3NRIA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from s. aureus complexed with dehydrosqualene (dhs)
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
284
structure length
279
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transferase
total genus 116
structure length 279
sequence length 284
ec nomenclature
pdb deposition date 2010-06-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3nriA00
4KVDA 2ONHA 2E95A 3G4FA 3TC1A 3WCAA 2OA6A 5DHKA 2Z78A 4JYXA 1HXCA 5ILJA 3IPIA 3KB9A 4LLSA 5ILHA 5DGNF 1UBXA 2AEKA 2ZEVA 2PS7A 1HM7A 2ZCRA 4KQSA 4EA2A 5EROA 4LTVA 5IKHA 1V4IA 3KRFA 4RXEA 3ACWA 3ADZA 4HD1A 1YYUA 1UBYA 4LIXA 5DIQF 5CG5A 5IVGA 4KFAA 3VJDA 1V4HA 3KROB 3APZA 3LSNA 5HN7A 3N45F 1WL2A 4MC0A 4ZQ8A 5CG6A 4EA0A 3M00A 2AZKA 3LDWA 3ASXA 3ICKA 5IL3A 3S9VA 1ZW5A 3M0GA 2FTZA 3OABA 5DJPF 2OGDA 4E9UA 2F94F 3WCCA 4LZ0A 1JFGA 1WY0A 3KRAA 4DEMF 1HXAA 2Q9YA 3CKEA 1WL1A 4LXWA 3TFNA 3NRIA 4NFJF 3WCFA 4JXNA 5E8KA 3TFPA 2PS5A 5ILZA 4N9UA 2E8WA 4KWDA 4KK2A 1RQIA 3KRCA 3CC9A 4EA1A 1YHMA 3V66A 3RYWA 2ONGA 3SDTA 3LGZB 2J5CA 1N23A 1N1ZA 2OPNA 1WKZA 4DI5A 3RMGA 3ZMCA 5ER8A 4GAXA 2ZY1A 4F6VA 4F62A 4LFEA 5JA0F 2PS6A 5IN8A 3WCIA 3LG5A 2AELA 2PS8A 4KVWA 4QXSF 2Z7IA 3N5HF 3OYRA 4LPGF 3WCHA 5JV2F 2P1CA 3WCMA 3WC9A 2ZCSA 5KSXF 3AQBB 4FJQA 5DGSF 4KQ5A 3OACB 2AZJA 4LUUA 3TFVA 3Q2QA 2E90A 1N21A 4KPJA 5AYPA 5AHUB 1RQJA 3P5RA 3WCEA 4Q23A 5DGMF 4FP4A 3W7FA 2E8VA 3WSAA 4L2XF 2Q58A 3DYFA 3ZL6A 5EAUA 2H8OA 5IMIA 4KQUA 5B0MA 3ZMBA 2F89F 3SDRA 1YYQA 2J1OA 3WCLA 3Q1OA 3DYGA 3V1XA 3CP6A 1HM4A 1N20A 1YHKA 3P8RA 2E8XA 3MZVA 4H5CF 1VG3A 5IMPA 4P0XA 5B01A 3RYEA 3LGKA 3P5PA 3ZOUA 1YYRA 2Z4WA 1N1BA 4NUAA 2F7MF 1KIZA 2VF6A 1EZFA 2O1OA 3KBKA 2F9KF 2PS4A 3WCGA 4DWGA 3LZ9A 4LA6A 5DW7A 5ILIA 3Q2ZA 5IK6A 2FORA 3RBMA 2Q80A 3WJNA 4GA3A 3KRPB 2E93A 3WEHA 1FPSA 4RXDA 4NKFA 4DWBA 5A0IA 2ZCQA 5B0LA 1YYSA 2DH4A 1VG4A 3AQ0A 5EASA 4KVYA 4PVYF 4XQTF 4LA5A 2E92A 5A0JA 5B03A 1WMWA 4MC8A 4P0WA 3N49F 4OGUA 1YHLA 1WL3A 5EATA 3WEGA 3LVSA 3KRFB 2AZLA 2E8TA 1KIYA 4JZBA 1YV5A 2Z4YA 3WJOA 5AFXA 1N24A 2I19A 4JZXA 4PVXF 2F92F 2J1PA 3PDEA 5DJVF 3BNXA 3LOMA 4NFIF 3OACA 4JVJF 2ZCOA 2AETA 3DYHA 3SDQA 3KRAB 5B02A 1VG2A 3N3LF 3ICZA 4GP2A 4E9ZA 3ZCDA 2ZEUA 1YQ7A 3N0FA 3ID0A 4LTZA 3KRCB 3PH7A 5DZ2A 3TS7A 3WCDA 3BNYA 1JFAA 3EZ3A 4OKMA 5IK9A 3S4JA 4DZWA 3WEFA 1PS1A 5IL8A 4K10A 3N1WF 3WE9A 2RAHA 3VJCA 4RXCA 4RNQA 4P0VA 3ACXA 4KKMA 3P41A 3VJEA 4DHDA 5A0KA 1WL0A 3WCBA 3VJ8A 2Z7HA 3VJBA 3KROA 2Q9ZA 5HN8A 2E8UA 5IKAA 3M02A 2F8ZF 3EFQA 4LZCA 3KRPA 5DJRF 5B00A 1V4JA 4NFKF 3PYAA 3SAEA 4LZ3A 3Q30A 2OPMA 3N46F 5E8LA 1DI1A 3WSBA 1V4KA 3B7LA 3N1VF 4QPFA 1VG7A 3P8LA 3QQVA 3WEKA 3ICMA 4LPHF 4OMHA 3N0GA 2E94A 3LLWA 3WEIA 4RXAA 3NPKA 3LJIA 3M9UA 4H5DF 4NG6A 5B0JA 3N5JF 5DHIA 4H5EF 1RTRA 5B0KA 5HN9A 3QKCA 3SDVA 5ILKA 5JV0F 1DGPA 3AQCB 