3N3DA

Crystal structure of geranylgeranyl pyrophosphate synthase from lactobacillus brevis atcc 367
Total Genus 125
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
125
sequence length
322
structure length
322
Chain Sequence
DRQLWRQFPQVEPQLTALQDYLLRTVQLDNQPIHHKILALLKSGGKLLRPGYFYLFSTFGNAATPAQLQAGAAAIEILHVGTLIHDDVIDDSPTRRGVRTIQMTYGQRNAIYAGDFMFTVYFDQVLKSTTDRSLIQNHIDAMHRILQGELHQMDLNYREDITLDAYLNEIAGKTAELFALSCYQGAQLAGAPQSVIDRTRDIGIAIGCAYQMLDDILDYAGDPKRTQKPVLEDLRSGVYSLPLLLSLSHAPRDFHKLLKKKQAMTLEDIKHVQALVAQYDGVGAAKQLAQDYTDRALTLIQQLPVGSAQQSLEQLTRLLLRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl pyrophosphate synthase
publication title Crystal Structure of Geranylgeranyl Pyrophosphate Synthase from Lactobacillus Brevis
rcsb
source organism Lactobacillus brevis
total genus 125
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3n3dA00
2E8XA 1RTRA 3EFQA 1UBXA 5JV0F 5EASA 4KK2A 4LUUA 1N24A 5C05A 3VJBA 5CG5A 1V4IA 3LK5A 2FORA 4L2XF 3TFVA 3ICNA 4P0XA 3QQVA 2PS4A 4GP1A 3OABA 1YYUA 4LPGF 2RAHA 3LGKA 1WKZA 2F7MF 4MC8A 3ACWA 4KVWA 3WEGA 3KRAB 1WY0A 1N22A 4MC0A 1YHMA 1N20A 2Z4WA 5ILYA 5B02A 2AELA 1HXGA 1RQJA 3RMGA 4N1ZF 3ASXA 2PS7A 2E91A 4DHDA 4OMGA 4F6XA 1HM7A 3N3LF 2J5CA 4KQSA 2F8CF 4OGUA 1V4JA 4DWGA 3Q2QA 4KVDA 3EGTA 4QXSF 3KRPB 3RYWA 3AQ0A 2QISA 2OGDA 4NFJF 2VF6A 3P5RA 3M0GA 4LFEA 3ZL6A 3AQCB 3LEEA 1VG7A 3WEFA 2ZEVA 3LGZB 2F8ZF 4LPHF 4JZXA 3ACXA 5DHIA 3MAVA 5B0IA 3WEHA 2EWGA 4KKMA 5ERMA 3NRIA 2Q9YA 3PDEA 5B03A 5IK6A 3V1VA 1N23A 4LLTA 4RXCA 2E95A 2F92F 5A0JA 4MC3A 3P5PA 2Z4ZA 1WL1A 5IL3A 3WE9A 1YYRA 4QPFA 3WCIA 1FPSA 5B0MA 2E93A 4KUXA 3KB9A 3KRAA 5HN9A 2F94F 4XQTF 2E4OA 1YQ7A 3ICKA 5IMIA 3NPKA 3N1WF 1KIZA 3PKOA 3M9UA 5IMNA 4PVYF 5ILKA 2ZCQA 5DJPF 2P1CA 3CKEA 4DWBA 2J1PA 2Z7HA 1YHLA 3LVSA 5IK0A 2DH4A 5IM1A 2Q80A 4LLSA 5IL8A 2AZJA 5DIQF 3KRPA 3G4FA 1WL0A 1WL2A 5HNAA 2ZCSA 3PH7A 4K10A 3SAEA 4Q23A 3VJEA 3ZOUA 4NKEA 4LFVF 3WJOA 3CP6A 5HN8A 4KQ5A 4N9UA 3V1XA 3N3DA 4H5CF 1VG3A 3MZVA 4OMHA 4PVXF 3OYRA 4GAXA 3OACB 1HX9A 4EA1A 2Z4YA 3UCAA 3N1VF 5KSXF 1JFAA 2Z4VA 4KFAA 5JA0F 2J1OA 2PS8A 2I19A 3ADZA 3M02A 2OPMA 2ZCRA 1UBYA 3BNXA 4FP4A 5IN8A 2AZLA 2ONGA 4OKZA 4NUAA 1YYSA 3WCFA 5JV1F 5IK9A 1V4KA 3KBKA 1ZW5A 2Z7IA 2F9KF 5A0IA 1EZFA 4KVIA 4WK5A 3KRFB 3LSNA 5ERNA 3KROB 3WSBA 5EAUA 2Z4XA 3M00A 1HXAA 1YHKA 3WCGA 3PYBA 2PS5A 3WCBA 4GA3A 5B01A 3N0GA 4LFGA 4NKFA 3S9VA 3N45F 5DZ2A 3M01A 3OACA 1N1BA 3PYAA 3ICMA 4F6VA 5ILDA 4FJQA 2E8VA 3CC9A 3VJCA 3Q2ZA 3TFPA 1WL3A 1HM4A 4DEMF 1WMWA 3P41A 3SDUA 2F89F 3DYFA 5ILJA 3NF2A 3LZ9A 5IMPA 3B7LA 3N49F 4DZWA 3EZ3A 3P8LA 3WCDA 3VJ9A 3ID0A 3LLWA 3P8RA 1HXCA 2Z52A 3KRFA 5B0LA 4XQSF 2E8WA 3KROA 1KIYA 3NPRA 4UMJA 1YYTA 1N1ZA 2Z78A 1JFGA 4LZ3A 4RXDA 3SDRA 3ACYA 2AEKA 5CG6A 1DI1A 3ICZA 3DYGA 3N6KF 4HD1A 2ZCOA 3SDQA 4RXEA 1VG4A 5IKHA 2AETA 3ZMCA 3Q30A 4KPDA 3IBAA 1V4HA 5EATA 4LIXA 4LA6A 2ONHA 