5ERNA

Crystal structure of elongation domain of phomopsis amygdali fusicoccadiene synthase
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
307
structure length
286
Chain Sequence
DHIFFEKAVLEAPYDYIASMPSKGVRDQFIDALNDWLRVPDVKVGKIKDAVRVLHNSSLLLDDFQDNSPLRRGKPSTHNIFGSAQTVNTATYSIIKAIGQIMEFSVQEVMNSIMILFQGQAMDLFWTYNGHVPSEEEYYRMIDQKTGQLFSIATSLLLNAADNEIPRTKIQSCLHRLTRLLGRCFQIRDDYQNLGKWSLALIHMIHKQRSHMALLNVLSTGRKHGGMTLEQKQFVLDIIEEEKSLDYTRSVMMDLHVQLRAEIGRIEILLDSPNPAMRLLLELLRV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Fusicoccadiene synthase
publication title Structure and Function of Fusicoccadiene Synthase, a Hexameric Bifunctional Diterpene Synthase.
pubmed doi rcsb
source organism Phomopsis amygdali
total genus 108
structure length 286
sequence length 307
chains with identical sequence B
ec nomenclature ec 2.5.1.29: Geranylgeranyl diphosphate synthase.
pdb deposition date 2015-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5ernA00
3V66A 4MC8A 3SAEA 5B0LA 2E4OA 2Z50A 5B0MA 1YHMA 4DWBA 2E90A 5I1UA 3ZMBA 4KKMA 4KVYA 1V4IA 3G4FA 2I19A 3EGTA 5IVGA 5B0JA 3N6KF 3CKEA 3WCEA 3WCAA 5A0JA 2AZLA 3KRCB 1V4HA 4PVXF 4E9ZA 2QISA 3WJOA 1VG4A 3WSBA 3AE0A 3VJ8A 3VJCA 1WL2A 2F94F 2E91A 4JZXA 3ACXA 4QPFA 1KIYA 5ERMA 3Q2QA 5C05A 3PYBA 5KSXF 1N1BA 2AZJA 2Z4WA 2PS5A 3N49F 3WCDA 3V1VA 2E8WA 1YYTA 5H9DA 2E8TA 3ASXA 3P41A 3WCLA 4MC0A 4F6XA 5EASA 3LZ9A 4KQSA 1WL0A 1N23A 1N21A 3PYAA 2OPMA 3ACWA 1UBWA 3LGZB 3OACA 3ZOUA 1N20A 3VJ9A 2PS6A 4FP4A 3DYGA 1YYRA 5IKHA 2P1CA 3WCMA 3LK5A 3TFPA 3ACYA 3AQCB 5JV1F 2F92F 1YYUA 3KROB 3P8LA 4L2XF 5ILJA 1HXCA 4KFAA 1KIZA 3LOMA 4LA6A 1YQ7A 4EA1A 1YYQA 2ZEUA 3KRCA 3SDUA 3P5PA 2AEKA 1WMWA 4GAXA 4GA3A 1DI1A 5B0IA 5B03A 4E9UA 4LIXA 3IPIA 5IMPA 2E8UA 5HN8A 2OGDA 1ZW5A 3LGKA 4XQTF 5JA0F 1VG7A 2Z4VA 2VF6A 4DXJA 3PDEA 3RYEA 5CG6A 3ICNA 5IMIA 3VJAA 3KB9A 4LTVA 4NKFA 3WC9A 3LSNA 5E8HA 2AZKA 3ICKA 1WY0A 5AFXA 2ONHA 5AELA 4LUUA 5HNAA 5IK9A 4F6VA 2F8ZF 1UBVA 3SDRA 1HXAA 4RXCA 4NUAA 2FORA 4LOBA 3OABB 3NPRA 3B7LA 5IN8A 3KRPB 3TS7A 4LZ0A 1FPSA 2PS7A 3WCIA 3N1WF 3WCJA 4LTZA 2E92A 5B02A 1V4EA 4GP1A 4NG6A 5ERNA 3WSAA 5DJVF 1WKZA 5HN7A 3WEIA 3N1VF 5CG5A 3LJIA 3KROA 3N46F 4HD1A 3WCFA 3WCCA 2Z52A 2AELA 3TFNA 3SDQA 3RYWA 3NRIA 3ZMCA 3VJDA 3ID0A 2F8CF 5DZ2A 4FJQA 5DGSF 5EAUA 2J1OA 1VG3A 4OMHA 5ILKA 4KQ5A 4JZBA 4LFEA 4RXAA 3CC9A 2E95A 4H5DF 4GP2A 4KWDA 3KBKA 2Q9ZA 3M02A 3P5RA 2ZCRA 4EA0A 1N24A 5DIQF 2ZEVA 3TC1A 3N0GA 4DZWA 3V1XA 3KRAB 5IKAA 3G4DA 3RBMA 3BNXA 1YHLA 3AQ0A 3TFVA 1YJ4A 3S9VA 1YYSA 3QQVA 3WEGA 3OABA 3SDTA 4E1EA 3PKOA 1JFGA 3KRPA 2Z4ZA 2F9KF 4RNQA 2Z4YA 3APZA 3M0GA 5A0KA 2ZCSA 3QKCA 4OMGA 3WEKA 4DEMF 3CP6A 2O1OA 5IMNA 5EATA 1DGPA 2OPNA 5B0KA 5ILDA 4DHDA 4UMJA 3ZCDA 5DHKA 4LXWA 3M9UA 1RQIA 3N0FA 4NFKF 5HN9A 2E94A 3PH7A 1UBXA 1V4JA 4KVWA 4RXEA 3EZ3A 1HM4A 4KK2A 4KUXA 2J1PA 4LFVF 3KRFB 2Q80A 3WJNA 1V4KA 5B00A 1JFAA 