3NRIA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from s. aureus complexed with dehydrosqualene (dhs)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
284
structure length
279
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 116
structure length 279
sequence length 284
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3nriA00
3VJ8A 3N46F 3M9UA 3EGTA 5B01A 5IM1A 3KRFB 5DW7A 3W7FA 2ZCQA 4LA5A 3PDEA 5E8LA 5IMIA 5ERMA 2AELA 3G4DA 1JFAA 3QKCA 4JXNA 3SDUA 3AQ0A 4JXYA 2Z52A 3LMDA 4GA3A 4LZCA 4MC0A 1YYUA 4LA6A 1V4HA 1EZFA 1WY0A 1UBYA 3ICNA 5AYPA 3WEFA 3MAVA 1V4IA 3CKEA 2PS7A 3N5HF 2Q80A 3UCAA 3KRCA 4P0WA 3OACB 3N1WF 4KUXA 5A0JA 3KBKA 1HX9A 3Q2ZA 4KPJA 1PS1A 5AELA 3APZA 4P0VA 3M02A 4F6XA 2AZKA 3SDRA 3LOMA 3S4JA 1YHMA 5DHKA 3WCAA 2OA6A 3ICZA 2Q9ZA 4KVWA 1UBXA 4GP2A 3P8RA 5DGNF 5B00A 2AETA 2E92A 4LZ3A 3ACXA 4OMHA 4DWGA 2E95A 5B0JA 4MC8A 1DI1A 1WMWA 4PVXF 5DIQF 5E8KA 3BNYA 3EFQA 3WEKA 3ZL6A 2Q9YA 4WK5A 3IBAA 3N45F 4LZ0A 5IMNA 1RQIA 1WKZA 3OABA 5IL8A 1FPSA 5AHUB 3DYHA 2J1PA 4E1EA 3WCEA 3P8LA 4GAXA 3NPKA 5HN8A 5KSXF 2E91A 1N23A 3KB9A 4NUAA 3TFNA 3TS7A 1N1BA 5EAUA 4JVJF 5ER8A 3TFPA 1VG6A 5IN8A 3M0GA 3KRFA 2VF6A 4RNQA 5HNAA 3RYWA 2Z4WA 3ZMBA 5IK9A 3P5RA 4MC3A 3Q2QA 1YJ4A 4GP1A 3S9VA 3V66A 4RXEA 4JYXA 3LVSA 4LPHF 4KWDA 2ZCOA 3SDVA 3G4FA 2EWGA 5JV0F 3OACA 4XQRF 3P5PA 5JUZF 3AQBB 3WJKA 3P41A 3VJ9A 3NRIA 5DJVF 1N21A 3B7LA 4LIXA 2E8XA 5DZ2A 3CC9A 3N3LF 5I1UA 2Q58A 4LFVF 5C05A 1N20A 2E93A 4F62A 1HXCA 4LOBA 5DJPF 4NG6A 3VJDA 1V4KA 2F8CF 3ASXA 3LJIA 3WCLA 4F6VA 3ACWA 2DH4A 3DYGA 1N1ZA 4N9UA 3SDQA 2QISA 3N5JF 3RYEA 5ILKA 5IK6A 3WEJA 1VG2A 3N0FA 5B0KA 3N6KF 4DHDA 1WL3A 4P0XA 5ERNA 3WJNA 4KFAA 3WC9A 3M01A 5CG6A 3WCBA 1RTRA 2P1CA 5HN7A 3NF2A 3VJCA 1HM7A 4XQSF 2ONGA 4KQSA 2PS5A 4H5DF 2Z50A 5IKHA 2RAHA 4FJQA 2ZEUA 3Q30A 3WEHA 2OPMA 5IKAA 1UBWA 5B0IA 3ADZA 4L2XF 2E4OA 3WCGA 2F94F 5EATA 2H8OA 2AZJA 4XQTF 5B0LA 4PVYF 1N24A 2ZCRA 1YYQA 4JZBA 4DWBA 1WL2A 3WCDA 3WCJA 4E9UA 2PS4A 2E8VA 4DXJA 2AEKA 4H5CF 2Z4XA 4LFGA 1HM4A 1VG4A 1YYSA 5IL3A 4NFKF 3N49F 4OKMA 3WJOA 4H5EF 3ACYA 2E8TA 2F7MF 3KROB 4KQ5A 5E8HA 3KRPA 5IVGA 5JA0F 3LGKA 5EASA 4E9ZA 2F92F 3KRAB 3RMGA 5HN9A 4DEMF 1ZW5A 5EROA 4K10A 4LLTA 2E90A 2OPNA 1YQ7A 3NPRA 5JV1F 4HD1A 4LXWA 4RYPA 5ILHA 1YV5A 4RXAA 4FP4A 1YYTA 3VJAA 2F9KF 2FTZA 3KRPB 3WE9A 1KIYA 2F89F 2ZY1A 3LGZB 3WEIA 4KVIA 5A0KA 3WCIA 3WSBA 3VJBA 4KPDA 3AQCB 3DYFA 4OKZA 4RXCA 3WCFA 2E8WA 1HXGA 4LFEA 5DHIA 4N1ZF 3LEEA 2Z4ZA 2Z7HA 3WCHA 3V1XA 1WL0A 5CG5A 4DZWA 1N22A 4LTZA 4QXSF 2PS6A 2J1OA 4ZQ8A 1YYRA 4LTVA 4DI5A 3PYBA 4RXDA 3ZMCA 3WSAA 1UBVA 3M00A 5H9DA 4QPFA 3WEGA 4NFIF 3PH7A 3WCCA 4KKMA 3LZ9A 3LK5A 1JFGA 4EA2A 3SAEA 2J5CA 4KVDA 1V4EA 3ID0A 3IPIA 3MZVA 3TC1A 4JZXA 3ZOUA 2OGDA 5ILYA 2PS8A 3PYAA 3TFVA 2E8UA 3KRCB 1YHKA 3CP6A 3RBMA 2ZEVA 2Z78A 4KVYA 