5DGNF 3M00A 5AHUB 5ILIA 3SDUA 3RYWA 5B03A 1KIZA 2EWGA 5C05A 2ZEUA 3LK5A 4NKEA 3WCGA 4XQSF 5IK6A 3Q2ZA 2ZCOA 3TC1A 5JV2F 2Z4WA 4OKZA 5IL3A 4RYPA 3LLWA 3P8LA 3WJOA 2E8XA 3N0GA 3M01A 4FJQA 3DYGA 3VJDA 2E8TA 4UMJA 1V4HA 3W7FA 3LEEA 5HN8A 3SDVA 4H5EF 1YJ4A 5AYPA 4JZXA 3WSBA 2F8ZF 4L2XF 3DYHA 3EGTA 3KRAB 5HN9A 3UCAA 4LUUA 3ASXA 4XQTF 3WC9A 1YYTA 1YHMA 3MZVA 2Z50A 5H9DA 4OGUA 2E90A 1N20A 1HM4A 5B0MA 2AZJA 2E92A 3WEIA 5ILDA 5DZ2A 5EASA 4JXNA 3N46F 2Z78A 5JA0F 1YYSA 2DH4A 2ZY1A 3M0GA 4E1EA 4KVDA 3LZ9A 5HN7A 3TFVA 2ONHA 3VJ8A 1VG2A 1YHKA 3EZ3A 4RXDA 3LG5A 2QISA 4MC0A 3ACYA 2VF6A 3WEKA 1VG6A 3WCDA 5ILHA 3WCEA 1YHLA 4NFJF 2Z7HA 4NFKF 4QPFA 1FPSA 2OA6A 5I1UA 4XQRF 3WEHA 3V66A 3N6KF 4QXSF 4LLTA 3APZA 3P5PA 2P1CA 3WEGA 4KQUA 3SAEA 3ADZA 4KQ5A 3AQ0A 5IM1A 1V4KA 2F89F 3ICNA 3WCBA 3EFQA 1YQ7A 3KROA 4KPJA 3RBMA 4ZQ8A 4NFIF 3WSAA 3VJAA 3NRIA 4LPHF 3SDTA 1JFGA 4F6VA 3LVSA 4OMHA 4DHDA 5ER8A 3ZL6A 2PS7A 2Z4VA 3LSNA 5DJRF 3WCMA 3OACA 3VJBA 2E8WA 3AQBB 4DEMF 4H5DF 4RXEA 4EA2A 4KFAA 3KBKA 1WL1A 3N3DA 2ZCQA 1HXCA 2F8CF 2Z4YA 5IKHA 4WK5A 2Q80A 5B01A 3PDEA 3WCLA 5AELA 2OPNA 1UBYA 5EAUA 3LMDA 3WCIA 4MC3A 3ZMBA 4LFVF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DW7 A;  4KKM A;  5DJV F;  5EAT A;  4P0V A;  5DGM F;  4LZ3 A;  3B7L A;  2E95 A;  3WCJ A;  2E91 A;  1YYQ A;  4FP4 A;  3OAB A;  5ERN A;  4F62 A;  2J1P A;  1HX9 A;  3N1V F;  1ZW5 A;  3VJE A;  2Q9Z A;  3RYE A;  4NKF A;  5IK9 A;  3BNY A;  3N49 F;  4PVX F;  1WL2 A;  3KRC B;  3Q2Q A;  2AET A;  3P41 A;  1YV5 A;  3NPK A;  5ILK A;  2J1O A;  4N9U A;  2Z4X A;  4LXW A;  5B00 A;  1VG7 A;  3Q30 A;  4LFG A;  4JZB A;  4DWG A;  3KRO B;  5DJP F;  4GP2 A;  4K10 A;  4LTZ A;  2E8U A;  5E8K A;  3WCC A;  4H5C F;  3KRP A;  3AQC B;  3P8R A;  5ERM A;  2O1O A;  3CKE A;  2E93 A;  3G4F A;  2H8O A;  3LDW A;  3PYA A;  4RNQ A;  4OKM A;  3V1V A;  3N5J F;  5E8L A;  5IL8 A;  3WCF A;  3OAC B;  4NUA A;  2ZCR A;  3N5H F;  5B0I A;  3G4D A;  2RAH A;  3WJN A;  4DXJ A;  5JUZ F;  3PYB A;  4KVI A;  3QKC A;  4KK2 A;  3N0F A;  5IMP A;  3ICZ A;  3KRC A;  