4E9ZA 2AZKA 3KRCB 1N21A 4H5EF 4ZQ8A 3SDTA 3WSAA 1PS1A 4OKMA 3WCHA 4KQUA 4GP2A 5ILHA 5JUZF 5DW7A 3TC1A 5DGMF 5IKAA 2Q9ZA 2Z50A 3VJAA 3LG5A 3RYEA 5DGNF 3N5JF 3WCAA 5B0KA 4LXWA 1VG2A 3WEJA 4E1EA 1UBWA 3LMDA 2E8UA 3VJ8A 3G4DA 5ER8A 3LJIA 4JZBA 4LZCA 4H5DF 4DXJA 3WC9A 3LOMA 3IPIA 5E8KA 3WJNA 4JXNA 3V66A 1YYQA 3WCLA 4LOBA 5ILZA 3BNYA 3WCMA 2E90A 3WCEA 4KPJA 3N0FA 3SDVA 5DHKA 3KRCA 2FTZA 3AQBB 5E8LA 3TFNA 4DI5A 4EA2A 4JVJF 3AE0A 5I1UA 5DGSF 3WCCA 5E8HA 4LA5A 3N46F 5A0KA 1V4EA 4KWDA 4P0VA 3QKCA 1DGPA 3TS7A 4JXYA 5IVGA 4NG6A 4EA0A 3VJDA 5JV2F 2OA6A 3LDWA 4JYXA 4LTVA 3OABB 2E8TA 5AELA 2PS6A 3RBMA 4E9UA 4RNQA 2O1OA 5DJVF 3N5HF 1YV5A 2ZY1A 4LZ0A 2E92A 3S4JA 3WEIA 2ZEUA 5B0JA 2Q58A 5EROA 4NFIF 5AFXA 5B00A 5AYPA 3WJKA 4XQRF 4RYPA 2OPNA 1RQIA 4RXAA 3Q1OA 3W7FA 1YJ4A 4LTZA 5AHUB 4P0WA 3ZCDA 1UBVA 3WCJA 3WEKA 3APZA 4NFKF 3ZMBA 4KVYA 2H8OA 1VG6A 5ILIA 5DJRF 5H9DA 2E94A 5HN7A 3DYHA 4F62A
chains in the Genus database with same CATH superfamily
2E8XA 1RTRA 3EFQA 1UBXA 5JV0F 5EASA 4KK2A 4LUUA 1N24A 5C05A 3VJBA 5CG5A 1V4IA 3LK5A 2FORA 4L2XF 3TFVA 3ICNA 4P0XA 3QQVA 2PS4A 4GP1A 3OABA 1YYUA 4LPGF 2RAHA 3LGKA 1WKZA 2F7MF 4MC8A 3ACWA 4KVWA 3WEGA 3KRAB 1WY0A 1N22A 4MC0A 1YHMA 1N20A 2Z4WA 5ILYA 5B02A 2AELA 1HXGA 1RQJA 3RMGA 4N1ZF 3ASXA 2PS7A 2E91A 4DHDA 4OMGA 4F6XA 1HM7A 3N3LF 2J5CA 4KQSA 2F8CF 4OGUA 1V4JA 4DWGA 3Q2QA 4KVDA 3EGTA 4QXSF 3KRPB 3RYWA 3AQ0A 2QISA 2OGDA 4NFJF 2VF6A 3P5RA 3M0GA 4LFEA 3ZL6A 3AQCB 3LEEA 1VG7A 3WEFA 2ZEVA 3LGZB 2F8ZF 4LPHF 4JZXA 3ACXA 5DHIA 3MAVA 5B0IA 3WEHA 2EWGA 4KKMA 5ERMA 3NRIA 2Q9YA 3PDEA 5B03A 5IK6A 3V1VA 1N23A 4LLTA 4RXCA 2E95A 2F92F 5A0JA 4MC3A 3P5PA 2Z4ZA 1WL1A 5IL3A 3WE9A 1YYRA 4QPFA 3WCIA 1FPSA 5B0MA 2E93A 4KUXA 3KB9A 3KRAA 5HN9A 2F94F 4XQTF 2E4OA 1YQ7A 3ICKA 5IMIA 3NPKA 3N1WF 1KIZA 3PKOA 3M9UA 5IMNA 4PVYF 5ILKA 2ZCQA 5DJPF 2P1CA 3CKEA 4DWBA 2J1PA 2Z7HA 1YHLA 3LVSA 5IK0A 2DH4A 5IM1A 2Q80A 4LLSA 5IL8A 2AZJA 5DIQF 3KRPA 3G4FA 1WL0A 1WL2A 5HNAA 2ZCSA 3PH7A 4K10A 3SAEA 4Q23A 3VJEA 3ZOUA 4NKEA 4LFVF 3WJOA 3CP6A 5HN8A 4KQ5A 4N9UA 3V1XA 3N3DA 4H5CF 1VG3A 3MZVA 4OMHA 4PVXF 3OYRA 4GAXA 3OACB 1HX9A 4EA1A 2Z4YA 3UCAA 3N1VF 5KSXF 1JFAA 2Z4VA 4KFAA 5JA0F 2J1OA 2PS8A 2I19A 3ADZA 3M02A 2OPMA 2ZCRA 1UBYA 3BNXA 4FP4A 5IN8A 2AZLA 2ONGA 4OKZA 4NUAA 1YYSA 3WCFA 5JV1F 5IK9A 1V4KA 3KBKA 1ZW5A 2Z7IA 2F9KF 5A0IA 1EZFA 4KVIA 4WK5A 3KRFB 3LSNA 5ERNA 3KROB 3WSBA 5EAUA 2Z4XA 3M00A 1HXAA 1YHKA 3WCGA 3PYBA 2PS5A 3WCBA 4GA3A 5B01A 3N0GA 4LFGA 4NKFA 3S9VA 3N45F 5DZ2A 3M01A 3OACA 1N1BA 3PYAA 3ICMA 4F6VA 5ILDA 4FJQA 2E8VA 3CC9A 3VJCA 3Q2ZA 3TFPA 1WL3A 1HM4A 4DEMF 1WMWA 3P41A 3SDUA 2F89F 3DYFA 5ILJA 3NF2A 3LZ9A 5IMPA 3B7LA 3N49F 4DZWA 3EZ3A 3P8LA 3WCDA 3VJ9A 3ID0A 3LLWA 3P8RA 1HXCA 2Z52A 3KRFA 5B0LA 4XQSF 2E8WA 3KROA 1KIYA 3NPRA 4UMJA 1YYTA 1N1ZA 2Z78A 1JFGA 4LZ3A 4RXDA 3SDRA 3ACYA 2AEKA 5CG6A 1DI1A 3ICZA 3DYGA 3N6KF 4HD1A 2ZCOA 3SDQA 