4LPGF 5DJRF 1WL1A 3AE0A 2F8ZF 2O1OA 4NKEA 1V4JA 3N1VF 5JV2F 3QQVA 4LLSA 2E94A 4OMGA 3LSNA 3BNXA 4KQUA 2AZLA 3ICMA 3KROA 5B02A 2Z4VA 1KIZA 5IMPA 3EZ3A 3LG5A 2Z7IA 2ONHA 1YHLA 3KRAA 3N3DA 2I19A 3ICKA 2FORA 1DGPA 5A0IA 5ILJA 4NFJF 5B0MA 4NKFA 4Q23A 2Z4YA 4KK2A 3SDTA 3PKOA 3VJEA 4OGUA 3OABB 4UMJA 1VG7A 5B03A 1VG3A 3LLWA 3V1VA 4EA1A 5IK0A 3Q1OA 3WCMA 5ILZA 4EA0A 5ILDA 2ZCSA 3N0GA 5ILIA 4LUUA 3ZCDA 5AFXA 5DGMF 3OYRA 1HXAA 3LDWA 1RQJA 5DGSF
chains in the Genus database with same CATH superfamily
3VJ8A 3N46F 3M9UA 3EGTA 5B01A 5IM1A 3KRFB 5DW7A 3W7FA 2ZCQA 4LA5A 3PDEA 5E8LA 5IMIA 5ERMA 2AELA 3G4DA 1JFAA 3QKCA 4JXNA 3SDUA 3AQ0A 4JXYA 2Z52A 3LMDA 4GA3A 4LZCA 4MC0A 1YYUA 4LA6A 1V4HA 1EZFA 1WY0A 1UBYA 3ICNA 5AYPA 3WEFA 3MAVA 1V4IA 3CKEA 2PS7A 3N5HF 2Q80A 3UCAA 3KRCA 4P0WA 3OACB 3N1WF 4KUXA 5A0JA 3KBKA 1HX9A 3Q2ZA 4KPJA 1PS1A 5AELA 3APZA 4P0VA 3M02A 4F6XA 2AZKA 3SDRA 3LOMA 3S4JA 1YHMA 5DHKA 3WCAA 2OA6A 3ICZA 2Q9ZA 4KVWA 1UBXA 4GP2A 3P8RA 5DGNF 5B00A 2AETA 2E92A 4LZ3A 3ACXA 4OMHA 4DWGA 2E95A 5B0JA 4MC8A 1DI1A 1WMWA 4PVXF 5DIQF 5E8KA 3BNYA 3EFQA 3WEKA 3ZL6A 2Q9YA 4WK5A 3IBAA 3N45F 4LZ0A 5IMNA 1RQIA 1WKZA 3OABA 5IL8A 1FPSA 5AHUB 3DYHA 2J1PA 4E1EA 3WCEA 3P8LA 4GAXA 3NPKA 5HN8A 5KSXF 2E91A 1N23A 3KB9A 4NUAA 3TFNA 3TS7A 1N1BA 5EAUA 4JVJF 5ER8A 3TFPA 1VG6A 5IN8A 3M0GA 3KRFA 2VF6A 4RNQA 5HNAA 3RYWA 2Z4WA 3ZMBA 5IK9A 3P5RA 4MC3A 3Q2QA 1YJ4A 4GP1A 3S9VA 3V66A 4RXEA 4JYXA 3LVSA 4LPHF 4KWDA 2ZCOA 3SDVA 3G4FA 2EWGA 5JV0F 3OACA 4XQRF 3P5PA 5JUZF 3AQBB 3WJKA 3P41A 3VJ9A 3NRIA 5DJVF 1N21A 3B7LA 4LIXA 2E8XA 5DZ2A 3CC9A 3N3LF 5I1UA 2Q58A 4LFVF 5C05A 1N20A 2E93A 4F62A 1HXCA 4LOBA 5DJPF 4NG6A 3VJDA 1V4KA 2F8CF 3ASXA 3LJIA 3WCLA 4F6VA 3ACWA 2DH4A 3DYGA 1N1ZA 4N9UA 3SDQA 2QISA 3N5JF 3RYEA 5ILKA 5IK6A 3WEJA 1VG2A 3N0FA 5B0KA 3N6KF 4DHDA 1WL3A 4P0XA 5ERNA 3WJNA 4KFAA 3WC9A 3M01A 5CG6A 3WCBA 1RTRA 2P1CA 5HN7A 3NF2A 3VJCA 1HM7A 4XQSF 2ONGA 4KQSA 2PS5A 4H5DF 2Z50A 5IKHA 2RAHA 4FJQA 2ZEUA 3Q30A 3WEHA 2OPMA 5IKAA 1UBWA 5B0IA 3ADZA 4L2XF 2E4OA 3WCGA 2F94F 5EATA 2H8OA 2AZJA 4XQTF 5B0LA 4PVYF 1N24A 2ZCRA 1YYQA 4JZBA 4DWBA 1WL2A 3WCDA 3WCJA 4E9UA 2PS4A 2E8VA 4DXJA 2AEKA 4H5CF 2Z4XA 4LFGA 1HM4A 1VG4A 1YYSA 5IL3A 4NFKF 3N49F 4OKMA 3WJOA 4H5EF 3ACYA 2E8TA 2F7MF 3KROB 4KQ5A 5E8HA 3KRPA 5IVGA 5JA0F 3LGKA 5EASA 4E9ZA 2F92F 3KRAB 3RMGA 5HN9A 4DEMF 1ZW5A 5EROA 4K10A 4LLTA 2E90A 2OPNA 1YQ7A 3NPRA 5JV1F 4HD1A 4LXWA 4RYPA 5ILHA 1YV5A 4RXAA 4FP4A 1YYTA 3VJAA 2F9KF 2FTZA 3KRPB 3WE9A 1KIYA 2F89F 2ZY1A 3LGZB 3WEIA 4KVIA 5A0KA 3WCIA 3WSBA 3VJBA 4KPDA 3AQCB 3DYFA 4OKZA 4RXCA 3WCFA 2E8WA 1HXGA 4LFEA 5DHIA 4N1ZF 3LEEA 2Z4ZA 2Z7HA 3WCHA 3V1XA 1WL0A 5CG5A 4DZWA 1N22A 4LTZA 4QXSF 2PS6A 2J1OA 4ZQ8A 1YYRA 4LTVA 4DI5A 3PYBA 4RXDA 3ZMCA 3WSAA 1UBVA 3M00A 5H9DA 4QPFA 3WEGA 4NFIF 3PH7A 3WCCA 4KKMA 3LZ9A 3LK5A 1JFGA 