3ID0 A;  5ILZ A;  2PS4 A;  4RXC A;  4KPD A;  4LTV A;  4GP1 A;  3LGK A;  4LA5 A;  5IMN A;  4KQS A;  3KRF A;  4LLS A;  4KUX A;  4GAX A;  4F6X A;  4DZW A;  5JV0 F;  3N3L F;  4LOB A;  1V4I A;  3WCA A;  1HXA A;  5DIQ F;  4MC8 A;  2ZEV A;  3WE9 A;  2I19 A;  3OAB B;  3ZOU A;  1KIY A;  3PKO A;  2E4O A;  2OPM A;  1RTR A;  3WJK A;  5ILJ A;  5JV1 F;  3TS7 A;  4E9Z A;  2E94 A;  4JVJ F;  2AZK A;  3QQV A;  4EA1 A;  3LGZ B;  4EA0 A;  4PVY F;  2F92 F;  2Z7I A;  5B02 A;  4JXY A;  5B0L A;  3VJ9 A;  3S4J A;  4LZ0 A;  4LPG F;  5B0K A;  1RQI A;  2AEK A;  5E8H A;  3KRP B;  4E9U A;  3ZCD A;  2PS6 A;  4P0W A;  3WCH A;  3ICK A;  3SDR A;  1DGP A;  5CG6 A;  3N1W F;  3WEF A;  4RXA A;  3WEJ A;  3NPR A;  1N21 A;  1WL0 A;  3M9U A;  2Q9Y A;  3BNX A;  2Z52 A;  5CG5 A;  2ONG A;  5IKA A;  2F9K F;  5A0I A;  5A0K A;  1WMW A;  3MAV A;  4LA6 A;  4P0X A;  1VG3 A;  2FOR A;  1N24 A;  3V1X A;  4KWD A;  5B0J A;  3SDQ A;  3OYR A;  4OMG A;  3ZMC A;  3RMG A;  1YYU A;  3DYF A;  2E8V A;  1DI1 A;  1WY0 A;  2PS8 A;  2J5C A;  1JFA A;  3KRF B;  1V4J A;  5DHI A;  1WKZ A;  2AZL A;  4JYX A;  1EZF A;  4KVW A;  4GA3 A;  3Q1O A;  5A0J A;  1UBX A;  3LOM A;  4HD1 A;  1HXG A;  1V4E A;  1N1Z A;  1PS1 A;  3NF2 A;  2OGD A;  3VJC A;  3ICM A;  5ILY A;  3LJI A;  2PS5 A;  5IMI A;  1N1B A;  3IBA A;  3S9V A;  2F7M F;  2ZCS A;  3IPI A;  2FTZ A;  3ACW A;  3KRA A;  3M02 A;  3TFP A;  2Q58 A;  1N22 A;  3PH7 A;  5HNA A;  3AE0 A;  1HM7 A;  3CC9 A;  4LFE A;  1YYR A;  5ERO A;  4KVY A;  1UBV A;  3CP6 A;  5DHK A;  1VG4 A;  4LIX A;  1UBW A;  4DWB A;  3N45 F;  2Z4Z A;  5KSX F;  5IN8 A;  3KB9 A;  4NG6 A;  4Q23 A;  1RQJ A;  4DI5 A;  3TFN A;  3ACX A;  5IK0 A;  4LZC A;  5DGS F;  4N1Z F;  5AFX A;  2F94 F;  5IVG A;  3P5R A;  2AEL A;  1N23 A;  1WL3 A;  5DGN F;  3M00 A;  5AHU B;  5ILI A;  3SDU A;  3RYW A;  5B03 A;  1KIZ A;  2EWG A;  5C05 A;  2ZEU A;  3LK5 A;  4NKE A;  3WCG A;  4XQS F;  5IK6 A;  3Q2Z A;  2ZCO A;  3TC1 A;  5JV2 F;  2Z4W A;  4OKZ A;  5IL3 A;  4RYP A;  3LLW A;  3P8L A;  3WJO A;  2E8X A;  3N0G A;  3M01 A;  4FJQ A;  3DYG