5E8LA 2E93A 4H5CF 3NPKA 5DW7A 3UCAA 3WCHA 2PS8A 2Q58A 3DYFA 2ONGA 3WJKA 3N5JF 4ZQ8A 3S4JA 1VG2A 5AHUB 5IM1A 5E8KA 4KPJA 3WEFA 1HM7A 4P0XA 5ILHA 4KPDA 2Z4XA 1VG6A 2Z78A 3KRAA 3N45F 3N3LF 4KVIA 4PVYF 2Z7IA 2Q9YA 5ILIA 4H5EF 4XQSF 3M00A 4RXDA 3LLWA 3EFQA 4K10A 3OYRA 4Q23A 1N22A 5ILYA 5IK6A 3W7FA 4DI5A 4NFJF 5JV2F 4OKZA 1HXGA 4LZCA 2F7MF 4P0WA 2E8XA 2J5CA 1WL1A 5DHIA 2E8VA 1YV5A 2ZCQA 4JVJF 3WCBA 2OA6A 3SDVA 4LPGF 3ICMA 2Z7HA 3M01A 3ZL6A 5DJRF 5ILZA 1HX9A 1RTRA 1EZFA 3KRFA 4RYPA 4NKEA 5IK0A 4LFGA 3LEEA 5AYPA 3RMGA 5DGNF 3LDWA 3P8RA 4LA5A 3ADZA 3WEHA 4DWGA 4LZ3A 3Q2ZA 5IL3A 4JYXA 3N5HF 4XQRF 4OKMA 2ZY1A 3VJBA 4OGUA 5ER8A 3N3DA 4LPHF 5DJPF 3IBAA 2H8OA 3ICZA 4KVDA 4WK5A 3WEJA 1UBYA 2DH4A 5JV0F 1WL3A 3LMDA 1N1ZA 3AQBB 3MAVA 5B01A 4LLSA 3Q1OA 3LG5A 1YHKA 4N1ZF 1RQJA 5DGMF 4NFIF 4P0VA 4F62A 2RAHA 5A0IA 2PS4A 5EROA 4JXNA 2AETA 3VJEA 3LVSA 3WE9A 3MZVA 3BNYA 5JUZF 3OACB 4LLTA 2EWGA 3WCGA 4N9UA 3NF2A 4KQUA 2F89F 4MC3A 2ZCOA 4EA2A 3Q30A 3DYHA 4QXSF 1PS1A 5IL8A 2FTZA 4JXYA
chains in the Genus database with same CATH superfamily
3V66A 4MC8A 3SAEA 5B0LA 2E4OA 2Z50A 5B0MA 1YHMA 4DWBA 2E90A 5I1UA 3ZMBA 4KKMA 4KVYA 1V4IA 3G4FA 2I19A 3EGTA 5IVGA 5B0JA 3N6KF 3CKEA 3WCEA 3WCAA 5A0JA 2AZLA 3KRCB 1V4HA 4PVXF 4E9ZA 2QISA 3WJOA 1VG4A 3WSBA 3AE0A 3VJ8A 3VJCA 1WL2A 2F94F 2E91A 4JZXA 3ACXA 4QPFA 1KIYA 5ERMA 3Q2QA 5C05A 3PYBA 5KSXF 1N1BA 2AZJA 2Z4WA 2PS5A 3N49F 3WCDA 3V1VA 2E8WA 1YYTA 5H9DA 2E8TA 3ASXA 3P41A 3WCLA 4MC0A 4F6XA 5EASA 3LZ9A 4KQSA 1WL0A 1N23A 1N21A 3PYAA 2OPMA 3ACWA 1UBWA 3LGZB 3OACA 3ZOUA 1N20A 3VJ9A 2PS6A 4FP4A 3DYGA 1YYRA 5IKHA 2P1CA 3WCMA 3LK5A 3TFPA 3ACYA 3AQCB 5JV1F 2F92F 1YYUA 3KROB 3P8LA 4L2XF 5ILJA 1HXCA 4KFAA 1KIZA 3LOMA 4LA6A 1YQ7A 4EA1A 1YYQA 2ZEUA 3KRCA 3SDUA 3P5PA 2AEKA 1WMWA 4GAXA 4GA3A 1DI1A 5B0IA 5B03A 4E9UA 4LIXA 3IPIA 5IMPA 2E8UA 5HN8A 2OGDA 1ZW5A 3LGKA 4XQTF 5JA0F 1VG7A 2Z4VA 2VF6A 4DXJA 3PDEA 3RYEA 5CG6A 3ICNA 5IMIA 3VJAA 3KB9A 4LTVA 4NKFA 3WC9A 3LSNA 5E8HA 2AZKA 3ICKA 1WY0A 5AFXA 2ONHA 5AELA 4LUUA 5HNAA 5IK9A 4F6VA 2F8ZF 1UBVA 3SDRA 1HXAA 4RXCA 4NUAA 2FORA 4LOBA 3OABB 3NPRA 3B7LA 5IN8A 3KRPB 3TS7A 4LZ0A 1FPSA 2PS7A 3WCIA 3N1WF 3WCJA 4LTZA 2E92A 5B02A 1V4EA 4GP1A 4NG6A 5ERNA 3WSAA 5DJVF 1WKZA 5HN7A 3WEIA 3N1VF 5CG5A 3LJIA 3KROA 3N46F 4HD1A 3WCFA 3WCCA 2Z52A 2AELA 3TFNA 3SDQA 3RYWA 3NRIA 3ZMCA 3VJDA 3ID0A 2F8CF 5DZ2A 4FJQA 5DGSF 5EAUA 2J1OA 1VG3A 4OMHA 5ILKA 4KQ5A 4JZBA 4LFEA 4RXAA 3CC9A 2E95A 4H5DF 4GP2A 4KWDA 3KBKA 2Q9ZA 3M02A 3P5RA 2ZCRA 4EA0A 1N24A 5DIQF 2ZEVA 3TC1A 3N0GA 4DZWA 3V1XA 3KRAB 5IKAA 3G4DA 3RBMA 3BNXA 1YHLA 3AQ0A 3TFVA 1YJ4A 3S9VA 1YYSA 3QQVA 3WEGA 3OABA 3SDTA 4E1EA 3PKOA 1JFGA 3KRPA 2Z4ZA 2F9KF 4RNQA 2Z4YA 3APZA 3M0GA 5A0KA 2ZCSA 3QKCA 4OMGA 3WEKA 4DEMF 3CP6A 2O1OA 5IMNA 5EATA 1DGPA 2OPNA 5B0KA 5ILDA 4DHDA 4UMJA 3ZCDA 5DHKA 4LXWA 3M9UA 1RQIA 3N0FA 4NFKF 5HN9A 2E94A 3PH7A 1UBXA 1V4JA 4KVWA 4RXEA 3EZ3A 