4RXEA 1VG4A 5IKHA 2AETA 3ZMCA 3Q30A 4KPDA 3IBAA 1V4HA 5EATA 4LIXA 4LA6A 2ONHA 4E9ZA 2AZKA 3KRCB 1N21A 4H5EF 4ZQ8A 3SDTA 3WSAA 1PS1A 4OKMA 3WCHA 4KQUA 4GP2A 5ILHA 5JUZF 5DW7A 3TC1A 5DGMF 5IKAA 2Q9ZA 2Z50A 3VJAA 3LG5A 3RYEA 5DGNF 3N5JF 3WCAA 5B0KA 4LXWA 1VG2A 3WEJA 4E1EA 1UBWA 3LMDA 2E8UA 3VJ8A 3G4DA 5ER8A 3LJIA 4JZBA 4LZCA 4H5DF 4DXJA 3WC9A 3LOMA 3IPIA 5E8KA 3WJNA 4JXNA 3V66A 1YYQA 3WCLA 4LOBA 5ILZA 3BNYA 3WCMA 2E90A 3WCEA 4KPJA 3N0FA 3SDVA 5DHKA 3KRCA 2FTZA 3AQBB 5E8LA 3TFNA 4DI5A 4EA2A 4JVJF 3AE0A 5I1UA 5DGSF 3WCCA 5E8HA 4LA5A 3N46F 5A0KA 1V4EA 4KWDA 4P0VA 3QKCA 1DGPA 3TS7A 4JXYA 5IVGA 4NG6A 4EA0A 3VJDA 5JV2F 2OA6A 3LDWA 4JYXA 4LTVA 3OABB 2E8TA 5AELA 2PS6A 3RBMA 4E9UA 4RNQA 2O1OA 5DJVF 3N5HF 1YV5A 2ZY1A 4LZ0A 2E92A 3S4JA 3WEIA 2ZEUA 5B0JA 2Q58A 5EROA 4NFIF 5AFXA 5B00A 5AYPA 3WJKA 4XQRF 4RYPA 2OPNA 1RQIA 4RXAA 3Q1OA 3W7FA 1YJ4A 4LTZA 5AHUB 4P0WA 3ZCDA 1UBVA 3WCJA 3WEKA 3APZA 4NFKF 3ZMBA 4KVYA 2H8OA 1VG6A 5ILIA 5DJRF 5H9DA 2E94A 5HN7A 3DYHA 4F62A
chains in the Genus database with same CATH topology
2E8XA 1RTRA 3EFQA 1UBXA 5JV0F 5EASA 4KK2A 4LUUA 1N24A 5C05A 3VJBA 5CG5A 1V4IA 3LK5A 2FORA 4L2XF 3TFVA 3ICNA 4P0XA 3QQVA 2PS4A 4GP1A 3OABA 1YYUA 4LPGF 2RAHA 3LGKA 1WKZA 2F7MF 4MC8A 3ACWA 4KVWA 3WEGA 3KRAB 1WY0A 1N22A 4MC0A 1YHMA 1N20A 2Z4WA 5ILYA 5B02A 2AELA 1HXGA 1RQJA 3RMGA 4N1ZF 3ASXA 2PS7A 2E91A 4DHDA 4OMGA 4F6XA 1HM7A 3N3LF 2J5CA 4KQSA 2F8CF 4OGUA 1V4JA 4DWGA 3Q2QA 4KVDA 3EGTA 4QXSF 3KRPB 3RYWA 3AQ0A 2QISA 2OGDA 4NFJF 2VF6A 3P5RA 3M0GA 4LFEA 3ZL6A 3AQCB 3LEEA 1VG7A 3WEFA 2ZEVA 3LGZB 2F8ZF 4LPHF 4JZXA 3ACXA 5DHIA 3MAVA 5B0IA 3WEHA 2EWGA 4KKMA 5ERMA 3NRIA 2Q9YA 3PDEA 5B03A 5IK6A 3V1VA 1N23A 4LLTA 4RXCA 2E95A 2F92F 5A0JA 4MC3A 3P5PA 2Z4ZA 1WL1A 5IL3A 3WE9A 1YYRA 4QPFA 3WCIA 1FPSA 5B0MA 2E93A 4KUXA 3KB9A 3KRAA 5HN9A 2F94F 4XQTF 2E4OA 1YQ7A 3ICKA 5IMIA 3NPKA 3N1WF 1KIZA 3PKOA 3M9UA 5IMNA 4PVYF 5ILKA 2ZCQA 5DJPF 2P1CA 3CKEA 4DWBA 2J1PA 2Z7HA 1YHLA 3LVSA 5IK0A 2DH4A 5IM1A 2Q80A 4LLSA 5IL8A 2AZJA 5DIQF 3KRPA 3G4FA 1WL0A 1WL2A 5HNAA 2ZCSA 3PH7A 4K10A 3SAEA 4Q23A 3VJEA 3ZOUA 4NKEA 4LFVF 3WJOA 3CP6A 5HN8A 4KQ5A 4N9UA 3V1XA 3N3DA 4H5CF 1VG3A 3MZVA 4OMHA 4PVXF 3OYRA 4GAXA 3OACB 1HX9A 4EA1A 2Z4YA 3UCAA 3N1VF 5KSXF 1JFAA 2Z4VA 4KFAA 5JA0F 2J1OA 2PS8A 2I19A 3ADZA 3M02A 2OPMA 2ZCRA 1UBYA 3BNXA 4FP4A 5IN8A 2AZLA 2ONGA 4OKZA 4NUAA 1YYSA 3WCFA 5JV1F 5IK9A 1V4KA 3KBKA 1ZW5A 2Z7IA 2F9KF 5A0IA 1EZFA 4KVIA 4WK5A 3KRFB 3LSNA 5ERNA 3KROB 3WSBA 5EAUA 2Z4XA 3M00A 1HXAA 1YHKA 3WCGA 3PYBA 2PS5A 3WCBA 4GA3A 5B01A 3N0GA 4LFGA 4NKFA 3S9VA 3N45F 5DZ2A 3M01A 3OACA 1N1BA 3PYAA 3ICMA 4F6VA 5ILDA 4FJQA 2E8VA 3CC9A 3VJCA 3Q2ZA 3TFPA 1WL3A 1HM4A 4DEMF 1WMWA 3P41A 3SDUA 2F89F 3DYFA 5ILJA 3NF2A 3LZ9A 5IMPA 3B7LA 3N49F 4DZWA 3EZ3A 3P8LA 3WCDA 3VJ9A 3ID0A 3LLWA 3P8RA 1HXCA 2Z52A 3KRFA 5B0LA 4XQSF 2E8WA 3KROA 1KIYA 3NPRA 4UMJA 1YYTA 1N1ZA 2Z78A 