A;  3VJD A;  2E8T A;  4UMJ A;  1V4H A;  3W7F A;  3LEE A;  5HN8 A;  3SDV A;  4H5E F;  1YJ4 A;  5AYP A;  4JZX A;  3WSB A;  2F8Z F;  4L2X F;  3DYH A;  3EGT A;  3KRA B;  5HN9 A;  3UCA A;  4LUU A;  3ASX A;  4XQT F;  3WC9 A;  1YYT A;  1YHM A;  3MZV A;  2Z50 A;  5H9D A;  4OGU A;  2E90 A;  1N20 A;  1HM4 A;  5B0M A;  2AZJ A;  2E92 A;  3WEI A;  5ILD A;  5DZ2 A;  5EAS A;  4JXN A;  3N46 F;  2Z78 A;  5JA0 F;  1YYS A;  2DH4 A;  2ZY1 A;  3M0G A;  4E1E A;  4KVD A;  3LZ9 A;  5HN7 A;  3TFV A;  2ONH A;  3VJ8 A;  1VG2 A;  1YHK A;  3EZ3 A;  4RXD A;  3LG5 A;  2QIS A;  4MC0 A;  3ACY A;  2VF6 A;  3WEK A;  1VG6 A;  3WCD A;  5ILH A;  3WCE A;  1YHL A;  4NFJ F;  2Z7H A;  4NFK F;  4QPF A;  1FPS A;  2OA6 A;  5I1U A;  4XQR F;  3WEH A;  3V66 A;  3N6K F;  4QXS F;  4LLT A;  3APZ A;  3P5P A;  2P1C A;  3WEG A;  4KQU A;  3SAE A;  3ADZ A;  4KQ5 A;  3AQ0 A;  5IM1 A;  1V4K A;  2F89 F;  3ICN A;  3WCB A;  3EFQ A;  1YQ7 A;  3KRO A;  4KPJ A;  3RBM A;  4ZQ8 A;  4NFI F;  3WSA A;  3VJA A;  3NRI A;  4LPH F;  3SDT A;  1JFG A;  4F6V A;  3LVS A;  4OMH A;  4DHD A;  5ER8 A;  3ZL6 A;  2PS7 A;  2Z4V A;  3LSN A;  5DJR F;  3WCM A;  3OAC A;  3VJB A;  2E8W A;  3AQB B;  4DEM F;  4H5D F;  4RXE A;  4EA2 A;  4KFA A;  3KBK A;  1WL1 A;  3N3D A;  2ZCQ A;  1HXC A;  2F8C F;  2Z4Y A;  5IKH A;  4WK5 A;  2Q80 A;  5B01 A;  3PDE A;  3WCL A;  5AEL A;  2OPN A;  1UBY A;  5EAU A;  3LMD A;  3WCI A;  4MC3 A;  3ZMB A;  4LFV F; 
#chains in the Genus database with same CATH topology
 5DW7 A;  4KKM A;  5DJV F;  5EAT A;  4P0V A;  5DGM F;  4LZ3 A;  3B7L A;  2E95 A;  3WCJ A;  2E91 A;  1YYQ A;  4FP4 A;  3OAB A;  5ERN A;  4F62 A;  2J1P A;  1HX9 A;  3N1V F;  1ZW5 A;  3VJE A;  2Q9Z A;  3RYE A;  4NKF A;  5IK9 A;  3BNY A;  3N49 F;  4PVX F;  1WL2 A;  3KRC B;  3Q2Q A;  2AET A;  3P41 A;  1YV5 A;  3NPK A;  5ILK A;  2J1O A;  4N9U A;  2Z4X A;  4LXW A;  5B00 A;  1VG7 A;  3Q30 A;  4LFG A;  4JZB A;  4DWG A;  3KRO B;  5DJP F;  4GP2 A;  4K10 A;  4LTZ A;  2E8U A;  5E8K A;  3WCC A;  4H5C F;  3KRP A;  3AQC B;  3P8R A;  5ERM A;  2O1O A;  3CKE