1HM4A 4KK2A 4KUXA 2J1PA 4LFVF 3KRFB 2Q80A 3WJNA 1V4KA 5B00A 1JFAA 5E8LA 2E93A 4H5CF 3NPKA 5DW7A 3UCAA 3WCHA 2PS8A 2Q58A 3DYFA 2ONGA 3WJKA 3N5JF 4ZQ8A 3S4JA 1VG2A 5AHUB 5IM1A 5E8KA 4KPJA 3WEFA 1HM7A 4P0XA 5ILHA 4KPDA 2Z4XA 1VG6A 2Z78A 3KRAA 3N45F 3N3LF 4KVIA 4PVYF 2Z7IA 2Q9YA 5ILIA 4H5EF 4XQSF 3M00A 4RXDA 3LLWA 3EFQA 4K10A 3OYRA 4Q23A 1N22A 5ILYA 5IK6A 3W7FA 4DI5A 4NFJF 5JV2F 4OKZA 1HXGA 4LZCA 2F7MF 4P0WA 2E8XA 2J5CA 1WL1A 5DHIA 2E8VA 1YV5A 2ZCQA 4JVJF 3WCBA 2OA6A 3SDVA 4LPGF 3ICMA 2Z7HA 3M01A 3ZL6A 5DJRF 5ILZA 1HX9A 1RTRA 1EZFA 3KRFA 4RYPA 4NKEA 5IK0A 4LFGA 3LEEA 5AYPA 3RMGA 5DGNF 3LDWA 3P8RA 4LA5A 3ADZA 3WEHA 4DWGA 4LZ3A 3Q2ZA 5IL3A 4JYXA 3N5HF 4XQRF 4OKMA 2ZY1A 3VJBA 4OGUA 5ER8A 3N3DA 4LPHF 5DJPF 3IBAA 2H8OA 3ICZA 4KVDA 4WK5A 3WEJA 1UBYA 2DH4A 5JV0F 1WL3A 3LMDA 1N1ZA 3AQBB 3MAVA 5B01A 4LLSA 3Q1OA 3LG5A 1YHKA 4N1ZF 1RQJA 5DGMF 4NFIF 4P0VA 4F62A 2RAHA 5A0IA 2PS4A 5EROA 4JXNA 2AETA 3VJEA 3LVSA 3WE9A 3MZVA 3BNYA 5JUZF 3OACB 4LLTA 2EWGA 3WCGA 4N9UA 3NF2A 4KQUA 2F89F 4MC3A 2ZCOA 4EA2A 3Q30A 3DYHA 4QXSF 1PS1A 5IL8A 2FTZA 4JXYA
chains in the Genus database with same CATH topology
3V66A 4MC8A 3SAEA 5B0LA 2E4OA 2Z50A 5B0MA 1YHMA 4DWBA 2E90A 5I1UA 3ZMBA 4KKMA 4KVYA 1V4IA 3G4FA 2I19A 3EGTA 5IVGA 5B0JA 3N6KF 3CKEA 3WCEA 3WCAA 5A0JA 2AZLA 3KRCB 1V4HA 4PVXF 4E9ZA 2QISA 3WJOA 1VG4A 3WSBA 3AE0A 3VJ8A 3VJCA 1WL2A 2F94F 2E91A 4JZXA 3ACXA 4QPFA 1KIYA 5ERMA 3Q2QA 5C05A 3PYBA 5KSXF 1N1BA 2AZJA 2Z4WA 2PS5A 3N49F 3WCDA 3V1VA 2E8WA 1YYTA 5H9DA 2E8TA 3ASXA 3P41A 3WCLA 4MC0A 4F6XA 5EASA 3LZ9A 4KQSA 1WL0A 1N23A 1N21A 3PYAA 2OPMA 3ACWA 1UBWA 3LGZB 3OACA 3ZOUA 1N20A 3VJ9A 2PS6A 4FP4A 3DYGA 1YYRA 5IKHA 2P1CA 3WCMA 3LK5A 3TFPA 3ACYA 3AQCB 5JV1F 2F92F 1YYUA 3KROB 3P8LA 4L2XF 5ILJA 1HXCA 4KFAA 1KIZA 3LOMA 4LA6A 1YQ7A 4EA1A 1YYQA 2ZEUA 3KRCA 3SDUA 3P5PA 2AEKA 1WMWA 4GAXA 4GA3A 1DI1A 5B0IA 5B03A 4E9UA 4LIXA 3IPIA 5IMPA 2E8UA 5HN8A 2OGDA 1ZW5A 3LGKA 4XQTF 5JA0F 1VG7A 2Z4VA 2VF6A 4DXJA 3PDEA 3RYEA 5CG6A 3ICNA 5IMIA 3VJAA 3KB9A 4LTVA 4NKFA 3WC9A 3LSNA 5E8HA 2AZKA 3ICKA 1WY0A 5AFXA 2ONHA 5AELA 4LUUA 5HNAA 5IK9A 4F6VA 2F8ZF 1UBVA 3SDRA 1HXAA 4RXCA 4NUAA 2FORA 4LOBA 3OABB 3NPRA 3B7LA 5IN8A 3KRPB 3TS7A 4LZ0A 1FPSA 2PS7A 3WCIA 3N1WF 3WCJA 4LTZA 2E92A 5B02A 1V4EA 4GP1A 4NG6A 5ERNA 3WSAA 5DJVF 1WKZA 5HN7A 3WEIA 3N1VF 5CG5A 3LJIA 3KROA 3N46F 4HD1A 3WCFA 3WCCA 2Z52A 2AELA 3TFNA 3SDQA 3RYWA 3NRIA 3ZMCA 3VJDA 3ID0A 2F8CF 5DZ2A 4FJQA 5DGSF 5EAUA 2J1OA 1VG3A 4OMHA 5ILKA 4KQ5A 4JZBA 4LFEA 4RXAA 3CC9A 2E95A 4H5DF 4GP2A 4KWDA 3KBKA 2Q9ZA 3M02A 3P5RA 2ZCRA 4EA0A 1N24A 5DIQF 2ZEVA 3TC1A 3N0GA 4DZWA 3V1XA 3KRAB 5IKAA 3G4DA 3RBMA 3BNXA 1YHLA 3AQ0A 3TFVA 1YJ4A 3S9VA 1YYSA 3QQVA 3WEGA 3OABA 3SDTA 4E1EA 3PKOA 1JFGA 3KRPA 2Z4ZA 2F9KF 4RNQA 2Z4YA 3APZA 3M0GA 5A0KA 2ZCSA 3QKCA 4OMGA 3WEKA 4DEMF 3CP6A 2O1OA 5IMNA 5EATA 1DGPA 2OPNA 5B0KA 5ILDA 4DHDA 4UMJA 3ZCDA 5DHKA 4LXWA 