4EA2A 3SAEA 2J5CA 4KVDA 1V4EA 3ID0A 3IPIA 3MZVA 3TC1A 4JZXA 3ZOUA 2OGDA 5ILYA 2PS8A 3PYAA 3TFVA 2E8UA 3KRCB 1YHKA 3CP6A 3RBMA 2ZEVA 2Z78A 4KVYA 4LPGF 5DJRF 1WL1A 3AE0A 2F8ZF 2O1OA 4NKEA 1V4JA 3N1VF 5JV2F 3QQVA 4LLSA 2E94A 4OMGA 3LSNA 3BNXA 4KQUA 2AZLA 3ICMA 3KROA 5B02A 2Z4VA 1KIZA 5IMPA 3EZ3A 3LG5A 2Z7IA 2ONHA 1YHLA 3KRAA 3N3DA 2I19A 3ICKA 2FORA 1DGPA 5A0IA 5ILJA 4NFJF 5B0MA 4NKFA 4Q23A 2Z4YA 4KK2A 3SDTA 3PKOA 3VJEA 4OGUA 3OABB 4UMJA 1VG7A 5B03A 1VG3A 3LLWA 3V1VA 4EA1A 5IK0A 3Q1OA 3WCMA 5ILZA 4EA0A 5ILDA 2ZCSA 3N0GA 5ILIA 4LUUA 3ZCDA 5AFXA 5DGMF 3OYRA 1HXAA 3LDWA 1RQJA 5DGSF
chains in the Genus database with same CATH topology
3VJ8A 3N46F 3M9UA 3EGTA 5B01A 5IM1A 3KRFB 5DW7A 3W7FA 2ZCQA 4LA5A 3PDEA 5E8LA 5IMIA 5ERMA 2AELA 3G4DA 1JFAA 3QKCA 4JXNA 3SDUA 3AQ0A 4JXYA 2Z52A 3LMDA 4GA3A 4LZCA 4MC0A 1YYUA 4LA6A 1V4HA 1EZFA 1WY0A 1UBYA 3ICNA 5AYPA 3WEFA 3MAVA 1V4IA 3CKEA 2PS7A 3N5HF 2Q80A 3UCAA 3KRCA 4P0WA 3OACB 3N1WF 4KUXA 5A0JA 3KBKA 1HX9A 3Q2ZA 4KPJA 1PS1A 5AELA 3APZA 4P0VA 3M02A 4F6XA 2AZKA 3SDRA 3LOMA 3S4JA 1YHMA 5DHKA 3WCAA 2OA6A 3ICZA 2Q9ZA 4KVWA 1UBXA 4GP2A 3P8RA 5DGNF 5B00A 2AETA 2E92A 4LZ3A 3ACXA 4OMHA 4DWGA 2E95A 5B0JA 4MC8A 1DI1A 1WMWA 4PVXF 5DIQF 5E8KA 3BNYA 3EFQA 3WEKA 3ZL6A 2Q9YA 4WK5A 3IBAA 3N45F 4LZ0A 5IMNA 1RQIA 1WKZA 3OABA 5IL8A 1FPSA 5AHUB 3DYHA 2J1PA 4E1EA 3WCEA 3P8LA 4GAXA 3NPKA 5HN8A 5KSXF 2E91A 1N23A 3KB9A 4NUAA 3TFNA 3TS7A 1N1BA 5EAUA 4JVJF 5ER8A 3TFPA 1VG6A 5IN8A 3M0GA 3KRFA 2VF6A 4RNQA 5HNAA 3RYWA 2Z4WA 3ZMBA 5IK9A 3P5RA 4MC3A 3Q2QA 1YJ4A 4GP1A 3S9VA 3V66A 4RXEA 4JYXA 3LVSA 4LPHF 4KWDA 2ZCOA 3SDVA 3G4FA 2EWGA 5JV0F 3OACA 4XQRF 3P5PA 5JUZF 3AQBB 3WJKA 3P41A 3VJ9A 3NRIA 5DJVF 1N21A 3B7LA 4LIXA 2E8XA 5DZ2A 3CC9A 3N3LF 5I1UA 2Q58A 4LFVF 5C05A 1N20A 2E93A 4F62A 1HXCA 4LOBA 5DJPF 4NG6A 3VJDA 1V4KA 2F8CF 3ASXA 3LJIA 3WCLA 4F6VA 3ACWA 2DH4A 3DYGA 1N1ZA 4N9UA 3SDQA 2QISA 3N5JF 3RYEA 5ILKA 5IK6A 3WEJA 1VG2A 3N0FA 5B0KA 3N6KF 4DHDA 1WL3A 4P0XA 5ERNA 3WJNA 4KFAA 3WC9A 3M01A 5CG6A 3WCBA 1RTRA 2P1CA 5HN7A 3NF2A 3VJCA 1HM7A 4XQSF 2ONGA 4KQSA 2PS5A 4H5DF 2Z50A 5IKHA 2RAHA 4FJQA 2ZEUA 3Q30A 3WEHA 2OPMA 5IKAA 1UBWA 5B0IA 3ADZA 4L2XF 2E4OA 3WCGA 2F94F 5EATA 2H8OA 2AZJA 4XQTF 5B0LA 4PVYF 1N24A 2ZCRA 1YYQA 4JZBA 4DWBA 1WL2A 3WCDA 3WCJA 4E9UA 2PS4A 2E8VA 4DXJA 2AEKA 4H5CF 2Z4XA 4LFGA 1HM4A 1VG4A 1YYSA 5IL3A 4NFKF 3N49F 4OKMA 3WJOA 4H5EF 3ACYA 2E8TA 2F7MF 3KROB 4KQ5A 5E8HA 3KRPA 5IVGA 5JA0F 3LGKA 5EASA 4E9ZA 2F92F 3KRAB 3RMGA 5HN9A 4DEMF 1ZW5A 5EROA 4K10A 4LLTA 2E90A 2OPNA 1YQ7A 3NPRA 5JV1F 4HD1A 4LXWA 4RYPA 5ILHA 1YV5A 4RXAA 4FP4A 1YYTA 3VJAA 2F9KF 2FTZA 3KRPB 3WE9A 1KIYA 2F89F 2ZY1A 3LGZB 3WEIA 4KVIA 5A0KA 3WCIA 3WSBA 3VJBA 4KPDA 3AQCB 3DYFA 4OKZA 4RXCA 3WCFA 2E8WA 1HXGA 4LFEA 5DHIA 4N1ZF 3LEEA 2Z4ZA 2Z7HA 3WCHA 3V1XA 1WL0A 5CG5A 4DZWA 1N22A 