A;  2E93 A;  3G4F A;  2H8O A;  3LDW A;  3PYA A;  4RNQ A;  4OKM A;  3V1V A;  3N5J F;  5E8L A;  5IL8 A;  3WCF A;  3OAC B;  4NUA A;  2ZCR A;  3N5H F;  5B0I A;  3G4D A;  2RAH A;  3WJN A;  4DXJ A;  5JUZ F;  3PYB A;  4KVI A;  3QKC A;  4KK2 A;  3N0F A;  5IMP A;  3ICZ A;  3KRC A;  3ID0 A;  5ILZ A;  2PS4 A;  4RXC A;  4KPD A;  4LTV A;  4GP1 A;  3LGK A;  4LA5 A;  5IMN A;  4KQS A;  3KRF A;  4LLS A;  4KUX A;  4GAX A;  4F6X A;  4DZW A;  5JV0 F;  3N3L F;  4LOB A;  1V4I A;  3WCA A;  1HXA A;  5DIQ F;  4MC8 A;  2ZEV A;  3WE9 A;  2I19 A;  3OAB B;  3ZOU A;  1KIY A;  3PKO A;  2E4O A;  2OPM A;  1RTR A;  3WJK A;  5ILJ A;  5JV1 F;  3TS7 A;  4E9Z A;  2E94 A;  4JVJ F;  2AZK A;  3QQV A;  4EA1 A;  3LGZ B;  4EA0 A;  4PVY F;  2F92 F;  2Z7I A;  5B02 A;  4JXY A;  5B0L A;  3VJ9 A;  3S4J A;  4LZ0 A;  4LPG F;  5B0K A;  1RQI A;  2AEK A;  5E8H A;  3KRP B;  4E9U A;  3ZCD A;  2PS6 A;  4P0W A;  3WCH A;  3ICK A;  3SDR A;  1DGP A;  5CG6 A;  3N1W F;  3WEF A;  4RXA A;  3WEJ A;  3NPR A;  1N21 A;  1WL0 A;  3M9U A;  2Q9Y A;  3BNX A;  2Z52 A;  5CG5 A;  2ONG A;  5IKA A;  2F9K F;  5A0I A;  5A0K A;  1WMW A;  3MAV A;  4LA6 A;  4P0X A;  1VG3 A;  2FOR A;  1N24 A;  3V1X A;  4KWD A;  5B0J A;  3SDQ A;  3OYR A;  4OMG A;  3ZMC A;  3RMG A;  1YYU A;  3DYF A;  2E8V A;  1DI1 A;  1WY0 A;  2PS8 A;  2J5C A;  1JFA A;  3KRF B;  1V4J A;  5DHI A;  1WKZ A;  2AZL A;  4JYX A;  1EZF A;  4KVW A;  4GA3 A;  3Q1O A;  5A0J A;  1UBX A;  3LOM A;  4HD1 A;  1HXG A;  1V4E A;  1N1Z A;  1PS1 A;  3NF2 A;  2OGD A;  3VJC A;  3ICM A;  5ILY A;  3LJI A;  2PS5 A;  5IMI A;  1N1B A;  3IBA A;  3S9V A;  2F7M F;  2ZCS A;  3IPI A;  2FTZ A;  3ACW A;  3KRA A;  3M02 A;  3TFP A;  2Q58 A;  1N22 A;  3PH7 A;  5HNA A;  3AE0 A;  1HM7 A;  3CC9 A;  4LFE A;  1YYR A;  5ERO A;  4KVY A;  1UBV A;  3CP6 A;  5DHK A;  1VG4 A;  4LIX A;  1UBW A;  4DWB A;  3N45 F;  2Z4Z A;  5KSX F;  5IN8 A;  3KB9 A;  4NG6 A;  4Q23 A;  1RQJ A;  4DI5 A;  3TFN A;  3ACX A;  5IK0 A;  4LZC A;  5DGS F;  4N1Z F;  5AFX A;  2F94 F;  5IVG A;  3P5R A;  2AEL A;  1N23 A;  1WL3 A;  5DGN F;  