4LFGA 4JXYA 3EGTA 3SDUA 2Z4ZA 3PYBA 4XQRF 4LOBA 3MAVA 3NF2A 5H9DA 3M01A 3AE0A 4RYPA 4LFVF 3WEJA 1YYTA 3ICNA 1HXGA 4MC3A 3NPRA 5ERMA 2E91A 3IBAA 4NKEA 3OABB 1N22A 2Z4VA 3N6KF 1VG6A 1YJ4A 1UBWA 5IK0A 5C05A 1HX9A 2EWGA 4WK5A 5JV1F 4LLTA 4F6XA 5JUZF 4XQSF 3VJ9A 3WCJA 4KUXA 4OKZA 4UMJA 3PKOA 1UBVA 2Z50A 2F8CF 5I1UA 5E8HA 2QISA 4DXJA 2Z4XA 5ERNA 3N3DA 4N1ZF 3ACYA 5HNAA 5ILDA 5AELA 3VJAA 4OMGA 5B0IA 3WJKA 2E4OA 3LMDA 2Z52A 3G4DA 3LEEA 5ILYA 5IMNA 3UCAA 5IM1A 3LK5A 1V4EA 4GP1A 3V1VA 4KVIA 4E1EA 4KPDA
chains in the Genus database with same CATH superfamily
4KVDA 2ONHA 2E95A 3G4FA 3TC1A 3WCAA 2OA6A 5DHKA 2Z78A 4JYXA 1HXCA 5ILJA 3IPIA 3KB9A 4LLSA 5ILHA 5DGNF 1UBXA 2AEKA 2ZEVA 2PS7A 1HM7A 2ZCRA 4KQSA 4EA2A 5EROA 4LTVA 5IKHA 1V4IA 3KRFA 4RXEA 3ACWA 3ADZA 4HD1A 1YYUA 1UBYA 4LIXA 5DIQF 5CG5A 5IVGA 4KFAA 3VJDA 1V4HA 3KROB 3APZA 3LSNA 5HN7A 3N45F 1WL2A 4MC0A 4ZQ8A 5CG6A 4EA0A 3M00A 2AZKA 3LDWA 3ASXA 3ICKA 5IL3A 3S9VA 1ZW5A 3M0GA 2FTZA 3OABA 5DJPF 2OGDA 4E9UA 2F94F 3WCCA 4LZ0A 1JFGA 1WY0A 3KRAA 4DEMF 1HXAA 2Q9YA 3CKEA 1WL1A 4LXWA 3TFNA 3NRIA 4NFJF 3WCFA 4JXNA 5E8KA 3TFPA 2PS5A 5ILZA 4N9UA 2E8WA 4KWDA 4KK2A 1RQIA 3KRCA 3CC9A 4EA1A 1YHMA 3V66A 3RYWA 2ONGA 3SDTA 3LGZB 2J5CA 1N23A 1N1ZA 2OPNA 1WKZA 4DI5A 3RMGA 3ZMCA 5ER8A 4GAXA 2ZY1A 4F6VA 4F62A 4LFEA 5JA0F 2PS6A 5IN8A 3WCIA 3LG5A 2AELA 2PS8A 4KVWA 4QXSF 2Z7IA 3N5HF 3OYRA 4LPGF 3WCHA 5JV2F 2P1CA 3WCMA 3WC9A 2ZCSA 5KSXF 3AQBB 4FJQA 5DGSF 4KQ5A 3OACB 2AZJA 4LUUA 3TFVA 3Q2QA 2E90A 1N21A 4KPJA 5AYPA 5AHUB 1RQJA 3P5RA 3WCEA 4Q23A 5DGMF 4FP4A 3W7FA 2E8VA 3WSAA 4L2XF 2Q58A 3DYFA 3ZL6A 5EAUA 2H8OA 5IMIA 4KQUA 5B0MA 3ZMBA 2F89F 3SDRA 1YYQA 2J1OA 3WCLA 3Q1OA 3DYGA 3V1XA 3CP6A 1HM4A 1N20A 1YHKA 3P8RA 2E8XA 3MZVA 4H5CF 1VG3A 5IMPA 4P0XA 5B01A 3RYEA 3LGKA 3P5PA 3ZOUA 1YYRA 2Z4WA 1N1BA 4NUAA 2F7MF 1KIZA 2VF6A 1EZFA 2O1OA 3KBKA 2F9KF 2PS4A 3WCGA 4DWGA 3LZ9A 4LA6A 5DW7A 5ILIA 3Q2ZA 5IK6A 2FORA 3RBMA 2Q80A 3WJNA 4GA3A 3KRPB 2E93A 3WEHA 1FPSA 4RXDA 4NKFA 4DWBA 5A0IA 2ZCQA 5B0LA 1YYSA 2DH4A 1VG4A 3AQ0A 5EASA 4KVYA 4PVYF 4XQTF 4LA5A 2E92A 5A0JA 5B03A 1WMWA 4MC8A 4P0WA 3N49F 4OGUA 1YHLA 1WL3A 5EATA 3WEGA 3LVSA 3KRFB 2AZLA 2E8TA 1KIYA 4JZBA 1YV5A 2Z4YA 3WJOA 5AFXA 1N24A 2I19A 4JZXA 4PVXF 2F92F 2J1PA 3PDEA 5DJVF 3BNXA 3LOMA 4NFIF 3OACA 4JVJF 2ZCOA 2AETA 3DYHA 3SDQA 3KRAB 5B02A 1VG2A 3N3LF 3ICZA 4GP2A 4E9ZA 3ZCDA 2ZEUA 1YQ7A 3N0FA 3ID0A 4LTZA 3KRCB 3PH7A 5DZ2A 3TS7A 3WCDA 3BNYA 1JFAA 3EZ3A 4OKMA 5IK9A 3S4JA 4DZWA 3WEFA 1PS1A 5IL8A 4K10A 3N1WF 3WE9A 2RAHA 3VJCA 4RXCA 4RNQA 4P0VA 3ACXA 4KKMA 3P41A 3VJEA 4DHDA 5A0KA 1WL0A 3WCBA 3VJ8A 2Z7HA 3VJBA 3KROA 2Q9ZA 5HN8A 2E8UA 5IKAA 3M02A 2F8ZF 3EFQA 4LZCA 3KRPA 5DJRF 5B00A 1V4JA 4NFKF 3PYAA 3SAEA 4LZ3A 3Q30A 2OPMA 3N46F 5E8LA 1DI1A 3WSBA 1V4KA 3B7LA 3N1VF 4QPFA 1VG7A 3P8LA 3QQVA 3WEKA 3ICMA 4LPHF 4OMHA 