4LTZA 4QXSF 2PS6A 2J1OA 4ZQ8A 1YYRA 4LTVA 4DI5A 3PYBA 4RXDA 3ZMCA 3WSAA 1UBVA 3M00A 5H9DA 4QPFA 3WEGA 4NFIF 3PH7A 3WCCA 4KKMA 3LZ9A 3LK5A 1JFGA 4EA2A 3SAEA 2J5CA 4KVDA 1V4EA 3ID0A 3IPIA 3MZVA 3TC1A 4JZXA 3ZOUA 2OGDA 5ILYA 2PS8A 3PYAA 3TFVA 2E8UA 3KRCB 1YHKA 3CP6A 3RBMA 2ZEVA 2Z78A 4KVYA 4LPGF 5DJRF 1WL1A 3AE0A 2F8ZF 2O1OA 4NKEA 1V4JA 3N1VF 5JV2F 3QQVA 4LLSA 2E94A 4OMGA 3LSNA 3BNXA 4KQUA 2AZLA 3ICMA 3KROA 5B02A 2Z4VA 1KIZA 5IMPA 3EZ3A 3LG5A 2Z7IA 2ONHA 1YHLA 3KRAA 3N3DA 2I19A 3ICKA 2FORA 1DGPA 5A0IA 5ILJA 4NFJF 5B0MA 4NKFA 4Q23A 2Z4YA 4KK2A 3SDTA 3PKOA 3VJEA 4OGUA 3OABB 4UMJA 1VG7A 5B03A 1VG3A 3LLWA 3V1VA 4EA1A 5IK0A 3Q1OA 3WCMA 5ILZA 4EA0A 5ILDA 2ZCSA 3N0GA 5ILIA 4LUUA 3ZCDA 5AFXA 5DGMF 3OYRA 1HXAA 3LDWA 1RQJA 5DGSF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VJ8 A;  3N46 F;  3M9U A;  3EGT A;  5B01 A;  5IM1 A;  3KRF B;  5DW7 A;  3W7F A;  2ZCQ A;  4LA5 A;  3PDE A;  5E8L A;  5IMI A;  5ERM A;  2AEL A;  3G4D A;  1JFA A;  3QKC A;  4JXN A;  3SDU A;  3AQ0 A;  4JXY A;  2Z52 A;  3LMD A;  4GA3 A;  4LZC A;  4MC0 A;  1YYU A;  4LA6 A;  1V4H A;  1EZF A;  1WY0 A;  1UBY A;  3ICN A;  5AYP A;  3WEF A;  3MAV A;  1V4I A;  3CKE A;  2PS7 A;  3N5H F;  2Q80 A;  3UCA A;  3KRC A;  4P0W A;  3OAC B;  3N1W F;  4KUX A;  5A0J A;  3KBK A;  1HX9 A;  3Q2Z A;  4KPJ A;  1PS1 A;  5AEL A;  3APZ A;  4P0V A;  3M02 A;  4F6X A;  2AZK A;  3SDR A;  3LOM A;  3S4J A;  1YHM A;  5DHK A;  3WCA A;  2OA6 A;  3ICZ A;  2Q9Z A;  4KVW A;  1UBX A;  4GP2 A;  3P8R A;  5DGN F;  5B00 A;  2AET A;  2E92 A;  4LZ3 A;  3ACX A;  4OMH A;  4DWG A;  2E95 A;  5B0J A;  4MC8 A;  1DI1 A;  1WMW A;  4PVX F;  5DIQ F;  5E8K A;  3BNY A;  3EFQ A;  3WEK A;  3ZL6 A;  2Q9Y A;  4WK5 A;  3IBA A;  3N45 F;  4LZ0 A;  5IMN A;  1RQI A;  1WKZ A;  3OAB A;  5IL8 A;  1FPS A;  5AHU B;  3DYH A;  2J1P A;  4E1E A;  3WCE A;  3P8L A;  4GAX A;  3NPK A;  5HN8 A;  5KSX F;  2E91 A;  1N23 A;  3KB9 A;  4NUA A;  3TFN A;  3TS7 A;  1N1B A;  5EAU A;  4JVJ F;  5ER8 A;  3TFP A;  1VG6 A;  5IN8 A;  3M0G A;  3KRF A;  2VF6 A;  4RNQ A;  5HNA A;  3RYW A;  2Z4W A;  3ZMB A;  5IK9 A;  3P5R A;  4MC3 A;  3Q2Q A;  1YJ4 A;  4GP1 A;  3S9V A;  3V66 A;  4RXE A;  4JYX A;  3LVS A;  4LPH F;  4KWD A;  2ZCO A;  3SDV A;  3G4F A;  2EWG A;  5JV0 F;  3OAC A;  4XQR F;  3P5P A;  5JUZ F;  3AQB B;  3WJK A;  3P41 A;  3VJ9 A;  3NRI A;  5DJV F;  1N21 A;  3B7L A;  4LIX A;  2E8X A;  5DZ2 A;  3CC9 A;  3N3L F;  5I1U A;  2Q58 A;  4LFV F;  5C05 A;  1N20 A;  2E93 A;  4F62 A;  1HXC A;  4LOB A;  5DJP F;  4NG6 A;  3VJD A;  1V4K A;  2F8C F;  3ASX A;  3LJI A;  3WCL A;  4F6V A;  3ACW A;  2DH4 A;  3DYG A;  1N1Z A;  4N9U A;  3SDQ A;  2QIS A;  3N5J F;  3RYE A;  5ILK A;  5IK6 A;  3WEJ A;  1VG2 A;  3N0F A;  5B0K A;  3N6K F;  4DHD A;  1WL3 A;  4P0X A;  5ERN A;  3WJN A;  4KFA A;  3WC9 A;  3M01 