3M00 A;  5AHU B;  5ILI A;  3SDU A;  3RYW A;  5B03 A;  1KIZ A;  2EWG A;  5C05 A;  2ZEU A;  3LK5 A;  4NKE A;  3WCG A;  4XQS F;  5IK6 A;  3Q2Z A;  2ZCO A;  3TC1 A;  5JV2 F;  2Z4W A;  4OKZ A;  5IL3 A;  4RYP A;  3LLW A;  3P8L A;  3WJO A;  2E8X A;  3N0G A;  3M01 A;  4FJQ A;  3DYG A;  3VJD A;  2E8T A;  4UMJ A;  1V4H A;  3W7F A;  3LEE A;  5HN8 A;  3SDV A;  4H5E F;  1YJ4 A;  5AYP A;  4JZX A;  3WSB A;  2F8Z F;  4L2X F;  3DYH A;  3EGT A;  3KRA B;  5HN9 A;  3UCA A;  4LUU A;  3ASX A;  4XQT F;  3WC9 A;  1YYT A;  1YHM A;  3MZV A;  2Z50 A;  5H9D A;  4OGU A;  2E90 A;  1N20 A;  1HM4 A;  5B0M A;  2AZJ A;  2E92 A;  3WEI A;  5ILD A;  5DZ2 A;  5EAS A;  4JXN A;  3N46 F;  2Z78 A;  5JA0 F;  1YYS A;  2DH4 A;  2ZY1 A;  3M0G A;  4E1E A;  4KVD A;  3LZ9 A;  5HN7 A;  3TFV A;  2ONH A;  3VJ8 A;  1VG2 A;  1YHK A;  3EZ3 A;  4RXD A;  3LG5 A;  2QIS A;  4MC0 A;  3ACY A;  2VF6 A;  3WEK A;  1VG6 A;  3WCD A;  5ILH A;  3WCE A;  1YHL A;  4NFJ F;  2Z7H A;  4NFK F;  4QPF A;  1FPS A;  2OA6 A;  5I1U A;  4XQR F;  3WEH A;  3V66 A;  3N6K F;  4QXS F;  4LLT A;  3APZ A;  3P5P A;  2P1C A;  3WEG A;  4KQU A;  3SAE A;  3ADZ A;  4KQ5 A;  3AQ0 A;  5IM1 A;  1V4K A;  2F89 F;  3ICN A;  3WCB A;  3EFQ A;  1YQ7 A;  3KRO A;  4KPJ A;  3RBM A;  4ZQ8 A;  4NFI F;  3WSA A;  3VJA A;  3NRI A;  4LPH F;  3SDT A;  1JFG A;  4F6V A;  3LVS A;  4OMH A;  4DHD A;  5ER8 A;  3ZL6 A;  2PS7 A;  2Z4V A;  3LSN A;  5DJR F;  3WCM A;  3OAC A;  3VJB A;  2E8W A;  3AQB B;  4DEM F;  4H5D F;  4RXE A;  4EA2 A;  4KFA A;  3KBK A;  1WL1 A;  3N3D A;  2ZCQ A;  1HXC A;  2F8C F;  2Z4Y A;  5IKH A;  4WK5 A;  2Q80 A;  5B01 A;  3PDE A;  3WCL A;  5AEL A;  2OPN A;  1UBY A;  5EAU A;  3LMD A;  3WCI A;  4MC3 A;  3ZMB A;  4LFV F; 
#chains in the Genus database with same CATH homology