3M9UA 1RQIA 3N0FA 4NFKF 5HN9A 2E94A 3PH7A 1UBXA 1V4JA 4KVWA 4RXEA 3EZ3A 1HM4A 4KK2A 4KUXA 2J1PA 4LFVF 3KRFB 2Q80A 3WJNA 1V4KA 5B00A 1JFAA 5E8LA 2E93A 4H5CF 3NPKA 5DW7A 3UCAA 3WCHA 2PS8A 2Q58A 3DYFA 2ONGA 3WJKA 3N5JF 4ZQ8A 3S4JA 1VG2A 5AHUB 5IM1A 5E8KA 4KPJA 3WEFA 1HM7A 4P0XA 5ILHA 4KPDA 2Z4XA 1VG6A 2Z78A 3KRAA 3N45F 3N3LF 4KVIA 4PVYF 2Z7IA 2Q9YA 5ILIA 4H5EF 4XQSF 3M00A 4RXDA 3LLWA 3EFQA 4K10A 3OYRA 4Q23A 1N22A 5ILYA 5IK6A 3W7FA 4DI5A 4NFJF 5JV2F 4OKZA 1HXGA 4LZCA 2F7MF 4P0WA 2E8XA 2J5CA 1WL1A 5DHIA 2E8VA 1YV5A 2ZCQA 4JVJF 3WCBA 2OA6A 3SDVA 4LPGF 3ICMA 2Z7HA 3M01A 3ZL6A 5DJRF 5ILZA 1HX9A 1RTRA 1EZFA 3KRFA 4RYPA 4NKEA 5IK0A 4LFGA 3LEEA 5AYPA 3RMGA 5DGNF 3LDWA 3P8RA 4LA5A 3ADZA 3WEHA 4DWGA 4LZ3A 3Q2ZA 5IL3A 4JYXA 3N5HF 4XQRF 4OKMA 2ZY1A 3VJBA 4OGUA 5ER8A 3N3DA 4LPHF 5DJPF 3IBAA 2H8OA 3ICZA 4KVDA 4WK5A 3WEJA 1UBYA 2DH4A 5JV0F 1WL3A 3LMDA 1N1ZA 3AQBB 3MAVA 5B01A 4LLSA 3Q1OA 3LG5A 1YHKA 4N1ZF 1RQJA 5DGMF 4NFIF 4P0VA 4F62A 2RAHA 5A0IA 2PS4A 5EROA 4JXNA 2AETA 3VJEA 3LVSA 3WE9A 3MZVA 3BNYA 5JUZF 3OACB 4LLTA 2EWGA 3WCGA 4N9UA 3NF2A 4KQUA 2F89F 4MC3A 2ZCOA 4EA2A 3Q30A 3DYHA 4QXSF 1PS1A 5IL8A 2FTZA 4JXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V66 A;  4MC8 A;  3SAE A;  5B0L A;  2E4O A;  2Z50 A;  5B0M A;  1YHM A;  4DWB A;  2E90 A;  5I1U A;  3ZMB A;  4KKM A;  4KVY A;  1V4I A;  3G4F A;  2I19 A;  3EGT A;  5IVG A;  5B0J A;  3N6K F;  3CKE A;  3WCE A;  3WCA A;  5A0J A;  2AZL A;  3KRC B;  1V4H A;  4PVX F;  4E9Z A;  2QIS A;  3WJO A;  1VG4 A;  3WSB A;  3AE0 A;  3VJ8 A;  3VJC A;  1WL2 A;  2F94 F;  2E91 A;  4JZX A;  3ACX A;  4QPF A;  1KIY A;  5ERM A;  3Q2Q A;  5C05 A;  3PYB A;  5KSX F;  1N1B A;  2AZJ A;  2Z4W A;  2PS5 A;  3N49 F;  3WCD A;  3V1V A;  2E8W A;  1YYT A;  5H9D A;  2E8T A;  3ASX A;  3P41 A;  3WCL A;  4MC0 A;  4F6X A;  5EAS A;  3LZ9 A;  4KQS A;  1WL0 A;  1N23 A;  1N21 A;  3PYA A;  2OPM A;  3ACW A;  1UBW A;  3LGZ B;  3OAC A;  3ZOU A;  1N20 A;  3VJ9 A;  2PS6 A;  4FP4 A;  3DYG A;  1YYR A;  5IKH A;  2P1C A;  3WCM A;  3LK5 A;  3TFP A;  3ACY A;  3AQC B;  5JV1 F;  2F92 F;  1YYU A;  3KRO B;  3P8L A;  4L2X F;  5ILJ A;  1HXC A;  4KFA A;  1KIZ A;  3LOM A;  4LA6 A;  1YQ7 A;  4EA1 A;  1YYQ A;  2ZEU A;  3KRC A;  3SDU A;  3P5P A;  2AEK A;  1WMW A;  4GAX A;  4GA3 A;  1DI1 A;  5B0I A;  5B03 A;  4E9U A;  4LIX A;  3IPI A;  5IMP A;  2E8U A;  5HN8 A;  2OGD A;  1ZW5 A;  3LGK A;  4XQT F;  5JA0 F;  1VG7 A;  2Z4V A;  2VF6 A;  4DXJ A;  3PDE A;  3RYE A;  5CG6 A;  3ICN A;  5IMI A;  3VJA A;  3KB9 A;  4LTV A;  4NKF A;  3WC9 A;  3LSN A;  5E8H A;  2AZK A;  3ICK A;  1WY0 A;  5AFX A;  2ONH A;  5AEL A;  4LUU A;  5HNA A;  5IK9 A;  4F6V A;  2F8Z F;  1UBV A;  3SDR A;  1HXA A;  4RXC A;  4NUA A;  2FOR A;  4LOB A;  3OAB B;  3NPR A;  3B7L A;  5IN8 A;  3KRP B;  3TS7 A;  4LZ0 A;  1FPS A;  2PS7 A;  3WCI A;  3N1W F;  3WCJ A;  4LTZ A;  2E92 A;  5B02 A;  1V4E A;  4GP1 