3N0GA 2E94A 3LLWA 3WEIA 4RXAA 3NPKA 3LJIA 3M9UA 4H5DF 4NG6A 5B0JA 3N5JF 5DHIA 4H5EF 1RTRA 5B0KA 5HN9A 3QKCA 3SDVA 5ILKA 5JV0F 1DGPA 3AQCB 4LFGA 4JXYA 3EGTA 3SDUA 2Z4ZA 3PYBA 4XQRF 4LOBA 3MAVA 3NF2A 5H9DA 3M01A 3AE0A 4RYPA 4LFVF 3WEJA 1YYTA 3ICNA 1HXGA 4MC3A 3NPRA 5ERMA 2E91A 3IBAA 4NKEA 3OABB 1N22A 2Z4VA 3N6KF 1VG6A 1YJ4A 1UBWA 5IK0A 5C05A 1HX9A 2EWGA 4WK5A 5JV1F 4LLTA 4F6XA 5JUZF 4XQSF 3VJ9A 3WCJA 4KUXA 4OKZA 4UMJA 3PKOA 1UBVA 2Z50A 2F8CF 5I1UA 5E8HA 2QISA 4DXJA 2Z4XA 5ERNA 3N3DA 4N1ZF 3ACYA 5HNAA 5ILDA 5AELA 3VJAA 4OMGA 5B0IA 3WJKA 2E4OA 3LMDA 2Z52A 3G4DA 3LEEA 5ILYA 5IMNA 3UCAA 5IM1A 3LK5A 1V4EA 4GP1A 3V1VA 4KVIA 4E1EA 4KPDA
chains in the Genus database with same CATH topology
4KVDA 2ONHA 2E95A 3G4FA 3TC1A 3WCAA 2OA6A 5DHKA 2Z78A 4JYXA 1HXCA 5ILJA 3IPIA 3KB9A 4LLSA 5ILHA 5DGNF 1UBXA 2AEKA 2ZEVA 2PS7A 1HM7A 2ZCRA 4KQSA 4EA2A 5EROA 4LTVA 5IKHA 1V4IA 3KRFA 4RXEA 3ACWA 3ADZA 4HD1A 1YYUA 1UBYA 4LIXA 5DIQF 5CG5A 5IVGA 4KFAA 3VJDA 1V4HA 3KROB 3APZA 3LSNA 5HN7A 3N45F 1WL2A 4MC0A 4ZQ8A 5CG6A 4EA0A 3M00A 2AZKA 3LDWA 3ASXA 3ICKA 5IL3A 3S9VA 1ZW5A 3M0GA 2FTZA 3OABA 5DJPF 2OGDA 4E9UA 2F94F 3WCCA 4LZ0A 1JFGA 1WY0A 3KRAA 4DEMF 1HXAA 2Q9YA 3CKEA 1WL1A 4LXWA 3TFNA 3NRIA 4NFJF 3WCFA 4JXNA 5E8KA 3TFPA 2PS5A 5ILZA 4N9UA 2E8WA 4KWDA 4KK2A 1RQIA 3KRCA 3CC9A 4EA1A 1YHMA 3V66A 3RYWA 2ONGA 3SDTA 3LGZB 2J5CA 1N23A 1N1ZA 2OPNA 1WKZA 4DI5A 3RMGA 3ZMCA 5ER8A 4GAXA 2ZY1A 4F6VA 4F62A 4LFEA 5JA0F 2PS6A 5IN8A 3WCIA 3LG5A 2AELA 2PS8A 4KVWA 4QXSF 2Z7IA 3N5HF 3OYRA 4LPGF 3WCHA 5JV2F 2P1CA 3WCMA 3WC9A 2ZCSA 5KSXF 3AQBB 4FJQA 5DGSF 4KQ5A 3OACB 2AZJA 4LUUA 3TFVA 3Q2QA 2E90A 1N21A 4KPJA 5AYPA 5AHUB 1RQJA 3P5RA 3WCEA 4Q23A 5DGMF 4FP4A 3W7FA 2E8VA 3WSAA 4L2XF 2Q58A 3DYFA 3ZL6A 5EAUA 2H8OA 5IMIA 4KQUA 5B0MA 3ZMBA 2F89F 3SDRA 1YYQA 2J1OA 3WCLA 3Q1OA 3DYGA 3V1XA 3CP6A 1HM4A 1N20A 1YHKA 3P8RA 2E8XA 3MZVA 4H5CF 1VG3A 5IMPA 4P0XA 5B01A 3RYEA 3LGKA 3P5PA 3ZOUA 1YYRA 2Z4WA 1N1BA 4NUAA 2F7MF 1KIZA 2VF6A 1EZFA 2O1OA 3KBKA 2F9KF 2PS4A 3WCGA 4DWGA 3LZ9A 4LA6A 5DW7A 5ILIA 3Q2ZA 5IK6A 2FORA 3RBMA 2Q80A 3WJNA 4GA3A 3KRPB 2E93A 3WEHA 1FPSA 4RXDA 4NKFA 4DWBA 5A0IA 2ZCQA 5B0LA 1YYSA 2DH4A 1VG4A 3AQ0A 5EASA 4KVYA 4PVYF 4XQTF 4LA5A 2E92A 5A0JA 5B03A 1WMWA 4MC8A 4P0WA 3N49F 4OGUA 1YHLA 1WL3A 5EATA 3WEGA 3LVSA 3KRFB 2AZLA 2E8TA 1KIYA 4JZBA 1YV5A 2Z4YA 3WJOA 5AFXA 1N24A 2I19A 4JZXA 4PVXF 2F92F 2J1PA 3PDEA 5DJVF 3BNXA 3LOMA 4NFIF 3OACA 4JVJF 2ZCOA 2AETA 3DYHA 3SDQA 3KRAB 5B02A 1VG2A 3N3LF 3ICZA 4GP2A 4E9ZA 3ZCDA 2ZEUA 1YQ7A 3N0FA 3ID0A 4LTZA 3KRCB 3PH7A 5DZ2A 3TS7A 3WCDA 3BNYA 1JFAA 3EZ3A 4OKMA 5IK9A 3S4JA 4DZWA 3WEFA 1PS1A 5IL8A 4K10A 3N1WF 3WE9A 2RAHA 3VJCA 4RXCA 4RNQA 4P0VA 3ACXA 4KKMA 3P41A 3VJEA 4DHDA 5A0KA 1WL0A 3WCBA 3VJ8A 2Z7HA 3VJBA 3KROA 2Q9ZA 5HN8A 2E8UA 5IKAA 3M02A 2F8ZF 3EFQA 4LZCA 3KRPA 5DJRF 5B00A 