1JFGA 4LZ3A 4RXDA 3SDRA 3ACYA 2AEKA 5CG6A 1DI1A 3ICZA 3DYGA 3N6KF 4HD1A 2ZCOA 3SDQA 4RXEA 1VG4A 5IKHA 2AETA 3ZMCA 3Q30A 4KPDA 3IBAA 1V4HA 5EATA 4LIXA 4LA6A 2ONHA 4E9ZA 2AZKA 3KRCB 1N21A 4H5EF 4ZQ8A 3SDTA 3WSAA 1PS1A 4OKMA 3WCHA 4KQUA 4GP2A 5ILHA 5JUZF 5DW7A 3TC1A 5DGMF 5IKAA 2Q9ZA 2Z50A 3VJAA 3LG5A 3RYEA 5DGNF 3N5JF 3WCAA 5B0KA 4LXWA 1VG2A 3WEJA 4E1EA 1UBWA 3LMDA 2E8UA 3VJ8A 3G4DA 5ER8A 3LJIA 4JZBA 4LZCA 4H5DF 4DXJA 3WC9A 3LOMA 3IPIA 5E8KA 3WJNA 4JXNA 3V66A 1YYQA 3WCLA 4LOBA 5ILZA 3BNYA 3WCMA 2E90A 3WCEA 4KPJA 3N0FA 3SDVA 5DHKA 3KRCA 2FTZA 3AQBB 5E8LA 3TFNA 4DI5A 4EA2A 4JVJF 3AE0A 5I1UA 5DGSF 3WCCA 5E8HA 4LA5A 3N46F 5A0KA 1V4EA 4KWDA 4P0VA 3QKCA 1DGPA 3TS7A 4JXYA 5IVGA 4NG6A 4EA0A 3VJDA 5JV2F 2OA6A 3LDWA 4JYXA 4LTVA 3OABB 2E8TA 5AELA 2PS6A 3RBMA 4E9UA 4RNQA 2O1OA 5DJVF 3N5HF 1YV5A 2ZY1A 4LZ0A 2E92A 3S4JA 3WEIA 2ZEUA 5B0JA 2Q58A 5EROA 4NFIF 5AFXA 5B00A 5AYPA 3WJKA 4XQRF 4RYPA 2OPNA 1RQIA 4RXAA 3Q1OA 3W7FA 1YJ4A 4LTZA 5AHUB 4P0WA 3ZCDA 1UBVA 3WCJA 3WEKA 3APZA 4NFKF 3ZMBA 4KVYA 2H8OA 1VG6A 5ILIA 5DJRF 5H9DA 2E94A 5HN7A 3DYHA 4F62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E8X A;  1RTR A;  3EFQ A;  1UBX A;  5JV0 F;  5EAS A;  4KK2 A;  4LUU A;  1N24 A;  5C05 A;  3VJB A;  5CG5 A;  1V4I A;  3LK5 A;  2FOR A;  4L2X F;  3TFV A;  3ICN A;  4P0X A;  3QQV A;  2PS4 A;  4GP1 A;  3OAB A;  1YYU A;  4LPG F;  2RAH A;  3LGK A;  1WKZ A;  2F7M F;  4MC8 A;  3ACW A;  4KVW A;  3WEG A;  3KRA B;  1WY0 A;  1N22 A;  4MC0 A;  1YHM A;  1N20 A;  2Z4W A;  5ILY A;  5B02 A;  2AEL A;  1HXG A;  1RQJ A;  3RMG A;  4N1Z F;  3ASX A;  2PS7 A;  2E91 A;  4DHD A;  4OMG A;  4F6X A;  1HM7 A;  3N3L F;  2J5C A;  4KQS A;  2F8C F;  4OGU A;  1V4J A;  4DWG A;  3Q2Q A;  4KVD A;  3EGT A;  4QXS F;  3KRP B;  3RYW A;  3AQ0 A;  2QIS A;  2OGD A;  4NFJ F;  2VF6 A;  3P5R A;  3M0G A;  4LFE A;  3ZL6 A;  3AQC B;  3LEE A;  1VG7 A;  3WEF A;  2ZEV A;  3LGZ B;  2F8Z F;  4LPH F;  4JZX A;  3ACX A;  5DHI A;  3MAV A;  5B0I A;  3WEH A;  2EWG A;  4KKM A;  5ERM A;  3NRI A;  2Q9Y A;  3PDE A;  5B03 A;  5IK6 A;  3V1V A;  1N23 A;  4LLT A;  4RXC A;  2E95 A;  2F92 F;  5A0J A;  4MC3 A;  3P5P A;  2Z4Z A;  1WL1 A;  5IL3 A;  3WE9 A;  1YYR A;  4QPF A;  3WCI A;  1FPS A;  5B0M A;  2E93 A;  4KUX A;  3KB9 A;  3KRA A;  5HN9 A;  2F94 F;  4XQT F;  2E4O A;  1YQ7 A;  3ICK A;  5IMI A;  3NPK A;  3N1W F;  1KIZ A;  3PKO A;  3M9U A;  5IMN A;  4PVY F;  5ILK A;  2ZCQ A;  5DJP F;  2P1C A;  3CKE A;  4DWB A;  2J1P A;  2Z7H A;  1YHL A;  3LVS A;  5IK0 A;  2DH4 A;  5IM1 A;  2Q80 A;  4LLS A;  5IL8 A;  2AZJ A;  5DIQ F;  3KRP A;  3G4F A;  1WL0 A;  1WL2 A;  5HNA A;  2ZCS A;  3PH7 A;  4K10 A;  3SAE A;  4Q23 A;  3VJE A;  3ZOU A;  4NKE A;  4LFV F;  3WJO A;  3CP6 A;  5HN8 A;  4KQ5 A;  4N9U A;  3V1X A;  3N3D A;  4H5C F;  1VG3 A;  3MZV A;  4OMH A;  4PVX F;  3OYR A;  4GAX A;  3OAC B;  1HX9 A;  4EA1 A;  2Z4Y A;  