 5DW7 A;  4KKM A;  5DJV F;  5EAT A;  4P0V A;  5DGM F;  4LZ3 A;  3B7L A;  2E95 A;  3WCJ A;  2E91 A;  1YYQ A;  4FP4 A;  3OAB A;  5ERN A;  4F62 A;  2J1P A;  1HX9 A;  3N1V F;  1ZW5 A;  3VJE A;  2Q9Z A;  3RYE A;  4NKF A;  5IK9 A;  3BNY A;  3N49 F;  4PVX F;  1WL2 A;  3KRC B;  3Q2Q A;  2AET A;  3P41 A;  1YV5 A;  3NPK A;  5ILK A;  2J1O A;  4N9U A;  2Z4X A;  4LXW A;  5B00 A;  1VG7 A;  3Q30 A;  4LFG A;  4JZB A;  4DWG A;  3KRO B;  5DJP F;  4GP2 A;  4K10 A;  4LTZ A;  2E8U A;  5E8K A;  3WCC A;  4H5C F;  3KRP A;  3AQC B;  3P8R A;  5ERM A;  2O1O A;  3CKE A;  2E93 A;  3G4F A;  2H8O A;  3LDW A;  3PYA A;  4RNQ A;  4OKM A;  3V1V A;  3N5J F;  5E8L A;  5IL8 A;  3WCF A;  3OAC B;  4NUA A;  2ZCR A;  3N5H F;  5B0I A;  3G4D A;  2RAH A;  3WJN A;  4DXJ A;  5JUZ F;  3PYB A;  4KVI A;  3QKC A;  4KK2 A;  3N0F A;  5IMP A;  3ICZ A;  3KRC A;  3ID0 A;  5ILZ A;  2PS4 A;  4RXC A;  4KPD A;  4LTV A;  4GP1 A;  3LGK A;  4LA5 A;  5IMN A;  4KQS A;  3KRF A;  4LLS A;  4KUX A;  4GAX A;  4F6X A;  4DZW A;  5JV0 F;  3N3L F;  4LOB A;  1V4I A;  3WCA A;  1HXA A;  5DIQ F;  4MC8 A;  2ZEV A;  3WE9 A;  2I19 A;  3OAB B;  3ZOU A;  1KIY A;  3PKO A;  2E4O A;  2OPM A;  1RTR A;  3WJK A;  5ILJ A;  5JV1 F;  3TS7 A;  4E9Z A;  2E94 A;  4JVJ F;  2AZK A;  3QQV A;  4EA1 A;  3LGZ B;  4EA0 A;  4PVY F;  2F92 F;  2Z7I A;  5B02 A;  4JXY A;  5B0L A;  3VJ9 A;  3S4J A;  4LZ0 A;  4LPG F;  5B0K A;  1RQI A;  2AEK A;  5E8H A;  3KRP B;  4E9U A;  3ZCD A;  2PS6 A;  4P0W A;  3WCH A;  3ICK A;  3SDR A;  1DGP A;  5CG6 A;  3N1W F;  3WEF A;  4RXA A;  3WEJ A;  3NPR A;  1N21 A;  1WL0 A;  3M9U A;  2Q9Y A;  3BNX A;  2Z52 A;  5CG5 A;  2ONG A;  5IKA A;  2F9K F;  5A0I A;  5A0K A;  1WMW A;  3MAV A;  4LA6 A;  4P0X A;  1VG3 A;  2FOR A;  1N24 A;  3V1X A;  4KWD A;  5B0J A;  3SDQ A;  3OYR A;  4OMG A;  3ZMC A;  3RMG A;  1YYU A;  3DYF A;  2E8V A;  1DI1 A;  1WY0 A;  2PS8 A;  2J5C A;  1JFA A;  3KRF B;  1V4J A;  5DHI A;  1WKZ A;  2AZL A;  4JYX A;  1EZF A;  4KVW A;  4GA3 A;  3Q1O A;  5A0J A;  1UBX A;  3LOM A;  4HD1 A;  1HXG A;  1V4E A;  1N1Z A;  1PS1 A;  3NF2 A;  2OGD A;  3VJC A;  3ICM A;  5ILY A;  3LJI A;  2PS5 A;  5IMI A;  1N1B A;  3IBA A;  3S9V A;  2F7M F;  2ZCS A;  3IPI A;  2FTZ A;  3ACW A;  3KRA A;  3M02 A;  3TFP A;  2Q58 A;  1N22 A;  3PH7 A;  5HNA A;  3AE0 A;  1HM7 A;  3CC9 A;  4LFE A;  1YYR A;  5ERO A;  4KVY