1V4JA 4NFKF 3PYAA 3SAEA 4LZ3A 3Q30A 2OPMA 3N46F 5E8LA 1DI1A 3WSBA 1V4KA 3B7LA 3N1VF 4QPFA 1VG7A 3P8LA 3QQVA 3WEKA 3ICMA 4LPHF 4OMHA 3N0GA 2E94A 3LLWA 3WEIA 4RXAA 3NPKA 3LJIA 3M9UA 4H5DF 4NG6A 5B0JA 3N5JF 5DHIA 4H5EF 1RTRA 5B0KA 5HN9A 3QKCA 3SDVA 5ILKA 5JV0F 1DGPA 3AQCB 4LFGA 4JXYA 3EGTA 3SDUA 2Z4ZA 3PYBA 4XQRF 4LOBA 3MAVA 3NF2A 5H9DA 3M01A 3AE0A 4RYPA 4LFVF 3WEJA 1YYTA 3ICNA 1HXGA 4MC3A 3NPRA 5ERMA 2E91A 3IBAA 4NKEA 3OABB 1N22A 2Z4VA 3N6KF 1VG6A 1YJ4A 1UBWA 5IK0A 5C05A 1HX9A 2EWGA 4WK5A 5JV1F 4LLTA 4F6XA 5JUZF 4XQSF 3VJ9A 3WCJA 4KUXA 4OKZA 4UMJA 3PKOA 1UBVA 2Z50A 2F8CF 5I1UA 5E8HA 2QISA 4DXJA 2Z4XA 5ERNA 3N3DA 4N1ZF 3ACYA 5HNAA 5ILDA 5AELA 3VJAA 4OMGA 5B0IA 3WJKA 2E4OA 3LMDA 2Z52A 3G4DA 3LEEA 5ILYA 5IMNA 3UCAA 5IM1A 3LK5A 1V4EA 4GP1A 3V1VA 4KVIA 4E1EA 4KPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KVD A;  2ONH A;  2E95 A;  3G4F A;  3TC1 A;  3WCA A;  2OA6 A;  5DHK A;  2Z78 A;  4JYX A;  1HXC A;  5ILJ A;  3IPI A;  3KB9 A;  4LLS A;  5ILH A;  5DGN F;  1UBX A;  2AEK A;  2ZEV A;  2PS7 A;  1HM7 A;  2ZCR A;  4KQS A;  4EA2 A;  5ERO A;  4LTV A;  5IKH A;  1V4I A;  3KRF A;  4RXE A;  3ACW A;  3ADZ A;  4HD1 A;  1YYU A;  1UBY A;  4LIX A;  5DIQ F;  5CG5 A;  5IVG A;  4KFA A;  3VJD A;  1V4H A;  3KRO B;  3APZ A;  3LSN A;  5HN7 A;  3N45 F;  1WL2 A;  4MC0 A;  4ZQ8 A;  5CG6 A;  4EA0 A;  3M00 A;  2AZK A;  3LDW A;  3ASX A;  3ICK A;  5IL3 A;  3S9V A;  1ZW5 A;  3M0G A;  2FTZ A;  3OAB A;  5DJP F;  2OGD A;  4E9U A;  2F94 F;  3WCC A;  4LZ0 A;  1JFG A;  1WY0 A;  3KRA A;  4DEM F;  1HXA A;  2Q9Y A;  3CKE A;  1WL1 A;  4LXW A;  3TFN A;  3NRI A;  4NFJ F;  3WCF A;  4JXN A;  5E8K A;  3TFP A;  2PS5 A;  5ILZ A;  4N9U A;  2E8W A;  4KWD A;  4KK2 A;  1RQI A;  3KRC A;  3CC9 A;  4EA1 A;  1YHM A;  3V66 A;  3RYW A;  2ONG A;  3SDT A;  3LGZ B;  2J5C A;  1N23 A;  1N1Z A;  2OPN A;  1WKZ A;  4DI5 A;  3RMG A;  3ZMC A;  5ER8 A;  4GAX A;  2ZY1 A;  4F6V A;  4F62 A;  4LFE A;  5JA0 F;  2PS6 A;  5IN8 A;  3WCI A;  3LG5 A;  2AEL A;  2PS8 A;  4KVW A;  4QXS F;  2Z7I A;  3N5H F;  3OYR A;  4LPG F;  3WCH A;  5JV2 F;  2P1C A;  3WCM A;  3WC9 A;  2ZCS A;  5KSX F;  3AQB B;  4FJQ A;  5DGS F;  4KQ5 A;  3OAC B;  2AZJ A;  4LUU A;  3TFV A;  3Q2Q A;  2E90 A;  1N21 A;  4KPJ A;  5AYP A;  5AHU B;  1RQJ A;  3P5R A;  3WCE A;  4Q23 A;  5DGM F;  4FP4 A;  3W7F A;  2E8V A;  3WSA A;  4L2X F;  2Q58 A;  3DYF A;  3ZL6 A;  5EAU A;  2H8O A;  5IMI A;  4KQU A;  5B0M A;  3ZMB A;  2F89 F;  3SDR A;  1YYQ A;  2J1O A;  3WCL A;  3Q1O A;  3DYG A;  3V1X A;  3CP6 A;  1HM4 A;  1N20 A;  1YHK A;  3P8R A;  2E8X A;  3MZV A;  4H5C F;  1VG3 A;  5IMP A;  4P0X A;  5B01 A;  3RYE A;  3LGK A;  3P5P A;  3ZOU A;  1YYR A;  2Z4W A;  1N1B A;  4NUA A;  2F7M F;  1KIZ A;  2VF6 A;  1EZF A;  2O1O A;  3KBK A;  2F9K F;  2PS4 A;  3WCG A;  4DWG A;  3LZ9 A;  4LA6 