A;  5CG6 A;  3WCB A;  1RTR A;  2P1C A;  5HN7 A;  3NF2 A;  3VJC A;  1HM7 A;  4XQS F;  2ONG A;  4KQS A;  2PS5 A;  4H5D F;  2Z50 A;  5IKH A;  2RAH A;  4FJQ A;  2ZEU A;  3Q30 A;  3WEH A;  2OPM A;  5IKA A;  1UBW A;  5B0I A;  3ADZ A;  4L2X F;  2E4O A;  3WCG A;  2F94 F;  5EAT A;  2H8O A;  2AZJ A;  4XQT F;  5B0L A;  4PVY F;  1N24 A;  2ZCR A;  1YYQ A;  4JZB A;  4DWB A;  1WL2 A;  3WCD A;  3WCJ A;  4E9U A;  2PS4 A;  2E8V A;  4DXJ A;  2AEK A;  4H5C F;  2Z4X A;  4LFG A;  1HM4 A;  1VG4 A;  1YYS A;  5IL3 A;  4NFK F;  3N49 F;  4OKM A;  3WJO A;  4H5E F;  3ACY A;  2E8T A;  2F7M F;  3KRO B;  4KQ5 A;  5E8H A;  3KRP A;  5IVG A;  5JA0 F;  3LGK A;  5EAS A;  4E9Z A;  2F92 F;  3KRA B;  3RMG A;  5HN9 A;  4DEM F;  1ZW5 A;  5ERO A;  4K10 A;  4LLT A;  2E90 A;  2OPN A;  1YQ7 A;  3NPR A;  5JV1 F;  4HD1 A;  4LXW A;  4RYP A;  5ILH A;  1YV5 A;  4RXA A;  4FP4 A;  1YYT A;  3VJA A;  2F9K F;  2FTZ A;  3KRP B;  3WE9 A;  1KIY A;  2F89 F;  2ZY1 A;  3LGZ B;  3WEI A;  4KVI A;  5A0K A;  3WCI A;  3WSB A;  3VJB A;  4KPD A;  3AQC B;  3DYF A;  4OKZ A;  4RXC A;  3WCF A;  2E8W A;  1HXG A;  4LFE A;  5DHI A;  4N1Z F;  3LEE A;  2Z4Z A;  2Z7H A;  3WCH A;  3V1X A;  1WL0 A;  5CG5 A;  4DZW A;  1N22 A;  4LTZ A;  4QXS F;  2PS6 A;  2J1O A;  4ZQ8 A;  1YYR A;  4LTV A;  4DI5 A;  3PYB A;  4RXD A;  3ZMC A;  3WSA A;  1UBV A;  3M00 A;  5H9D A;  4QPF A;  3WEG A;  4NFI F;  3PH7 A;  3WCC A;  4KKM A;  3LZ9 A;  3LK5 A;  1JFG A;  4EA2 A;  3SAE A;  2J5C A;  4KVD A;  1V4E A;  3ID0 A;  3IPI A;  3MZV A;  3TC1 A;  4JZX A;  3ZOU A;  2OGD A;  5ILY A;  2PS8 A;  3PYA A;  3TFV A;  2E8U A;  3KRC B;  1YHK A;  3CP6 A;  3RBM A;  2ZEV A;  2Z78 A;  4KVY A;  4LPG F;  5DJR F;  1WL1 A;  3AE0 A;  2F8Z F;  2O1O A;  4NKE A;  1V4J A;  3N1V F;  5JV2 F;  3QQV A;  4LLS A;  2E94 A;  4OMG A;  3LSN A;  3BNX A;  4KQU A;  2AZL A;  3ICM A;  3KRO A;  5B02 A;  2Z4V A;  1KIZ A;  5IMP A;  3EZ3 A;  3LG5 A;  2Z7I A;  2ONH A;  1YHL A;  3KRA A;  3N3D A;  2I19 A;  3ICK A;  2FOR A;  1DGP A;  5A0I A;  5ILJ A;  4NFJ F;  5B0M A;  4NKF A;  4Q23 A;  2Z4Y A;  4KK2 A;  3SDT A;  3PKO A;  3VJE A;  4OGU A;  3OAB B;  4UMJ A;  1VG7 A;  5B03 A;  1VG3 A;  3LLW A;  3V1V A;  4EA1 A;  5IK0 A;  3Q1O A;  3WCM A;  5ILZ A;  4EA0 A;  5ILD A;  2ZCS A;  3N0G A;  5ILI A;  4LUU A;  3ZCD A;  5AFX A;  5DGM F;  3OYR A;  1HXA A;  3LDW A;  1RQJ A;  5DGS F; 
#chains in the Genus database with same CATH topology