3UCA A;  3N1V F;  5KSX F;  1JFA A;  2Z4V A;  4KFA A;  5JA0 F;  2J1O A;  2PS8 A;  2I19 A;  3ADZ A;  3M02 A;  2OPM A;  2ZCR A;  1UBY A;  3BNX A;  4FP4 A;  5IN8 A;  2AZL A;  2ONG A;  4OKZ A;  4NUA A;  1YYS A;  3WCF A;  5JV1 F;  5IK9 A;  1V4K A;  3KBK A;  1ZW5 A;  2Z7I A;  2F9K F;  5A0I A;  1EZF A;  4KVI A;  4WK5 A;  3KRF B;  3LSN A;  5ERN A;  3KRO B;  3WSB A;  5EAU A;  2Z4X A;  3M00 A;  1HXA A;  1YHK A;  3WCG A;  3PYB A;  2PS5 A;  3WCB A;  4GA3 A;  5B01 A;  3N0G A;  4LFG A;  4NKF A;  3S9V A;  3N45 F;  5DZ2 A;  3M01 A;  3OAC A;  1N1B A;  3PYA A;  3ICM A;  4F6V A;  5ILD A;  4FJQ A;  2E8V A;  3CC9 A;  3VJC A;  3Q2Z A;  3TFP A;  1WL3 A;  1HM4 A;  4DEM F;  1WMW A;  3P41 A;  3SDU A;  2F89 F;  3DYF A;  5ILJ A;  3NF2 A;  3LZ9 A;  5IMP A;  3B7L A;  3N49 F;  4DZW A;  3EZ3 A;  3P8L A;  3WCD A;  3VJ9 A;  3ID0 A;  3LLW A;  3P8R A;  1HXC A;  2Z52 A;  3KRF A;  5B0L A;  4XQS F;  2E8W A;  3KRO A;  1KIY A;  3NPR A;  4UMJ A;  1YYT A;  1N1Z A;  2Z78 A;  1JFG A;  4LZ3 A;  4RXD A;  3SDR A;  3ACY A;  2AEK A;  5CG6 A;  1DI1 A;  3ICZ A;  3DYG A;  3N6K F;  4HD1 A;  2ZCO A;  3SDQ A;  4RXE A;  1VG4 A;  5IKH A;  2AET A;  3ZMC A;  3Q30 A;  4KPD A;  3IBA A;  1V4H A;  5EAT A;  4LIX A;  4LA6 A;  2ONH A;  4E9Z A;  2AZK A;  3KRC B;  1N21 A;  4H5E F;  4ZQ8 A;  3SDT A;  3WSA A;  1PS1 A;  4OKM A;  3WCH A;  4KQU A;  4GP2 A;  5ILH A;  5JUZ F;  5DW7 A;  3TC1 A;  5DGM F;  5IKA A;  2Q9Z A;  2Z50 A;  3VJA A;  3LG5 A;  3RYE A;  5DGN F;  3N5J F;  3WCA A;  5B0K A;  4LXW A;  1VG2 A;  3WEJ A;  4E1E A;  1UBW A;  3LMD A;  2E8U A;  3VJ8 A;  3G4D A;  5ER8 A;  3LJI A;  4JZB A;  4LZC A;  4H5D F;  4DXJ A;  3WC9 A;  3LOM A;  3IPI A;  5E8K A;  3WJN A;  4JXN A;  3V66 A;  1YYQ A;  3WCL A;  4LOB A;  5ILZ A;  3BNY A;  3WCM A;  2E90 A;  3WCE A;  4KPJ A;  3N0F A;  3SDV A;  5DHK A;  3KRC A;  2FTZ A;  3AQB B;  5E8L A;  3TFN A;  4DI5 A;  4EA2 A;  4JVJ F;  3AE0 A;  5I1U A;  5DGS F;  3WCC A;  5E8H A;  4LA5 A;  3N46 F;  5A0K A;  1V4E A;  4KWD A;  4P0V A;  3QKC A;  1DGP A;  3TS7 A;  4JXY A;  5IVG A;  4NG6 A;  4EA0 A;  3VJD A;  5JV2 F;  2OA6 A;  3LDW A;  4JYX A;  4LTV A;  3OAB B;  2E8T A;  5AEL A;  2PS6 A;  3RBM A;  4E9U A;  4RNQ A;  2O1O A;  5DJV F;  3N5H F;  1YV5 A;  2ZY1 A;  4LZ0 A;  2E92 A;  3S4J A;  3WEI A;  2ZEU A;  5B0J A;  2Q58 A;  5ERO A;  4NFI F;  5AFX A;  5B00 A;  5AYP A;  3WJK A;  4XQR F;  4RYP A;  2OPN A;  1RQI A;  4RXA A;  3Q1O A;  3W7F A;  1YJ4 A;  4LTZ A;  5AHU B;  4P0W A;  3ZCD A;  1UBV A;  3WCJ A;  3WEK A;  3APZ A;  4NFK F;  3ZMB A;  4KVY A;  2H8O A;  1VG6 A;  5ILI A;  5DJR F;  5H9D A;  2E94 A;  5HN7 A;  3DYH A;  4F62 A; 
#chains in the Genus database with same CATH topology