A;  5DW7 A;  5ILI A;  3Q2Z A;  5IK6 A;  2FOR A;  3RBM A;  2Q80 A;  3WJN A;  4GA3 A;  3KRP B;  2E93 A;  3WEH A;  1FPS A;  4RXD A;  4NKF A;  4DWB A;  5A0I A;  2ZCQ A;  5B0L A;  1YYS A;  2DH4 A;  1VG4 A;  3AQ0 A;  5EAS A;  4KVY A;  4PVY F;  4XQT F;  4LA5 A;  2E92 A;  5A0J A;  5B03 A;  1WMW A;  4MC8 A;  4P0W A;  3N49 F;  4OGU A;  1YHL A;  1WL3 A;  5EAT A;  3WEG A;  3LVS A;  3KRF B;  2AZL A;  2E8T A;  1KIY A;  4JZB A;  1YV5 A;  2Z4Y A;  3WJO A;  5AFX A;  1N24 A;  2I19 A;  4JZX A;  4PVX F;  2F92 F;  2J1P A;  3PDE A;  5DJV F;  3BNX A;  3LOM A;  4NFI F;  3OAC A;  4JVJ F;  2ZCO A;  2AET A;  3DYH A;  3SDQ A;  3KRA B;  5B02 A;  1VG2 A;  3N3L F;  3ICZ A;  4GP2 A;  4E9Z A;  3ZCD A;  2ZEU A;  1YQ7 A;  3N0F A;  3ID0 A;  4LTZ A;  3KRC B;  3PH7 A;  5DZ2 A;  3TS7 A;  3WCD A;  3BNY A;  1JFA A;  3EZ3 A;  4OKM A;  5IK9 A;  3S4J A;  4DZW A;  3WEF A;  1PS1 A;  5IL8 A;  4K10 A;  3N1W F;  3WE9 A;  2RAH A;  3VJC A;  4RXC A;  4RNQ A;  4P0V A;  3ACX A;  4KKM A;  3P41 A;  3VJE A;  4DHD A;  5A0K A;  1WL0 A;  3WCB A;  3VJ8 A;  2Z7H A;  3VJB A;  3KRO A;  2Q9Z A;  5HN8 A;  2E8U A;  5IKA A;  3M02 A;  2F8Z F;  3EFQ A;  4LZC A;  3KRP A;  5DJR F;  5B00 A;  1V4J A;  4NFK F;  3PYA A;  3SAE A;  4LZ3 A;  3Q30 A;  2OPM A;  3N46 F;  5E8L A;  1DI1 A;  3WSB A;  1V4K A;  3B7L A;  3N1V F;  4QPF A;  1VG7 A;  3P8L A;  3QQV A;  3WEK A;  3ICM A;  4LPH F;  4OMH A;  3N0G A;  2E94 A;  3LLW A;  3WEI A;  4RXA A;  3NPK A;  3LJI A;  3M9U A;  4H5D F;  4NG6 A;  5B0J A;  3N5J F;  5DHI A;  4H5E F;  1RTR A;  5B0K A;  5HN9 A;  3QKC A;  3SDV A;  5ILK A;  5JV0 F;  1DGP A;  3AQC B;  4LFG A;  4JXY A;  3EGT A;  3SDU A;  2Z4Z A;  3PYB A;  4XQR F;  4LOB A;  3MAV A;  3NF2 A;  5H9D A;  3M01 A;  3AE0 A;  4RYP A;  4LFV F;  3WEJ A;  1YYT A;  3ICN A;  1HXG A;  4MC3 A;  3NPR A;  5ERM A;  2E91 A;  3IBA A;  4NKE A;  3OAB B;  1N22 A;  2Z4V A;  3N6K F;  1VG6 A;  1YJ4 A;  1UBW A;  5IK0 A;  5C05 A;  1HX9 A;  2EWG A;  4WK5 A;  5JV1 F;  4LLT A;  4F6X A;  5JUZ F;  4XQS F;  3VJ9 A;  3WCJ A;  4KUX A;  4OKZ A;  4UMJ A;  3PKO A;  1UBV A;  2Z50 A;  2F8C F;  5I1U A;  5E8H A;  2QIS A;  4DXJ A;  2Z4X A;  5ERN A;  3N3D A;  4N1Z F;  3ACY A;  5HNA A;  5ILD A;  5AEL A;  3VJA A;  4OMG A;  5B0I A;  3WJK A;  2E4O A;  3LMD A;  2Z52 A;  3G4D A;  3LEE A;  5ILY A;  5IMN A;  3UCA A;  5IM1 A;  3LK5 A;  1V4E A;  4GP1 A;  3V1V A;  4KVI A;  4E1E A;  4KPD A; 
#chains in the Genus database with same CATH topology