A;  4NG6 A;  5ERN A;  3WSA A;  5DJV F;  1WKZ A;  5HN7 A;  3WEI A;  3N1V F;  5CG5 A;  3LJI A;  3KRO A;  3N46 F;  4HD1 A;  3WCF A;  3WCC A;  2Z52 A;  2AEL A;  3TFN A;  3SDQ A;  3RYW A;  3NRI A;  3ZMC A;  3VJD A;  3ID0 A;  2F8C F;  5DZ2 A;  4FJQ A;  5DGS F;  5EAU A;  2J1O A;  1VG3 A;  4OMH A;  5ILK A;  4KQ5 A;  4JZB A;  4LFE A;  4RXA A;  3CC9 A;  2E95 A;  4H5D F;  4GP2 A;  4KWD A;  3KBK A;  2Q9Z A;  3M02 A;  3P5R A;  2ZCR A;  4EA0 A;  1N24 A;  5DIQ F;  2ZEV A;  3TC1 A;  3N0G A;  4DZW A;  3V1X A;  3KRA B;  5IKA A;  3G4D A;  3RBM A;  3BNX A;  1YHL A;  3AQ0 A;  3TFV A;  1YJ4 A;  3S9V A;  1YYS A;  3QQV A;  3WEG A;  3OAB A;  3SDT A;  4E1E A;  3PKO A;  1JFG A;  3KRP A;  2Z4Z A;  2F9K F;  4RNQ A;  2Z4Y A;  3APZ A;  3M0G A;  5A0K A;  2ZCS A;  3QKC A;  4OMG A;  3WEK A;  4DEM F;  3CP6 A;  2O1O A;  5IMN A;  5EAT A;  1DGP A;  2OPN A;  5B0K A;  5ILD A;  4DHD A;  4UMJ A;  3ZCD A;  5DHK A;  4LXW A;  3M9U A;  1RQI A;  3N0F A;  4NFK F;  5HN9 A;  2E94 A;  3PH7 A;  1UBX A;  1V4J A;  4KVW A;  4RXE A;  3EZ3 A;  1HM4 A;  4KK2 A;  4KUX A;  2J1P A;  4LFV F;  3KRF B;  2Q80 A;  3WJN A;  1V4K A;  5B00 A;  1JFA A;  5E8L A;  2E93 A;  4H5C F;  3NPK A;  5DW7 A;  3UCA A;  3WCH A;  2PS8 A;  2Q58 A;  3DYF A;  2ONG A;  3WJK A;  3N5J F;  4ZQ8 A;  3S4J A;  1VG2 A;  5AHU B;  5IM1 A;  5E8K A;  4KPJ A;  3WEF A;  1HM7 A;  4P0X A;  5ILH A;  4KPD A;  2Z4X A;  1VG6 A;  2Z78 A;  3KRA A;  3N45 F;  3N3L F;  4KVI A;  4PVY F;  2Z7I A;  2Q9Y A;  5ILI A;  4H5E F;  4XQS F;  3M00 A;  4RXD A;  3LLW A;  3EFQ A;  4K10 A;  3OYR A;  4Q23 A;  1N22 A;  5ILY A;  5IK6 A;  3W7F A;  4DI5 A;  4NFJ F;  5JV2 F;  4OKZ A;  1HXG A;  4LZC A;  2F7M F;  4P0W A;  2E8X A;  2J5C A;  1WL1 A;  5DHI A;  2E8V A;  1YV5 A;  2ZCQ A;  4JVJ F;  3WCB A;  2OA6 A;  3SDV A;  4LPG F;  3ICM A;  2Z7H A;  3M01 A;  3ZL6 A;  5DJR F;  5ILZ A;  1HX9 A;  1RTR A;  1EZF A;  3KRF A;  4RYP A;  4NKE A;  5IK0 A;  4LFG A;  3LEE A;  5AYP A;  3RMG A;  5DGN F;  3LDW A;  3P8R A;  4LA5 A;  3ADZ A;  3WEH A;  4DWG A;  4LZ3 A;  3Q2Z A;  5IL3 A;  4JYX A;  3N5H F;  4XQR F;  4OKM A;  2ZY1 A;  3VJB A;  4OGU A;  5ER8 A;  3N3D A;  4LPH F;  5DJP F;  3IBA A;  2H8O A;  3ICZ A;  4KVD A;  4WK5 A;  3WEJ A;  1UBY A;  2DH4 A;  5JV0 F;  1WL3 A;  3LMD A;  1N1Z A;  3AQB B;  3MAV A;  5B01 A;  4LLS A;  3Q1O A;  3LG5 A;  1YHK A;  4N1Z F;  1RQJ A;  5DGM F;  4NFI F;  4P0V A;  4F62 A;  2RAH A;  5A0I A;  2PS4 A;  5ERO A;  4JXN A;  2AET A;  3VJE A;  3LVS A;  3WE9 A;  3MZV A;  3BNY A;  5JUZ F;  3OAC B;  4LLT A;  2EWG A;  3WCG A;  4N9U A;  3NF2 A;  4KQU A;  2F89 F;  4MC3 A;  2ZCO A;  4EA2 A;  3Q30 A;  3DYH A;  4QXS F;  1PS1 A;  5IL8 A;  2FTZ A;  4JXY A; 
#chains in the Genus database with same CATH topology