 2E8X A;  1RTR A;  3EFQ A;  1UBX A;  5JV0 F;  5EAS A;  4KK2 A;  4LUU A;  1N24 A;  5C05 A;  3VJB A;  5CG5 A;  1V4I A;  3LK5 A;  2FOR A;  4L2X F;  3TFV A;  3ICN A;  4P0X A;  3QQV A;  2PS4 A;  4GP1 A;  3OAB A;  1YYU A;  4LPG F;  2RAH A;  3LGK A;  1WKZ A;  2F7M F;  4MC8 A;  3ACW A;  4KVW A;  3WEG A;  3KRA B;  1WY0 A;  1N22 A;  4MC0 A;  1YHM A;  1N20 A;  2Z4W A;  5ILY A;  5B02 A;  2AEL A;  1HXG A;  1RQJ A;  3RMG A;  4N1Z F;  3ASX A;  2PS7 A;  2E91 A;  4DHD A;  4OMG A;  4F6X A;  1HM7 A;  3N3L F;  2J5C A;  4KQS A;  2F8C F;  4OGU A;  1V4J A;  4DWG A;  3Q2Q A;  4KVD A;  3EGT A;  4QXS F;  3KRP B;  3RYW A;  3AQ0 A;  2QIS A;  2OGD A;  4NFJ F;  2VF6 A;  3P5R A;  3M0G A;  4LFE A;  3ZL6 A;  3AQC B;  3LEE A;  1VG7 A;  3WEF A;  2ZEV A;  3LGZ B;  2F8Z F;  4LPH F;  4JZX A;  3ACX A;  5DHI A;  3MAV A;  5B0I A;  3WEH A;  2EWG A;  4KKM A;  5ERM A;  3NRI A;  2Q9Y A;  3PDE A;  5B03 A;  5IK6 A;  3V1V A;  1N23 A;  4LLT A;  4RXC A;  2E95 A;  2F92 F;  5A0J A;  4MC3 A;  3P5P A;  2Z4Z A;  1WL1 A;  5IL3 A;  3WE9 A;  1YYR A;  4QPF A;  3WCI A;  1FPS A;  5B0M A;  2E93 A;  4KUX A;  3KB9 A;  3KRA A;  5HN9 A;  2F94 F;  4XQT F;  2E4O A;  1YQ7 A;  3ICK A;  5IMI A;  3NPK A;  3N1W F;  1KIZ A;  3PKO A;  3M9U A;  5IMN A;  4PVY F;  5ILK A;  2ZCQ A;  5DJP F;  2P1C A;  3CKE A;  4DWB A;  2J1P A;  2Z7H A;  1YHL A;  3LVS A;  5IK0 A;  2DH4 A;  5IM1 A;  2Q80 A;  4LLS A;  5IL8 A;  2AZJ A;  5DIQ F;  3KRP A;  3G4F A;  1WL0 A;  1WL2 A;  5HNA A;  2ZCS A;  3PH7 A;  4K10 A;  3SAE A;  4Q23 A;  3VJE A;  3ZOU A;  4NKE A;  4LFV F;  3WJO A;  3CP6 A;  5HN8 A;  4KQ5 A;  4N9U A;  3V1X A;  3N3D A;  4H5C F;  1VG3 A;  3MZV A;  4OMH A;  4PVX F;  3OYR A;  4GAX A;  3OAC B;  1HX9 A;  4EA1 A;  2Z4Y A;  3UCA A;  3N1V F;  5KSX F;  1JFA A;  2Z4V A;  4KFA A;  5JA0 F;  2J1O A;  2PS8 A;  2I19 A;  3ADZ A;  3M02 A;  2OPM A;  2ZCR A;  1UBY A;  3BNX A;  4FP4 A;  5IN8 A;  2AZL A;  2ONG A;  4OKZ A;  4NUA A;  1YYS A;  3WCF A;  5JV1 F;  5IK9 A;  1V4K A;  3KBK A;  1ZW5 A;  2Z7I A;  2F9K F;  5A0I A;  1EZF A;  4KVI A;  4WK5 A;  3KRF B;  3LSN A;  5ERN A;  3KRO B;  3WSB A;  5EAU A;  2Z4X A;  3M00 A;  1HXA A;  1YHK A;  3WCG A;  3PYB A;  2PS5 A;  3WCB A;  4GA3 A;  5B01 A;  3N0G A;  4LFG A;  4NKF A;  3S9V A;  3N45 F;  5DZ2 A;  3M01 A;  3OAC A;  1N1B A;  3PYA A;  3ICM A;  4F6V A;  5ILD A;  4FJQ A;  2E8V A;  3CC9 A;  3VJC A;  3Q2Z A;  3TFP A;  1WL3 A;  1HM4 A;  4DEM F;  1WMW A;  3P41 A;  3SDU A;  2F89 F;  3DYF A;  5ILJ A;  3NF2 A;  3LZ9 A;  5IMP A;  3B7L A;  3N49 F;  4DZW A;  3EZ3 A;  3P8L A;  3WCD A;  3VJ9 A;  3ID0 A;  3LLW A;  3P8R A;  1HXC A;  2Z52 A;  3KRF A;  5B0L A;  4XQS F;  2E8W A;  3KRO A;  1KIY A;  3NPR A;  4UMJ A;  1YYT A;  1N1Z A;  2Z78 A;  1JFG A;  4LZ3 A;  4RXD A;  3SDR A;  3ACY A;  2AEK A;  5CG6 A;  1DI1 A;  3ICZ A;  3DYG A;  3N6K F;  4HD1 A;  2ZCO A;  3SDQ A;  4RXE A;  1VG4 A;  5IKH A;  2AET A;  3ZMC A;  3Q30 A;  4KPD A;  3IBA A;  1V4H A;  5EAT A;  4LIX A;  4LA6 A;  2ONH A;  4E9Z A;  2AZK A;  3KRC B;  1N21 A;  4H5E F;  4ZQ8 A;  3SDT A;  3WSA A;  1PS1 A;  4OKM A;  3WCH