 3VJ8 A;  3N46 F;  3M9U A;  3EGT A;  5B01 A;  5IM1 A;  3KRF B;  5DW7 A;  3W7F A;  2ZCQ A;  4LA5 A;  3PDE A;  5E8L A;  5IMI A;  5ERM A;  2AEL A;  3G4D A;  1JFA A;  3QKC A;  4JXN A;  3SDU A;  3AQ0 A;  4JXY A;  2Z52 A;  3LMD A;  4GA3 A;  4LZC A;  4MC0 A;  1YYU A;  4LA6 A;  1V4H A;  1EZF A;  1WY0 A;  1UBY A;  3ICN A;  5AYP A;  3WEF A;  3MAV A;  1V4I A;  3CKE A;  2PS7 A;  3N5H F;  2Q80 A;  3UCA A;  3KRC A;  4P0W A;  3OAC B;  3N1W F;  4KUX A;  5A0J A;  3KBK A;  1HX9 A;  3Q2Z A;  4KPJ A;  1PS1 A;  5AEL A;  3APZ A;  4P0V A;  3M02 A;  4F6X A;  2AZK A;  3SDR A;  3LOM A;  3S4J A;  1YHM A;  5DHK A;  3WCA A;  2OA6 A;  3ICZ A;  2Q9Z A;  4KVW A;  1UBX A;  4GP2 A;  3P8R A;  5DGN F;  5B00 A;  2AET A;  2E92 A;  4LZ3 A;  3ACX A;  4OMH A;  4DWG A;  2E95 A;  5B0J A;  4MC8 A;  1DI1 A;  1WMW A;  4PVX F;  5DIQ F;  5E8K A;  3BNY A;  3EFQ A;  3WEK A;  3ZL6 A;  2Q9Y A;  4WK5 A;  3IBA A;  3N45 F;  4LZ0 A;  5IMN A;  1RQI A;  1WKZ A;  3OAB A;  5IL8 A;  1FPS A;  5AHU B;  3DYH A;  2J1P A;  4E1E A;  3WCE A;  3P8L A;  4GAX A;  3NPK A;  5HN8 A;  5KSX F;  2E91 A;  1N23 A;  3KB9 A;  4NUA A;  3TFN A;  3TS7 A;  1N1B A;  5EAU A;  4JVJ F;  5ER8 A;  3TFP A;  1VG6 A;  5IN8 A;  3M0G A;  3KRF A;  2VF6 A;  4RNQ A;  5HNA A;  3RYW A;  2Z4W A;  3ZMB A;  5IK9 A;  3P5R A;  4MC3 A;  3Q2Q A;  1YJ4 A;  4GP1 A;  3S9V A;  3V66 A;  4RXE A;  4JYX A;  3LVS A;  4LPH F;  4KWD A;  2ZCO A;  3SDV A;  3G4F A;  2EWG A;  5JV0 F;  3OAC A;  4XQR F;  3P5P A;  5JUZ F;  3AQB B;  3WJK A;  3P41 A;  3VJ9 A;  3NRI A;  5DJV F;  1N21 A;  3B7L A;  4LIX A;  2E8X A;  5DZ2 A;  3CC9 A;  3N3L F;  5I1U A;  2Q58 A;  4LFV F;  5C05 A;  1N20 A;  2E93 A;  4F62 A;  1HXC A;  4LOB A;  5DJP F;  4NG6 A;  3VJD A;  1V4K A;  2F8C F;  3ASX A;  3LJI A;  3WCL A;  4F6V A;  3ACW A;  2DH4 A;  3DYG A;  1N1Z A;  4N9U A;  3SDQ A;  2QIS A;  3N5J F;  3RYE A;  5ILK A;  5IK6 A;  3WEJ A;  1VG2 A;  3N0F A;  5B0K A;  3N6K F;  4DHD A;  1WL3 A;  4P0X A;  5ERN A;  3WJN A;  4KFA A;  3WC9 A;  3M01 A;  5CG6 A;  3WCB A;  1RTR A;  2P1C A;  5HN7 A;  3NF2 A;  3VJC A;  1HM7 A;  4XQS F;  2ONG A;  4KQS A;  2PS5 A;  4H5D F;  2Z50 A;  5IKH A;  2RAH A;  4FJQ A;  2ZEU A;  3Q30 A;  3WEH A;  2OPM A;  5IKA A;  1UBW A;  5B0I A;  3ADZ A;  4L2X F;  2E4O A;  3WCG A;  2F94 F;  5EAT A;  2H8O A;  2AZJ A;  4XQT F;  5B0L A;  4PVY F;  1N24 A;  2ZCR A;  1YYQ A;  4JZB A;  4DWB A;  1WL2 A;  3WCD A;  3WCJ A;  4E9U A;  2PS4 A;  2E8V A;  4DXJ A;  2AEK A;  4H5C F;  2Z4X A;  4LFG A;  1HM4 A;  1VG4 A;  1YYS A;  5IL3 A;  4NFK F;  3N49 F;  4OKM A;  3WJO A;  4H5E F;  3ACY A;  2E8T A;  2F7M F;  3KRO B;  4KQ5 A;  5E8H A;  3KRP A;  5IVG A;  5JA0 F;  3LGK A;  5EAS A;  4E9Z A;  2F92 F;  3KRA B;  3RMG A;  5HN9 A;  4DEM F;  1ZW5 A;  5ERO A;  4K10 A;  4LLT A;  2E90 A;  2OPN A;  1YQ7 A;  3NPR A;  5JV1 F;  4HD1 A;  4LXW A;  4RYP A;  5ILH A;  1YV5 A;  4RXA A;  4FP4 A;  1YYT A;  3VJA A;  2F9K F;  2FTZ A;  3KRP B;  3WE9 A;  1KIY A;  2F89 F;  2ZY1 A;  3LGZ B;  3WEI A;  4KVI A;  5A0K A;  3WCI A;  3WSB A;  3VJB A;  4KPD A;  3AQC B;  3DYF A;  4OKZ A;  4RXC A;  3WCF A;  2E8W A;  1HXG A;  4LFE A;  5DHI A;  4N1Z F;  3LEE A;  2Z4Z A;  2Z7H A;  3WCH A;  3V1X A;  1WL0 A;  5CG5 A;  4DZW