 3V66 A;  4MC8 A;  3SAE A;  5B0L A;  2E4O A;  2Z50 A;  5B0M A;  1YHM A;  4DWB A;  2E90 A;  5I1U A;  3ZMB A;  4KKM A;  4KVY A;  1V4I A;  3G4F A;  2I19 A;  3EGT A;  5IVG A;  5B0J A;  3N6K F;  3CKE A;  3WCE A;  3WCA A;  5A0J A;  2AZL A;  3KRC B;  1V4H A;  4PVX F;  4E9Z A;  2QIS A;  3WJO A;  1VG4 A;  3WSB A;  3AE0 A;  3VJ8 A;  3VJC A;  1WL2 A;  2F94 F;  2E91 A;  4JZX A;  3ACX A;  4QPF A;  1KIY A;  5ERM A;  3Q2Q A;  5C05 A;  3PYB A;  5KSX F;  1N1B A;  2AZJ A;  2Z4W A;  2PS5 A;  3N49 F;  3WCD A;  3V1V A;  2E8W A;  1YYT A;  5H9D A;  2E8T A;  3ASX A;  3P41 A;  3WCL A;  4MC0 A;  4F6X A;  5EAS A;  3LZ9 A;  4KQS A;  1WL0 A;  1N23 A;  1N21 A;  3PYA A;  2OPM A;  3ACW A;  1UBW A;  3LGZ B;  3OAC A;  3ZOU A;  1N20 A;  3VJ9 A;  2PS6 A;  4FP4 A;  3DYG A;  1YYR A;  5IKH A;  2P1C A;  3WCM A;  3LK5 A;  3TFP A;  3ACY A;  3AQC B;  5JV1 F;  2F92 F;  1YYU A;  3KRO B;  3P8L A;  4L2X F;  5ILJ A;  1HXC A;  4KFA A;  1KIZ A;  3LOM A;  4LA6 A;  1YQ7 A;  4EA1 A;  1YYQ A;  2ZEU A;  3KRC A;  3SDU A;  3P5P A;  2AEK A;  1WMW A;  4GAX A;  4GA3 A;  1DI1 A;  5B0I A;  5B03 A;  4E9U A;  4LIX A;  3IPI A;  5IMP A;  2E8U A;  5HN8 A;  2OGD A;  1ZW5 A;  3LGK A;  4XQT F;  5JA0 F;  1VG7 A;  2Z4V A;  2VF6 A;  4DXJ A;  3PDE A;  3RYE A;  5CG6 A;  3ICN A;  5IMI A;  3VJA A;  3KB9 A;  4LTV A;  4NKF A;  3WC9 A;  3LSN A;  5E8H A;  2AZK A;  3ICK A;  1WY0 A;  5AFX A;  2ONH A;  5AEL A;  4LUU A;  5HNA A;  5IK9 A;  4F6V A;  2F8Z F;  1UBV A;  3SDR A;  1HXA A;  4RXC A;  4NUA A;  2FOR A;  4LOB A;  3OAB B;  3NPR A;  3B7L A;  5IN8 A;  3KRP B;  3TS7 A;  4LZ0 A;  1FPS A;  2PS7 A;  3WCI A;  3N1W F;  3WCJ A;  4LTZ A;  2E92 A;  5B02 A;  1V4E A;  4GP1 A;  4NG6 A;  5ERN A;  3WSA A;  5DJV F;  1WKZ A;  5HN7 A;  3WEI A;  3N1V F;  5CG5 A;  3LJI A;  3KRO A;  3N46 F;  4HD1 A;  3WCF A;  3WCC A;  2Z52 A;  2AEL A;  3TFN A;  3SDQ A;  3RYW A;  3NRI A;  3ZMC A;  3VJD A;  3ID0 A;  2F8C F;  5DZ2 A;  4FJQ A;  5DGS F;  5EAU A;  2J1O A;  1VG3 A;  4OMH A;  5ILK A;  4KQ5 A;  4JZB A;  4LFE A;  4RXA A;  3CC9 A;  2E95 A;  4H5D F;  4GP2 A;  4KWD A;  3KBK A;  2Q9Z A;  3M02 A;  3P5R A;  2ZCR A;  4EA0 A;  1N24 A;  5DIQ F;  2ZEV A;  3TC1 A;  3N0G A;  4DZW A;  3V1X A;  3KRA B;  5IKA A;  3G4D A;  3RBM A;  3BNX A;  1YHL A;  3AQ0 A;  3TFV A;  1YJ4 A;  3S9V A;  1YYS A;  3QQV A;  3WEG A;  3OAB A;  3SDT A;  4E1E A;  3PKO A;  1JFG A;  3KRP A;  2Z4Z A;  2F9K F;  4RNQ A;  2Z4Y A;  3APZ A;  3M0G A;  5A0K A;  2ZCS A;  3QKC A;  4OMG A;  3WEK A;  4DEM F;  3CP6 A;  2O1O A;  5IMN A;  5EAT A;  1DGP A;  2OPN A;  5B0K A;  5ILD A;  4DHD A;  4UMJ A;  3ZCD A;  5DHK A;  4LXW A;  3M9U A;  1RQI A;  3N0F A;  4NFK F;  5HN9 A;  2E94 A;  3PH7 A;  1UBX A;  1V4J A;  4KVW A;  4RXE A;  3EZ3 A;  1HM4 A;  4KK2 A;  4KUX A;  2J1P A;  4LFV F;  3KRF B;  2Q80 A;  3WJN A;  1V4K A;  5B00 A;  1JFA A;  5E8L A;  2E93 A;  4H5C F;  3NPK A;  5DW7 A;  3UCA A;  3WCH A;  2PS8 A;  2Q58 A;  3DYF A;  2ONG A;  3WJK A;  3N5J F;  4ZQ8 A;  3S4J A;  1VG2 A;  5AHU B;  5IM1 A;  5E8K A;  4KPJ A;  3WEF A;  1HM7 A;  4P0X