4RXDA

T. brucei farnesyl diphosphate synthase complexed with risedronate
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
365
structure length
355
Chain Sequence
MQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Farnesyl pyrophosphate synthase
publication title Farnesyl diphosphate synthase inhibitors with unique ligand-binding geometries.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 152
structure length 355
sequence length 365
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4rxdA00
4WK5A 4UMJA 3ZOUA 3IBAA 3WEKA 2O1OA 3KRFB 4RNQA 5B0IA 1N22A 5IL8A 4LLTA 3ICKA 3WEFA 3P5PA 3V1VA 3Q2QA 2Z78A 3ASXA 3ID0A 4JZBA 3N49F 4GAXA 2E93A 5ER8A 3ICNA 3UCAA 3OYRA 4NKFA 1DI1A 2Z4ZA 4RXEA 5B0JA 5E8HA 3ICZA 5JUZF 2E90A 3KRFA 3SDUA 5DJRF 3VJCA 4E1EA 3CP6A 3KRCB 4H5DF 5IMIA 3LGKA 1HXAA 5IKAA 1YHMA 2Q9ZA 3LOMA 1RQJA 5DHIA 5A0KA 1UBXA 5DJPF 4OKZA 4DI5A 1YYSA 3KRCA 4LZCA 3ZMCA 2FTZA 2RAHA 4KQUA 3RBMA 3WCFA 1HXCA 3M00A 3QQVA 2QISA 2H8OA 4LA5A 1V4EA 3APZA 5B03A 2E8VA 3N3LF 4HD1A 3VJEA 3AE0A 4FJQA 5E8KA 3EFQA 2ZCSA 2PS5A 5ILZA 1EZFA 2J1PA 5EROA 4ZQ8A 4LFEA 1WY0A 1UBVA 4LPGF 3WEIA 3SDTA 2ZCQA 1V4IA 5ILYA 2F9KF 5B0KA 5JV1F 4LIXA 4JXNA 3LVSA 3NRIA 4KVIA 3M02A 1YYQA 4LTVA 1HXGA 3Q1OA 4Q23A 3WCCA 3KB9A 4MC8A 5DZ2A 3N1WF 3DYGA 5AYPA 3WEHA 5I1UA 4KVWA 1VG2A 4KPJA 4KPDA 3N0GA 2F92F 4JZXA 5AHUB 4NKEA 5A0JA 3P8RA 3WJKA 3DYFA 4OKMA 2P1CA 2Z50A 1KIYA 1VG4A 4KQ5A 1UBYA 5CG6A 4RXDA 5C05A 4JYXA 3LZ9A 1YQ7A 4OMGA 3N5HF 1YHKA 3N1VF 3WEGA 1V4JA 5JA0F 3KBKA 5DGNF 4RYPA 5IM1A 2E4OA 3AQ0A 3TFVA 4F6XA 4NFIF 3NF2A 3N0FA 1UBWA 5AELA 2PS8A 3KRAB 2AZJA 2Q58A 3WC9A 3AQBB 2AZLA 4KWDA 1WKZA 5IK6A 1YYUA 3ADZA 3M01A 4KVDA 3ZMBA 3P5RA 5ILJA 1N1ZA 4LFVF 3KRAA 1VG6A 3TC1A 2ZCRA 2F94F 3LDWA 4JXYA 5HNAA 2E92A 3VJ9A 2E8TA 3WCIA 3Q2ZA 3WCDA 4LLSA 4E9ZA 1V4HA 3SDRA 4RXAA 1N23A 2AEKA 4DZWA 4XQSF 3LG5A 3WEJA 4H5EF 2Q9YA 3S4JA 4FP4A 4LOBA 5B01A 2E91A 3M9UA 4RXCA 3NPKA 2ONHA 5IK9A 3WCEA 2PS4A 3LMDA 1FPSA 2F7MF 5B0LA 4GA3A 4F62A 3LEEA 2AELA 1KIZA 5EAUA 2Z52A 3CC9A 3N6KF 1V4KA 4OMHA 3LSNA 4F6VA 5EATA 1RTRA 5DW7A 3WCAA 3LJIA 2E8XA 2Z7IA 5IMNA 5IMPA 3WCLA 1HM4A 2ZEUA 3PDEA 2EWGA 5IK0A 4H5CF 1WMWA 2F8ZF 2OGDA 3G4DA 3N3DA 3WSBA 1VG7A 1YYTA 3AQCB 3KROB 3WJNA 2E8UA 4N9UA 3OACA 5IL3A 5ERNA 4KVYA 5HN9A 2F8CF 1WL1A 3WE9A 3BNYA 5B00A 5HN7A 3DYHA 3PYAA 5JV0F 3KRPA 3MZVA 