A;  1N22 A;  4LTZ A;  4QXS F;  2PS6 A;  2J1O A;  4ZQ8 A;  1YYR A;  4LTV A;  4DI5 A;  3PYB A;  4RXD A;  3ZMC A;  3WSA A;  1UBV A;  3M00 A;  5H9D A;  4QPF A;  3WEG A;  4NFI F;  3PH7 A;  3WCC A;  4KKM A;  3LZ9 A;  3LK5 A;  1JFG A;  4EA2 A;  3SAE A;  2J5C A;  4KVD A;  1V4E A;  3ID0 A;  3IPI A;  3MZV A;  3TC1 A;  4JZX A;  3ZOU A;  2OGD A;  5ILY A;  2PS8 A;  3PYA A;  3TFV A;  2E8U A;  3KRC B;  1YHK A;  3CP6 A;  3RBM A;  2ZEV A;  2Z78 A;  4KVY A;  4LPG F;  5DJR F;  1WL1 A;  3AE0 A;  2F8Z F;  2O1O A;  4NKE A;  1V4J A;  3N1V F;  5JV2 F;  3QQV A;  4LLS A;  2E94 A;  4OMG A;  3LSN A;  3BNX A;  4KQU A;  2AZL A;  3ICM A;  3KRO A;  5B02 A;  2Z4V A;  1KIZ A;  5IMP A;  3EZ3 A;  3LG5 A;  2Z7I A;  2ONH A;  1YHL A;  3KRA A;  3N3D A;  2I19 A;  3ICK A;  2FOR A;  1DGP A;  5A0I A;  5ILJ A;  4NFJ F;  5B0M A;  4NKF A;  4Q23 A;  2Z4Y A;  4KK2 A;  3SDT A;  3PKO A;  3VJE A;  4OGU A;  3OAB B;  4UMJ A;  1VG7 A;  5B03 A;  1VG3 A;  3LLW A;  3V1V A;  4EA1 A;  5IK0 A;  3Q1O A;  3WCM A;  5ILZ A;  4EA0 A;  5ILD A;  2ZCS A;  3N0G A;  5ILI A;  4LUU A;  3ZCD A;  5AFX A;  5DGM F;  3OYR A;  1HXA A;  3LDW A;  1RQJ A;  5DGS F; 
#chains in the Genus database with same CATH homology
 3VJ8 A;  3N46 F;  3M9U A;  3EGT A;  5B01 A;  5IM1 A;  3KRF B;  5DW7 A;  3W7F A;  2ZCQ A;  4LA5 A;  3PDE A;  5E8L A;  5IMI A;  5ERM A;  2AEL A;  3G4D A;  1JFA A;  3QKC A;  4JXN A;  3SDU A;  3AQ0 A;  4JXY A;  2Z52 A;  3LMD A;  4GA3 A;  4LZC A;  4MC0 A;  1YYU A;  4LA6 A;  1V4H A;  1EZF A;  1WY0 A;  1UBY A;  3ICN A;  5AYP A;  3WEF A;  3MAV A;  1V4I A;  3CKE A;  2PS7 A;  3N5H F;  2Q80 A;  3UCA A;  3KRC A;  4P0W A;  3OAC B;  3N1W F;  4KUX A;  5A0J A;  3KBK A;  1HX9 A;  3Q2Z A;  4KPJ A;  1PS1 A;  5AEL A;  3APZ A;  4P0V A;  3M02 A;  4F6X A;  2AZK A;  3SDR A;  3LOM A;  3S4J A;  1YHM A;  5DHK A;  3WCA A;  2OA6 A;  3ICZ A;  2Q9Z A;  4KVW A;  1UBX A;  4GP2 A;  3P8R A;  5DGN F;  5B00 A;  2AET A;  2E92 A;  4LZ3 A;  3ACX A;  4OMH A;  4DWG A;  2E95 A;  5B0J A;  4MC8 A;  1DI1 A;  1WMW A;  4PVX F;  5DIQ F;  5E8K A;  3BNY A;  3EFQ A;  3WEK A;  3ZL6 A;  2Q9Y A;  4WK5 A;  3IBA A;  3N45 F;  4LZ0 A;  5IMN A;  1RQI A;  1WKZ A;  3OAB A;  5IL8 A;  1FPS A;  5AHU B;  3DYH A;  2J1P A;  4E1E A;  3WCE A;  3P8L A;  4GAX A;  3NPK A;  5HN8 A;  5KSX F;  2E91 A;  1N23 A;  3KB9 A;  4NUA A;  3TFN A;  3TS7 A;  1N1B A;  5EAU A;  4JVJ F;  5ER8 A;  3TFP A;  1VG6 A;  5IN8 A;  3M0G A;  3KRF A;  2VF6 A;  4RNQ A;  5HNA A;  3RYW A;  2Z4W A;  3ZMB A;  5IK9 A;  3P5R A;  4MC3 A;  3Q2Q A;  1YJ4 A;  4GP1 A;  3S9V A;  3V66 A;  4RXE A;  4JYX A;  3LVS A;  4LPH F;  4KWD A;  2ZCO A;  3SDV A;  3G4F A;  2EWG A;  5JV0 F;  3OAC A;  4XQR F;  3P5P A;  5JUZ F;  3AQB B;  3WJK A;  3P41 A;  3VJ9 A;  3NRI A;  5DJV F;  1N21 A;  3B7L A;  4LIX A;  2E8X A;  5DZ2 A;  3CC9 A;  