A;  5ILH A;  4KPD A;  2Z4X A;  1VG6 A;  2Z78 A;  3KRA A;  3N45 F;  3N3L F;  4KVI A;  4PVY F;  2Z7I A;  2Q9Y A;  5ILI A;  4H5E F;  4XQS F;  3M00 A;  4RXD A;  3LLW A;  3EFQ A;  4K10 A;  3OYR A;  4Q23 A;  1N22 A;  5ILY A;  5IK6 A;  3W7F A;  4DI5 A;  4NFJ F;  5JV2 F;  4OKZ A;  1HXG A;  4LZC A;  2F7M F;  4P0W A;  2E8X A;  2J5C A;  1WL1 A;  5DHI A;  2E8V A;  1YV5 A;  2ZCQ A;  4JVJ F;  3WCB A;  2OA6 A;  3SDV A;  4LPG F;  3ICM A;  2Z7H A;  3M01 A;  3ZL6 A;  5DJR F;  5ILZ A;  1HX9 A;  1RTR A;  1EZF A;  3KRF A;  4RYP A;  4NKE A;  5IK0 A;  4LFG A;  3LEE A;  5AYP A;  3RMG A;  5DGN F;  3LDW A;  3P8R A;  4LA5 A;  3ADZ A;  3WEH A;  4DWG A;  4LZ3 A;  3Q2Z A;  5IL3 A;  4JYX A;  3N5H F;  4XQR F;  4OKM A;  2ZY1 A;  3VJB A;  4OGU A;  5ER8 A;  3N3D A;  4LPH F;  5DJP F;  3IBA A;  2H8O A;  3ICZ A;  4KVD A;  4WK5 A;  3WEJ A;  1UBY A;  2DH4 A;  5JV0 F;  1WL3 A;  3LMD A;  1N1Z A;  3AQB B;  3MAV A;  5B01 A;  4LLS A;  3Q1O A;  3LG5 A;  1YHK A;  4N1Z F;  1RQJ A;  5DGM F;  4NFI F;  4P0V A;  4F62 A;  2RAH A;  5A0I A;  2PS4 A;  5ERO A;  4JXN A;  2AET A;  3VJE A;  3LVS A;  3WE9 A;  3MZV A;  3BNY A;  5JUZ F;  3OAC B;  4LLT A;  2EWG A;  3WCG A;  4N9U A;  3NF2 A;  4KQU A;  2F89 F;  4MC3 A;  2ZCO A;  4EA2 A;  3Q30 A;  3DYH A;  4QXS F;  1PS1 A;  5IL8 A;  2FTZ A;  4JXY A; 
#chains in the Genus database with same CATH homology
 3V66 A;  4MC8 A;  3SAE A;  5B0L A;  2E4O A;  2Z50 A;  5B0M A;  1YHM A;  4DWB A;  2E90 A;  5I1U A;  3ZMB A;  4KKM A;  4KVY A;  1V4I A;  3G4F A;  2I19 A;  3EGT A;  5IVG A;  5B0J A;  3N6K F;  3CKE A;  3WCE A;  3WCA A;  5A0J A;  2AZL A;  3KRC B;  1V4H A;  4PVX F;  4E9Z A;  2QIS A;  3WJO A;  1VG4 A;  3WSB A;  3AE0 A;  3VJ8 A;  3VJC A;  1WL2 A;  2F94 F;  2E91 A;  4JZX A;  3ACX A;  4QPF A;  1KIY A;  5ERM A;  3Q2Q A;  5C05 A;  3PYB A;  5KSX F;  1N1B A;  2AZJ A;  2Z4W A;  2PS5 A;  3N49 F;  3WCD A;  3V1V A;  2E8W A;  1YYT A;  5H9D A;  2E8T A;  3ASX A;  3P41 A;  3WCL A;  4MC0 A;  4F6X A;  5EAS A;  3LZ9 A;  4KQS A;  1WL0 A;  1N23 A;  1N21 A;  3PYA A;  2OPM A;  3ACW A;  1UBW A;  3LGZ B;  3OAC A;  3ZOU A;  1N20 A;  3VJ9 A;  2PS6 A;  4FP4 A;  3DYG A;  1YYR A;  5IKH A;  2P1C A;  3WCM A;  3LK5 A;  3TFP A;  3ACY A;  3AQC B;  5JV1 F;  2F92 F;  1YYU A;  3KRO B;  3P8L A;  4L2X F;  5ILJ A;  1HXC A;  4KFA A;  1KIZ A;  3LOM A;  4LA6 A;  1YQ7 A;  4EA1 A;  1YYQ A;  2ZEU A;  3KRC A;  3SDU A;  3P5P A;  2AEK A;  1WMW A;  4GAX A;  4GA3 A;  1DI1 A;  5B0I A;  5B03 A;  4E9U A;  4LIX A;  3IPI A;  5IMP A;  2E8U A;  5HN8 A;  2OGD A;  1ZW5 A;  3LGK A;  4XQT F;  5JA0 F;  1VG7 A;  2Z4V A;  2VF6 A;  4DXJ A;  3PDE A;  3RYE A;  5CG6 A;  3ICN A;  5IMI A;  3VJA A;  3KB9 A;  4LTV A;  4NKF A;  3WC9 A;  3LSN A;  5E8H A;  2AZK A;  3ICK A;  1WY0 A;  5AFX A;  2ONH A;  5AEL A;  4LUU A;  5HNA A;  5IK9 A;  4F6V A;  2F8Z F;  1UBV A;  3SDR A;  1HXA A;  4RXC A;  4NUA A;  2FOR A;  4LOB