 4KVD A;  2ONH A;  2E95 A;  3G4F A;  3TC1 A;  3WCA A;  2OA6 A;  5DHK A;  2Z78 A;  4JYX A;  1HXC A;  5ILJ A;  3IPI A;  3KB9 A;  4LLS A;  5ILH A;  5DGN F;  1UBX A;  2AEK A;  2ZEV A;  2PS7 A;  1HM7 A;  2ZCR A;  4KQS A;  4EA2 A;  5ERO A;  4LTV A;  5IKH A;  1V4I A;  3KRF A;  4RXE A;  3ACW A;  3ADZ A;  4HD1 A;  1YYU A;  1UBY A;  4LIX A;  5DIQ F;  5CG5 A;  5IVG A;  4KFA A;  3VJD A;  1V4H A;  3KRO B;  3APZ A;  3LSN A;  5HN7 A;  3N45 F;  1WL2 A;  4MC0 A;  4ZQ8 A;  5CG6 A;  4EA0 A;  3M00 A;  2AZK A;  3LDW A;  3ASX A;  3ICK A;  5IL3 A;  3S9V A;  1ZW5 A;  3M0G A;  2FTZ A;  3OAB A;  5DJP F;  2OGD A;  4E9U A;  2F94 F;  3WCC A;  4LZ0 A;  1JFG A;  1WY0 A;  3KRA A;  4DEM F;  1HXA A;  2Q9Y A;  3CKE A;  1WL1 A;  4LXW A;  3TFN A;  3NRI A;  4NFJ F;  3WCF A;  4JXN A;  5E8K A;  3TFP A;  2PS5 A;  5ILZ A;  4N9U A;  2E8W A;  4KWD A;  4KK2 A;  1RQI A;  3KRC A;  3CC9 A;  4EA1 A;  1YHM A;  3V66 A;  3RYW A;  2ONG A;  3SDT A;  3LGZ B;  2J5C A;  1N23 A;  1N1Z A;  2OPN A;  1WKZ A;  4DI5 A;  3RMG A;  3ZMC A;  5ER8 A;  4GAX A;  2ZY1 A;  4F6V A;  4F62 A;  4LFE A;  5JA0 F;  2PS6 A;  5IN8 A;  3WCI A;  3LG5 A;  2AEL A;  2PS8 A;  4KVW A;  4QXS F;  2Z7I A;  3N5H F;  3OYR A;  4LPG F;  3WCH A;  5JV2 F;  2P1C A;  3WCM A;  3WC9 A;  2ZCS A;  5KSX F;  3AQB B;  4FJQ A;  5DGS F;  4KQ5 A;  3OAC B;  2AZJ A;  4LUU A;  3TFV A;  3Q2Q A;  2E90 A;  1N21 A;  4KPJ A;  5AYP A;  5AHU B;  1RQJ A;  3P5R A;  3WCE A;  4Q23 A;  5DGM F;  4FP4 A;  3W7F A;  2E8V A;  3WSA A;  4L2X F;  2Q58 A;  3DYF A;  3ZL6 A;  5EAU A;  2H8O A;  5IMI A;  4KQU A;  5B0M A;  3ZMB A;  2F89 F;  3SDR A;  1YYQ A;  2J1O A;  3WCL A;  3Q1O A;  3DYG A;  3V1X A;  3CP6 A;  1HM4 A;  1N20 A;  1YHK A;  3P8R A;  2E8X A;  3MZV A;  4H5C F;  1VG3 A;  5IMP A;  4P0X A;  5B01 A;  3RYE A;  3LGK A;  3P5P A;  3ZOU A;  1YYR A;  2Z4W A;  1N1B A;  4NUA A;  2F7M F;  1KIZ A;  2VF6 A;  1EZF A;  2O1O A;  3KBK A;  2F9K F;  2PS4 A;  3WCG A;  4DWG A;  3LZ9 A;  4LA6 A;  5DW7 A;  5ILI A;  3Q2Z A;  5IK6 A;  2FOR A;  3RBM A;  2Q80 A;  3WJN A;  4GA3 A;  3KRP B;  2E93 A;  3WEH A;  1FPS A;  4RXD A;  4NKF A;  4DWB A;  5A0I A;  2ZCQ A;  5B0L A;  1YYS A;  2DH4 A;  1VG4 A;  3AQ0 A;  5EAS A;  4KVY A;  4PVY F;  4XQT F;  4LA5 A;  2E92 A;  5A0J A;  5B03 A;  1WMW A;  4MC8 A;  4P0W A;  3N49 F;  4OGU A;  1YHL A;  1WL3 A;  5EAT A;  3WEG A;  3LVS A;  3KRF B;  2AZL A;  2E8T A;  1KIY A;  4JZB A;  1YV5 A;  2Z4Y A;  3WJO A;  5AFX A;  1N24 A;  2I19 A;  4JZX A;  4PVX F;  2F92 F;  2J1P A;  3PDE A;  5DJV F;  3BNX A;  3LOM A;  4NFI F;  3OAC A;  4JVJ F;  2ZCO A;  2AET A;  3DYH A;  3SDQ A;  3KRA B;  5B02 A;  1VG2 A;  3N3L F;  3ICZ A;  4GP2 A;  4E9Z A;  3ZCD A;  2ZEU A;  1YQ7 A;  3N0F A;  3ID0 A;  4LTZ A;  3KRC B;  3PH7 A;  5DZ2 A;  3TS7 A;  3WCD A;  3BNY A;  1JFA A;  3EZ3 A;  4OKM A;  5IK9 A;  3S4J A;  4DZW A;  3WEF A;  1PS1 A;  5IL8 A;  4K10 A;  3N1W F;  3WE9 A;  2RAH A;  3VJC A;  4RXC A;  4RNQ A;  4P0V A;  3ACX A;  4KKM A;  3P41 A;  3VJE A;  4DHD A;  5A0K A;  1WL0 A;  3WCB A;  3VJ8 A;  2Z7H A;  3VJB A;  3KRO A;  2Q9Z A;  5HN8 A;  2E8U A;  5IKA A;  3M02 A;  2F8Z F;  3EFQ A;  4LZC A;  3KRP A;  5DJR F;  5B00 A;  1V4J A;  4NFK F;  3PYA A;  3SAE