3N3L F;  5I1U A;  2Q58 A;  4LFV F;  5C05 A;  1N20 A;  2E93 A;  4F62 A;  1HXC A;  4LOB A;  5DJP F;  4NG6 A;  3VJD A;  1V4K A;  2F8C F;  3ASX A;  3LJI A;  3WCL A;  4F6V A;  3ACW A;  2DH4 A;  3DYG A;  1N1Z A;  4N9U A;  3SDQ A;  2QIS A;  3N5J F;  3RYE A;  5ILK A;  5IK6 A;  3WEJ A;  1VG2 A;  3N0F A;  5B0K A;  3N6K F;  4DHD A;  1WL3 A;  4P0X A;  5ERN A;  3WJN A;  4KFA A;  3WC9 A;  3M01 A;  5CG6 A;  3WCB A;  1RTR A;  2P1C A;  5HN7 A;  3NF2 A;  3VJC A;  1HM7 A;  4XQS F;  2ONG A;  4KQS A;  2PS5 A;  4H5D F;  2Z50 A;  5IKH A;  2RAH A;  4FJQ A;  2ZEU A;  3Q30 A;  3WEH A;  2OPM A;  5IKA A;  1UBW A;  5B0I A;  3ADZ A;  4L2X F;  2E4O A;  3WCG A;  2F94 F;  5EAT A;  2H8O A;  2AZJ A;  4XQT F;  5B0L A;  4PVY F;  1N24 A;  2ZCR A;  1YYQ A;  4JZB A;  4DWB A;  1WL2 A;  3WCD A;  3WCJ A;  4E9U A;  2PS4 A;  2E8V A;  4DXJ A;  2AEK A;  4H5C F;  2Z4X A;  4LFG A;  1HM4 A;  1VG4 A;  1YYS A;  5IL3 A;  4NFK F;  3N49 F;  4OKM A;  3WJO A;  4H5E F;  3ACY A;  2E8T A;  2F7M F;  3KRO B;  4KQ5 A;  5E8H A;  3KRP A;  5IVG A;  5JA0 F;  3LGK A;  5EAS A;  4E9Z A;  2F92 F;  3KRA B;  3RMG A;  5HN9 A;  4DEM F;  1ZW5 A;  5ERO A;  4K10 A;  4LLT A;  2E90 A;  2OPN A;  1YQ7 A;  3NPR A;  5JV1 F;  4HD1 A;  4LXW A;  4RYP A;  5ILH A;  1YV5 A;  4RXA A;  4FP4 A;  1YYT A;  3VJA A;  2F9K F;  2FTZ A;  3KRP B;  3WE9 A;  1KIY A;  2F89 F;  2ZY1 A;  3LGZ B;  3WEI A;  4KVI A;  5A0K A;  3WCI A;  3WSB A;  3VJB A;  4KPD A;  3AQC B;  3DYF A;  4OKZ A;  4RXC A;  3WCF A;  2E8W A;  1HXG A;  4LFE A;  5DHI A;  4N1Z F;  3LEE A;  2Z4Z A;  2Z7H A;  3WCH A;  3V1X A;  1WL0 A;  5CG5 A;  4DZW A;  1N22 A;  4LTZ A;  4QXS F;  2PS6 A;  2J1O A;  4ZQ8 A;  1YYR A;  4LTV A;  4DI5 A;  3PYB A;  4RXD A;  3ZMC A;  3WSA A;  1UBV A;  3M00 A;  5H9D A;  4QPF A;  3WEG A;  4NFI F;  3PH7 A;  3WCC A;  4KKM A;  3LZ9 A;  3LK5 A;  1JFG A;  4EA2 A;  3SAE A;  2J5C A;  4KVD A;  1V4E A;  3ID0 A;  3IPI A;  3MZV A;  3TC1 A;  4JZX A;  3ZOU A;  2OGD A;  5ILY A;  2PS8 A;  3PYA A;  3TFV A;  2E8U A;  3KRC B;  1YHK A;  3CP6 A;  3RBM A;  2ZEV A;  2Z78 A;  4KVY A;  4LPG F;  5DJR F;  1WL1 A;  3AE0 A;  2F8Z F;  2O1O A;  4NKE A;  1V4J A;  3N1V F;  5JV2 F;  3QQV A;  4LLS A;  2E94 A;  4OMG A;  3LSN A;  3BNX A;  4KQU A;  2AZL A;  3ICM A;  3KRO A;  5B02 A;  2Z4V A;  1KIZ A;  5IMP A;  3EZ3 A;  3LG5 A;  2Z7I A;  2ONH A;  1YHL A;  3KRA A;  3N3D A;  2I19 A;  3ICK A;  2FOR A;  1DGP A;  5A0I A;  5ILJ A;  4NFJ F;  5B0M A;  4NKF A;  4Q23 A;  2Z4Y A;  4KK2 A;  3SDT A;  3PKO A;  3VJE A;  4OGU A;  3OAB B;  4UMJ A;  1VG7 A;  5B03 A;  1VG3 A;  3LLW A;  3V1V A;  4EA1 A;  5IK0 A;  3Q1O A;  3WCM A;  5ILZ A;  4EA0 A;  5ILD A;  2ZCS A;  3N0G A;  5ILI A;  4LUU A;  3ZCD A;  5AFX A;  5DGM F;  3OYR A;  1HXA A;  3LDW A;  1RQJ A;  5DGS F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...