A;  4KQU A;  4GP2 A;  5ILH A;  5JUZ F;  5DW7 A;  3TC1 A;  5DGM F;  5IKA A;  2Q9Z A;  2Z50 A;  3VJA A;  3LG5 A;  3RYE A;  5DGN F;  3N5J F;  3WCA A;  5B0K A;  4LXW A;  1VG2 A;  3WEJ A;  4E1E A;  1UBW A;  3LMD A;  2E8U A;  3VJ8 A;  3G4D A;  5ER8 A;  3LJI A;  4JZB A;  4LZC A;  4H5D F;  4DXJ A;  3WC9 A;  3LOM A;  3IPI A;  5E8K A;  3WJN A;  4JXN A;  3V66 A;  1YYQ A;  3WCL A;  4LOB A;  5ILZ A;  3BNY A;  3WCM A;  2E90 A;  3WCE A;  4KPJ A;  3N0F A;  3SDV A;  5DHK A;  3KRC A;  2FTZ A;  3AQB B;  5E8L A;  3TFN A;  4DI5 A;  4EA2 A;  4JVJ F;  3AE0 A;  5I1U A;  5DGS F;  3WCC A;  5E8H A;  4LA5 A;  3N46 F;  5A0K A;  1V4E A;  4KWD A;  4P0V A;  3QKC A;  1DGP A;  3TS7 A;  4JXY A;  5IVG A;  4NG6 A;  4EA0 A;  3VJD A;  5JV2 F;  2OA6 A;  3LDW A;  4JYX A;  4LTV A;  3OAB B;  2E8T A;  5AEL A;  2PS6 A;  3RBM A;  4E9U A;  4RNQ A;  2O1O A;  5DJV F;  3N5H F;  1YV5 A;  2ZY1 A;  4LZ0 A;  2E92 A;  3S4J A;  3WEI A;  2ZEU A;  5B0J A;  2Q58 A;  5ERO A;  4NFI F;  5AFX A;  5B00 A;  5AYP A;  3WJK A;  4XQR F;  4RYP A;  2OPN A;  1RQI A;  4RXA A;  3Q1O A;  3W7F A;  1YJ4 A;  4LTZ A;  5AHU B;  4P0W A;  3ZCD A;  1UBV A;  3WCJ A;  3WEK A;  3APZ A;  4NFK F;  3ZMB A;  4KVY A;  2H8O A;  1VG6 A;  5ILI A;  5DJR F;  5H9D A;  2E94 A;  5HN7 A;  3DYH A;  4F62 A; 
#chains in the Genus database with same CATH homology
 2E8X A;  1RTR A;  3EFQ A;  1UBX A;  5JV0 F;  5EAS A;  4KK2 A;  4LUU A;  1N24 A;  5C05 A;  3VJB A;  5CG5 A;  1V4I A;  3LK5 A;  2FOR A;  4L2X F;  3TFV A;  3ICN A;  4P0X A;  3QQV A;  2PS4 A;  4GP1 A;  3OAB A;  1YYU A;  4LPG F;  2RAH A;  3LGK A;  1WKZ A;  2F7M F;  4MC8 A;  3ACW A;  4KVW A;  3WEG A;  3KRA B;  1WY0 A;  1N22 A;  4MC0 A;  1YHM A;  1N20 A;  2Z4W A;  5ILY A;  5B02 A;  2AEL A;  1HXG A;  1RQJ A;  3RMG A;  4N1Z F;  3ASX A;  2PS7 A;  2E91 A;  4DHD A;  4OMG A;  4F6X A;  1HM7 A;  3N3L F;  2J5C A;  4KQS A;  2F8C F;  4OGU A;  1V4J A;  4DWG A;  3Q2Q A;  4KVD A;  3EGT A;  4QXS F;  3KRP B;  3RYW A;  3AQ0 A;  2QIS A;  2OGD A;  4NFJ F;  2VF6 A;  3P5R A;  3M0G A;  4LFE A;  3ZL6 A;  3AQC B;  3LEE A;  1VG7 A;  3WEF A;  2ZEV A;  3LGZ B;  2F8Z F;  4LPH F;  4JZX A;  3ACX A;  5DHI A;  3MAV A;  5B0I A;  3WEH A;  2EWG A;  4KKM A;  5ERM A;  3NRI A;  2Q9Y A;  3PDE A;  5B03 A;  5IK6 A;  3V1V A;  1N23 A;  4LLT A;  4RXC A;  2E95 A;  2F92 F;  5A0J A;  4MC3 A;  3P5P A;  2Z4Z A;  1WL1 A;  5IL3 A;  3WE9 A;  1YYR A;  4QPF A;  3WCI A;  1FPS A;  5B0M A;  2E93 A;  4KUX A;  3KB9 A;  3KRA A;  5HN9 A;  2F94 F;  4XQT F;  2E4O A;  1YQ7 A;  3ICK A;  5IMI A;  3NPK A;  3N1W F;  1KIZ A;  3PKO A;  3M9U A;  5IMN A;  4PVY F;  5ILK A;  2ZCQ A;  5DJP F;  2P1C A;  3CKE A;  4DWB A;  2J1P A;  2Z7H A;  1YHL A;  3LVS A;  5IK0 A;  2DH4 A;  5IM1 A;  2Q80 A;  4LLS A;  5IL8 A;  2AZJ A;  5DIQ F;  3KRP A;  3G4F A;  1WL0 A;  1WL2 A;  5HNA A;  2ZCS A;  3PH7 A;  4K10 A;  3SAE A;  4Q23 A;  3VJE A;  