A;  3OAB B;  3NPR A;  3B7L A;  5IN8 A;  3KRP B;  3TS7 A;  4LZ0 A;  1FPS A;  2PS7 A;  3WCI A;  3N1W F;  3WCJ A;  4LTZ A;  2E92 A;  5B02 A;  1V4E A;  4GP1 A;  4NG6 A;  5ERN A;  3WSA A;  5DJV F;  1WKZ A;  5HN7 A;  3WEI A;  3N1V F;  5CG5 A;  3LJI A;  3KRO A;  3N46 F;  4HD1 A;  3WCF A;  3WCC A;  2Z52 A;  2AEL A;  3TFN A;  3SDQ A;  3RYW A;  3NRI A;  3ZMC A;  3VJD A;  3ID0 A;  2F8C F;  5DZ2 A;  4FJQ A;  5DGS F;  5EAU A;  2J1O A;  1VG3 A;  4OMH A;  5ILK A;  4KQ5 A;  4JZB A;  4LFE A;  4RXA A;  3CC9 A;  2E95 A;  4H5D F;  4GP2 A;  4KWD A;  3KBK A;  2Q9Z A;  3M02 A;  3P5R A;  2ZCR A;  4EA0 A;  1N24 A;  5DIQ F;  2ZEV A;  3TC1 A;  3N0G A;  4DZW A;  3V1X A;  3KRA B;  5IKA A;  3G4D A;  3RBM A;  3BNX A;  1YHL A;  3AQ0 A;  3TFV A;  1YJ4 A;  3S9V A;  1YYS A;  3QQV A;  3WEG A;  3OAB A;  3SDT A;  4E1E A;  3PKO A;  1JFG A;  3KRP A;  2Z4Z A;  2F9K F;  4RNQ A;  2Z4Y A;  3APZ A;  3M0G A;  5A0K A;  2ZCS A;  3QKC A;  4OMG A;  3WEK A;  4DEM F;  3CP6 A;  2O1O A;  5IMN A;  5EAT A;  1DGP A;  2OPN A;  5B0K A;  5ILD A;  4DHD A;  4UMJ A;  3ZCD A;  5DHK A;  4LXW A;  3M9U A;  1RQI A;  3N0F A;  4NFK F;  5HN9 A;  2E94 A;  3PH7 A;  1UBX A;  1V4J A;  4KVW A;  4RXE A;  3EZ3 A;  1HM4 A;  4KK2 A;  4KUX A;  2J1P A;  4LFV F;  3KRF B;  2Q80 A;  3WJN A;  1V4K A;  5B00 A;  1JFA A;  5E8L A;  2E93 A;  4H5C F;  3NPK A;  5DW7 A;  3UCA A;  3WCH A;  2PS8 A;  2Q58 A;  3DYF A;  2ONG A;  3WJK A;  3N5J F;  4ZQ8 A;  3S4J A;  1VG2 A;  5AHU B;  5IM1 A;  5E8K A;  4KPJ A;  3WEF A;  1HM7 A;  4P0X A;  5ILH A;  4KPD A;  2Z4X A;  1VG6 A;  2Z78 A;  3KRA A;  3N45 F;  3N3L F;  4KVI A;  4PVY F;  2Z7I A;  2Q9Y A;  5ILI A;  4H5E F;  4XQS F;  3M00 A;  4RXD A;  3LLW A;  3EFQ A;  4K10 A;  3OYR A;  4Q23 A;  1N22 A;  5ILY A;  5IK6 A;  3W7F A;  4DI5 A;  4NFJ F;  5JV2 F;  4OKZ A;  1HXG A;  4LZC A;  2F7M F;  4P0W A;  2E8X A;  2J5C A;  1WL1 A;  5DHI A;  2E8V A;  1YV5 A;  2ZCQ A;  4JVJ F;  3WCB A;  2OA6 A;  3SDV A;  4LPG F;  3ICM A;  2Z7H A;  3M01 A;  3ZL6 A;  5DJR F;  5ILZ A;  1HX9 A;  1RTR A;  1EZF A;  3KRF A;  4RYP A;  4NKE A;  5IK0 A;  4LFG A;  3LEE A;  5AYP A;  3RMG A;  5DGN F;  3LDW A;  3P8R A;  4LA5 A;  3ADZ A;  3WEH A;  4DWG A;  4LZ3 A;  3Q2Z A;  5IL3 A;  4JYX A;  3N5H F;  4XQR F;  4OKM A;  2ZY1 A;  3VJB A;  4OGU A;  5ER8 A;  3N3D A;  4LPH F;  5DJP F;  3IBA A;  2H8O A;  3ICZ A;  4KVD A;  4WK5 A;  3WEJ A;  1UBY A;  2DH4 A;  5JV0 F;  1WL3 A;  3LMD A;  1N1Z A;  3AQB B;  3MAV A;  5B01 A;  4LLS A;  3Q1O A;  3LG5 A;  1YHK A;  4N1Z F;  1RQJ A;  5DGM F;  4NFI F;  4P0V A;  4F62 A;  2RAH A;  5A0I A;  2PS4 A;  5ERO A;  4JXN A;  2AET A;  3VJE A;  3LVS A;  3WE9 A;  3MZV A;  3BNY A;  5JUZ F;  3OAC B;  4LLT A;  2EWG A;  3WCG A;  4N9U A;  3NF2 A;  4KQU A;  2F89 F;  4MC3 A;  2ZCO A;  4EA2 A;  3Q30 A;  3DYH A;  4QXS F;  1PS1 A;  5IL8 A;  2FTZ A;  4JXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...