A;  4LZ3 A;  3Q30 A;  2OPM A;  3N46 F;  5E8L A;  1DI1 A;  3WSB A;  1V4K A;  3B7L A;  3N1V F;  4QPF A;  1VG7 A;  3P8L A;  3QQV A;  3WEK A;  3ICM A;  4LPH F;  4OMH A;  3N0G A;  2E94 A;  3LLW A;  3WEI A;  4RXA A;  3NPK A;  3LJI A;  3M9U A;  4H5D F;  4NG6 A;  5B0J A;  3N5J F;  5DHI A;  4H5E F;  1RTR A;  5B0K A;  5HN9 A;  3QKC A;  3SDV A;  5ILK A;  5JV0 F;  1DGP A;  3AQC B;  4LFG A;  4JXY A;  3EGT A;  3SDU A;  2Z4Z A;  3PYB A;  4XQR F;  4LOB A;  3MAV A;  3NF2 A;  5H9D A;  3M01 A;  3AE0 A;  4RYP A;  4LFV F;  3WEJ A;  1YYT A;  3ICN A;  1HXG A;  4MC3 A;  3NPR A;  5ERM A;  2E91 A;  3IBA A;  4NKE A;  3OAB B;  1N22 A;  2Z4V A;  3N6K F;  1VG6 A;  1YJ4 A;  1UBW A;  5IK0 A;  5C05 A;  1HX9 A;  2EWG A;  4WK5 A;  5JV1 F;  4LLT A;  4F6X A;  5JUZ F;  4XQS F;  3VJ9 A;  3WCJ A;  4KUX A;  4OKZ A;  4UMJ A;  3PKO A;  1UBV A;  2Z50 A;  2F8C F;  5I1U A;  5E8H A;  2QIS A;  4DXJ A;  2Z4X A;  5ERN A;  3N3D A;  4N1Z F;  3ACY A;  5HNA A;  5ILD A;  5AEL A;  3VJA A;  4OMG A;  5B0I A;  3WJK A;  2E4O A;  3LMD A;  2Z52 A;  3G4D A;  3LEE A;  5ILY A;  5IMN A;  3UCA A;  5IM1 A;  3LK5 A;  1V4E A;  4GP1 A;  3V1V A;  4KVI A;  4E1E A;  4KPD A; 
#chains in the Genus database with same CATH homology
 4KVD A;  2ONH A;  2E95 A;  3G4F A;  3TC1 A;  3WCA A;  2OA6 A;  5DHK A;  2Z78 A;  4JYX A;  1HXC A;  5ILJ A;  3IPI A;  3KB9 A;  4LLS A;  5ILH A;  5DGN F;  1UBX A;  2AEK A;  2ZEV A;  2PS7 A;  1HM7 A;  2ZCR A;  4KQS A;  4EA2 A;  5ERO A;  4LTV A;  5IKH A;  1V4I A;  3KRF A;  4RXE A;  3ACW A;  3ADZ A;  4HD1 A;  1YYU A;  1UBY A;  4LIX A;  5DIQ F;  5CG5 A;  5IVG A;  4KFA A;  3VJD A;  1V4H A;  3KRO B;  3APZ A;  3LSN A;  5HN7 A;  3N45 F;  1WL2 A;  4MC0 A;  4ZQ8 A;  5CG6 A;  4EA0 A;  3M00 A;  2AZK A;  3LDW A;  3ASX A;  3ICK A;  5IL3 A;  3S9V A;  1ZW5 A;  3M0G A;  2FTZ A;  3OAB A;  5DJP F;  2OGD A;  4E9U A;  2F94 F;  3WCC A;  4LZ0 A;  1JFG A;  1WY0 A;  3KRA A;  4DEM F;  1HXA A;  2Q9Y A;  3CKE A;  1WL1 A;  4LXW A;  3TFN A;  3NRI A;  4NFJ F;  3WCF A;  4JXN A;  5E8K A;  3TFP A;  2PS5 A;  5ILZ A;  4N9U A;  2E8W A;  4KWD A;  4KK2 A;  1RQI A;  3KRC A;  3CC9 A;  4EA1 A;  1YHM A;  3V66 A;  3RYW A;  2ONG A;  3SDT A;  3LGZ B;  2J5C A;  1N23 A;  1N1Z A;  2OPN A;  1WKZ A;  4DI5 A;  3RMG A;  3ZMC A;  5ER8 A;  4GAX A;  2ZY1 A;  4F6V A;  4F62 A;  4LFE A;  5JA0 F;  2PS6 A;  5IN8 A;  3WCI A;  3LG5 A;  2AEL A;  2PS8 A;  4KVW A;  4QXS F;  2Z7I A;  3N5H F;  3OYR A;  4LPG F;  3WCH A;  5JV2 F;  2P1C A;  3WCM A;  3WC9 A;  2ZCS A;  5KSX F;  3AQB B;  4FJQ A;  5DGS F;  4KQ5 A;  3OAC B;  2AZJ A;  4LUU A;  3TFV A;  3Q2Q A;  2E90 A;  1N21 A;  4KPJ A;  5AYP A;  5AHU B;  1RQJ A;  3P5R A;  3WCE A;  4Q23 A;  5DGM F;  4FP4 A;  3W7F A;  2E8V A;  3WSA A;  4L2X F;  2Q58 A;  3DYF A;  3ZL6 A;  5EAU A;  2H8O A;  5IMI A;  4KQU A;  5B0M A;  3ZMB A;  