3ZOU A;  4NKE A;  4LFV F;  3WJO A;  3CP6 A;  5HN8 A;  4KQ5 A;  4N9U A;  3V1X A;  3N3D A;  4H5C F;  1VG3 A;  3MZV A;  4OMH A;  4PVX F;  3OYR A;  4GAX A;  3OAC B;  1HX9 A;  4EA1 A;  2Z4Y A;  3UCA A;  3N1V F;  5KSX F;  1JFA A;  2Z4V A;  4KFA A;  5JA0 F;  2J1O A;  2PS8 A;  2I19 A;  3ADZ A;  3M02 A;  2OPM A;  2ZCR A;  1UBY A;  3BNX A;  4FP4 A;  5IN8 A;  2AZL A;  2ONG A;  4OKZ A;  4NUA A;  1YYS A;  3WCF A;  5JV1 F;  5IK9 A;  1V4K A;  3KBK A;  1ZW5 A;  2Z7I A;  2F9K F;  5A0I A;  1EZF A;  4KVI A;  4WK5 A;  3KRF B;  3LSN A;  5ERN A;  3KRO B;  3WSB A;  5EAU A;  2Z4X A;  3M00 A;  1HXA A;  1YHK A;  3WCG A;  3PYB A;  2PS5 A;  3WCB A;  4GA3 A;  5B01 A;  3N0G A;  4LFG A;  4NKF A;  3S9V A;  3N45 F;  5DZ2 A;  3M01 A;  3OAC A;  1N1B A;  3PYA A;  3ICM A;  4F6V A;  5ILD A;  4FJQ A;  2E8V A;  3CC9 A;  3VJC A;  3Q2Z A;  3TFP A;  1WL3 A;  1HM4 A;  4DEM F;  1WMW A;  3P41 A;  3SDU A;  2F89 F;  3DYF A;  5ILJ A;  3NF2 A;  3LZ9 A;  5IMP A;  3B7L A;  3N49 F;  4DZW A;  3EZ3 A;  3P8L A;  3WCD A;  3VJ9 A;  3ID0 A;  3LLW A;  3P8R A;  1HXC A;  2Z52 A;  3KRF A;  5B0L A;  4XQS F;  2E8W A;  3KRO A;  1KIY A;  3NPR A;  4UMJ A;  1YYT A;  1N1Z A;  2Z78 A;  1JFG A;  4LZ3 A;  4RXD A;  3SDR A;  3ACY A;  2AEK A;  5CG6 A;  1DI1 A;  3ICZ A;  3DYG A;  3N6K F;  4HD1 A;  2ZCO A;  3SDQ A;  4RXE A;  1VG4 A;  5IKH A;  2AET A;  3ZMC A;  3Q30 A;  4KPD A;  3IBA A;  1V4H A;  5EAT A;  4LIX A;  4LA6 A;  2ONH A;  4E9Z A;  2AZK A;  3KRC B;  1N21 A;  4H5E F;  4ZQ8 A;  3SDT A;  3WSA A;  1PS1 A;  4OKM A;  3WCH A;  4KQU A;  4GP2 A;  5ILH A;  5JUZ F;  5DW7 A;  3TC1 A;  5DGM F;  5IKA A;  2Q9Z A;  2Z50 A;  3VJA A;  3LG5 A;  3RYE A;  5DGN F;  3N5J F;  3WCA A;  5B0K A;  4LXW A;  1VG2 A;  3WEJ A;  4E1E A;  1UBW A;  3LMD A;  2E8U A;  3VJ8 A;  3G4D A;  5ER8 A;  3LJI A;  4JZB A;  4LZC A;  4H5D F;  4DXJ A;  3WC9 A;  3LOM A;  3IPI A;  5E8K A;  3WJN A;  4JXN A;  3V66 A;  1YYQ A;  3WCL A;  4LOB A;  5ILZ A;  3BNY A;  3WCM A;  2E90 A;  3WCE A;  4KPJ A;  3N0F A;  3SDV A;  5DHK A;  3KRC A;  2FTZ A;  3AQB B;  5E8L A;  3TFN A;  4DI5 A;  4EA2 A;  4JVJ F;  3AE0 A;  5I1U A;  5DGS F;  3WCC A;  5E8H A;  4LA5 A;  3N46 F;  5A0K A;  1V4E A;  4KWD A;  4P0V A;  3QKC A;  1DGP A;  3TS7 A;  4JXY A;  5IVG A;  4NG6 A;  4EA0 A;  3VJD A;  5JV2 F;  2OA6 A;  3LDW A;  4JYX A;  4LTV A;  3OAB B;  2E8T A;  5AEL A;  2PS6 A;  3RBM A;  4E9U A;  4RNQ A;  2O1O A;  5DJV F;  3N5H F;  1YV5 A;  2ZY1 A;  4LZ0 A;  2E92 A;  3S4J A;  3WEI A;  2ZEU A;  5B0J A;  2Q58 A;  5ERO A;  4NFI F;  5AFX A;  5B00 A;  5AYP A;  3WJK A;  4XQR F;  4RYP A;  2OPN A;  1RQI A;  4RXA A;  3Q1O A;  3W7F A;  1YJ4 A;  4LTZ A;  5AHU B;  4P0W A;  3ZCD A;  1UBV A;  3WCJ A;  3WEK A;  3APZ A;  4NFK F;  3ZMB A;  4KVY A;  2H8O A;  1VG6 A;  5ILI A;  5DJR F;  5H9D A;  2E94 A;  5HN7 A;  3DYH A;  4F62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...