A;  1UBV A;  3CP6 A;  5DHK A;  1VG4 A;  4LIX A;  1UBW A;  4DWB A;  3N45 F;  2Z4Z A;  5KSX F;  5IN8 A;  3KB9 A;  4NG6 A;  4Q23 A;  1RQJ A;  4DI5 A;  3TFN A;  3ACX A;  5IK0 A;  4LZC A;  5DGS F;  4N1Z F;  5AFX A;  2F94 F;  5IVG A;  3P5R A;  2AEL A;  1N23 A;  1WL3 A;  5DGN F;  3M00 A;  5AHU B;  5ILI A;  3SDU A;  3RYW A;  5B03 A;  1KIZ A;  2EWG A;  5C05 A;  2ZEU A;  3LK5 A;  4NKE A;  3WCG A;  4XQS F;  5IK6 A;  3Q2Z A;  2ZCO A;  3TC1 A;  5JV2 F;  2Z4W A;  4OKZ A;  5IL3 A;  4RYP A;  3LLW A;  3P8L A;  3WJO A;  2E8X A;  3N0G A;  3M01 A;  4FJQ A;  3DYG A;  3VJD A;  2E8T A;  4UMJ A;  1V4H A;  3W7F A;  3LEE A;  5HN8 A;  3SDV A;  4H5E F;  1YJ4 A;  5AYP A;  4JZX A;  3WSB A;  2F8Z F;  4L2X F;  3DYH A;  3EGT A;  3KRA B;  5HN9 A;  3UCA A;  4LUU A;  3ASX A;  4XQT F;  3WC9 A;  1YYT A;  1YHM A;  3MZV A;  2Z50 A;  5H9D A;  4OGU A;  2E90 A;  1N20 A;  1HM4 A;  5B0M A;  2AZJ A;  2E92 A;  3WEI A;  5ILD A;  5DZ2 A;  5EAS A;  4JXN A;  3N46 F;  2Z78 A;  5JA0 F;  1YYS A;  2DH4 A;  2ZY1 A;  3M0G A;  4E1E A;  4KVD A;  3LZ9 A;  5HN7 A;  3TFV A;  2ONH A;  3VJ8 A;  1VG2 A;  1YHK A;  3EZ3 A;  4RXD A;  3LG5 A;  2QIS A;  4MC0 A;  3ACY A;  2VF6 A;  3WEK A;  1VG6 A;  3WCD A;  5ILH A;  3WCE A;  1YHL A;  4NFJ F;  2Z7H A;  4NFK F;  4QPF A;  1FPS A;  2OA6 A;  5I1U A;  4XQR F;  3WEH A;  3V66 A;  3N6K F;  4QXS F;  4LLT A;  3APZ A;  3P5P A;  2P1C A;  3WEG A;  4KQU A;  3SAE A;  3ADZ A;  4KQ5 A;  3AQ0 A;  5IM1 A;  1V4K A;  2F89 F;  3ICN A;  3WCB A;  3EFQ A;  1YQ7 A;  3KRO A;  4KPJ A;  3RBM A;  4ZQ8 A;  4NFI F;  3WSA A;  3VJA A;  3NRI A;  4LPH F;  3SDT A;  1JFG A;  4F6V A;  3LVS A;  4OMH A;  4DHD A;  5ER8 A;  3ZL6 A;  2PS7 A;  2Z4V A;  3LSN A;  5DJR F;  3WCM A;  3OAC A;  3VJB A;  2E8W A;  3AQB B;  4DEM F;  4H5D F;  4RXE A;  4EA2 A;  4KFA A;  3KBK A;  1WL1 A;  3N3D A;  2ZCQ A;  1HXC A;  2F8C F;  2Z4Y A;  5IKH A;  4WK5 A;  2Q80 A;  5B01 A;  3PDE A;  3WCL A;  5AEL A;  2OPN A;  1UBY A;  5EAU A;  3LMD A;  3WCI A;  4MC3 A;  3ZMB A;  4LFV F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...