2F89 F;  3SDR A;  1YYQ A;  2J1O A;  3WCL A;  3Q1O A;  3DYG A;  3V1X A;  3CP6 A;  1HM4 A;  1N20 A;  1YHK A;  3P8R A;  2E8X A;  3MZV A;  4H5C F;  1VG3 A;  5IMP A;  4P0X A;  5B01 A;  3RYE A;  3LGK A;  3P5P A;  3ZOU A;  1YYR A;  2Z4W A;  1N1B A;  4NUA A;  2F7M F;  1KIZ A;  2VF6 A;  1EZF A;  2O1O A;  3KBK A;  2F9K F;  2PS4 A;  3WCG A;  4DWG A;  3LZ9 A;  4LA6 A;  5DW7 A;  5ILI A;  3Q2Z A;  5IK6 A;  2FOR A;  3RBM A;  2Q80 A;  3WJN A;  4GA3 A;  3KRP B;  2E93 A;  3WEH A;  1FPS A;  4RXD A;  4NKF A;  4DWB A;  5A0I A;  2ZCQ A;  5B0L A;  1YYS A;  2DH4 A;  1VG4 A;  3AQ0 A;  5EAS A;  4KVY A;  4PVY F;  4XQT F;  4LA5 A;  2E92 A;  5A0J A;  5B03 A;  1WMW A;  4MC8 A;  4P0W A;  3N49 F;  4OGU A;  1YHL A;  1WL3 A;  5EAT A;  3WEG A;  3LVS A;  3KRF B;  2AZL A;  2E8T A;  1KIY A;  4JZB A;  1YV5 A;  2Z4Y A;  3WJO A;  5AFX A;  1N24 A;  2I19 A;  4JZX A;  4PVX F;  2F92 F;  2J1P A;  3PDE A;  5DJV F;  3BNX A;  3LOM A;  4NFI F;  3OAC A;  4JVJ F;  2ZCO A;  2AET A;  3DYH A;  3SDQ A;  3KRA B;  5B02 A;  1VG2 A;  3N3L F;  3ICZ A;  4GP2 A;  4E9Z A;  3ZCD A;  2ZEU A;  1YQ7 A;  3N0F A;  3ID0 A;  4LTZ A;  3KRC B;  3PH7 A;  5DZ2 A;  3TS7 A;  3WCD A;  3BNY A;  1JFA A;  3EZ3 A;  4OKM A;  5IK9 A;  3S4J A;  4DZW A;  3WEF A;  1PS1 A;  5IL8 A;  4K10 A;  3N1W F;  3WE9 A;  2RAH A;  3VJC A;  4RXC A;  4RNQ A;  4P0V A;  3ACX A;  4KKM A;  3P41 A;  3VJE A;  4DHD A;  5A0K A;  1WL0 A;  3WCB A;  3VJ8 A;  2Z7H A;  3VJB A;  3KRO A;  2Q9Z A;  5HN8 A;  2E8U A;  5IKA A;  3M02 A;  2F8Z F;  3EFQ A;  4LZC A;  3KRP A;  5DJR F;  5B00 A;  1V4J A;  4NFK F;  3PYA A;  3SAE A;  4LZ3 A;  3Q30 A;  2OPM A;  3N46 F;  5E8L A;  1DI1 A;  3WSB A;  1V4K A;  3B7L A;  3N1V F;  4QPF A;  1VG7 A;  3P8L A;  3QQV A;  3WEK A;  3ICM A;  4LPH F;  4OMH A;  3N0G A;  2E94 A;  3LLW A;  3WEI A;  4RXA A;  3NPK A;  3LJI A;  3M9U A;  4H5D F;  4NG6 A;  5B0J A;  3N5J F;  5DHI A;  4H5E F;  1RTR A;  5B0K A;  5HN9 A;  3QKC A;  3SDV A;  5ILK A;  5JV0 F;  1DGP A;  3AQC B;  4LFG A;  4JXY A;  3EGT A;  3SDU A;  2Z4Z A;  3PYB A;  4XQR F;  4LOB A;  3MAV A;  3NF2 A;  5H9D A;  3M01 A;  3AE0 A;  4RYP A;  4LFV F;  3WEJ A;  1YYT A;  3ICN A;  1HXG A;  4MC3 A;  3NPR A;  5ERM A;  2E91 A;  3IBA A;  4NKE A;  3OAB B;  1N22 A;  2Z4V A;  3N6K F;  1VG6 A;  1YJ4 A;  1UBW A;  5IK0 A;  5C05 A;  1HX9 A;  2EWG A;  4WK5 A;  5JV1 F;  4LLT A;  4F6X A;  5JUZ F;  4XQS F;  3VJ9 A;  3WCJ A;  4KUX A;  4OKZ A;  4UMJ A;  3PKO A;  1UBV A;  2Z50 A;  2F8C F;  5I1U A;  5E8H A;  2QIS A;  4DXJ A;  2Z4X A;  5ERN A;  3N3D A;  4N1Z F;  3ACY A;  5HNA A;  5ILD A;  5AEL A;  3VJA A;  4OMG A;  5B0I A;  3WJK A;  2E4O A;  3LMD A;  2Z52 A;  3G4D A;  3LEE A;  5ILY A;  5IMN A;  3UCA A;  5IM1 A;  3LK5 A;  1V4E A;  4GP1 A;  3V1V A;  4KVI A;  4E1E A;  4KPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...