1WL3A 3KROA 2I19A 5B02A 1YYRA 1JFAA 1HX9A 4KK2A 3M0GA 3ZL6A 4LZ3A 2E8WA 4LXWA 2Z4VA 5ILIA 2OA6A 5ILKA 4OGUA 4MC3A 1WL0A 3P41A 4XQRF 2Z4WA 3WCJA 4EA1A 2Z4XA 2J1OA 4GP2A 5DGMF 5DGSF 3RMGA 5H9DA 3OABA 4PVYF 3IPIA 1PS1A 3EGTA 3PYBA 3G4FA 4NFJF 4NUAA 2E95A 3SDQA 3WCBA 5IN8A 2AZKA 2Q80A 5CG5A 4DWBA 4K10A 3TFPA 5A0IA 3ACYA 3LK5A 3PH7A 4KFAA 4EA2A 3S9VA 5B0MA 5EASA 3N46F 1DGPA 3WCGA 4LFGA 4EA0A 2DH4A 3QKCA 5DHKA 5ILHA 4N1ZF 4JVJF 3LGZB 3V66A 3MAVA 2PS7A 3ACXA 1YJ4A 1YHLA 2ONGA 5E8LA 5HN8A 5KSXF 3LLWA 3TS7A 4QPFA 1N21A 2F89F 4MC0A 2VF6A 1WL2A 3SAEA 5IVGA 3VJ8A 3WJOA 4DWGA 5AFXA 5DJVF 3EZ3A 2OPMA 3SDVA 3N45F 3OACB 4LPHF 3Q30A 1N24A 3ACWA 3N5JF 4KQSA 3NPRA 2J5CA 3WCMA 2ZEVA 2Z7HA 2ZCOA 1JFGA 3KRPB 4NG6A 3CKEA 4LA6A 1HM7A 4DHDA 3TFNA 4P0VA 4P0XA 4KUXA 4DEMF 3B7LA 4XQTF 1N20A 1N1BA 4LTZA 4DXJA 4P0WA 5JV2F 1YV5A 4PVXF 4QXSF 1ZW5A 5DIQF 4GP1A 4L2XF 4LZ0A 3W7FA 2E94A 1VG3A 3RYWA 4E9UA 3WCHA 3PKOA 5ILDA 4NFKF 4LUUA 3VJDA 3BNXA 2AETA 5IKHA 2OPNA 3VJBA 3ICMA 4KKMA 3P8LA 2FORA 3RYEA 2PS6A 3VJAA 5ERMA 2ZY1A 3WSAA 3OABB 2Z4YA 1RQIA 3V1XA 3ZCDA
chains in the Genus database with same CATH superfamily
4WK5A 4UMJA 3ZOUA 3IBAA 3WEKA 2O1OA 3KRFB 4RNQA 5B0IA 1N22A 5IL8A 4LLTA 3ICKA 3WEFA 3P5PA 3V1VA 3Q2QA 2Z78A 3ASXA 3ID0A 4JZBA 3N49F 4GAXA 2E93A 5ER8A 3ICNA 3UCAA 3OYRA 4NKFA 1DI1A 2Z4ZA 4RXEA 5B0JA 5E8HA 3ICZA 5JUZF 2E90A 3KRFA 3SDUA 5DJRF 3VJCA 4E1EA 3CP6A 3KRCB 4H5DF 5IMIA 3LGKA 1HXAA 5IKAA 1YHMA 2Q9ZA 3LOMA 1RQJA 5DHIA 5A0KA 1UBXA 5DJPF 4OKZA 4DI5A 1YYSA 3KRCA 4LZCA 3ZMCA 2FTZA 2RAHA 4KQUA 3RBMA 3WCFA 1HXCA 3M00A 3QQVA 2QISA 2H8OA 4LA5A 1V4EA 3APZA 5B03A 2E8VA 3N3LF 4HD1A 3VJEA 3AE0A 4FJQA 5E8KA 3EFQA 2ZCSA 2PS5A 5ILZA 1EZFA 2J1PA 5EROA 4ZQ8A 4LFEA 1WY0A 1UBVA 4LPGF 3WEIA 3SDTA 2ZCQA 1V4IA 5ILYA 2F9KF 5B0KA 5JV1F 4LIXA 4JXNA 3LVSA 3NRIA 4KVIA 3M02A 1YYQA 4LTVA 1HXGA 3Q1OA 4Q23A 3WCCA 3KB9A 4MC8A 5DZ2A 3N1WF 3DYGA 5AYPA 3WEHA 5I1UA 4KVWA 1VG2A 4KPJA 4KPDA 3N0GA 2F92F 4JZXA 5AHUB 4NKEA 5A0JA 3P8RA 3WJKA 3DYFA 4OKMA 2P1CA 2Z50A 1KIYA 1VG4A 4KQ5A 1UBYA 5CG6A 4RXDA 5C05A 4JYXA 3LZ9A 1YQ7A 4OMGA 3N5HF 1YHKA 3N1VF 3WEGA 1V4JA 5JA0F 3KBKA 5DGNF 4RYPA 5IM1A 2E4OA 3AQ0A 3TFVA 4F6XA 4NFIF 3NF2A 3N0FA 1UBWA 5AELA 2PS8A 3KRAB 2AZJA 2Q58A 3WC9A 3AQBB 2AZLA 4KWDA 1WKZA 5IK6A 1YYUA 3ADZA 3M01A 4KVDA 3ZMBA 3P5RA 5ILJA 1N1ZA 4LFVF 3KRAA 1VG6A 3TC1A 2ZCRA 2F94F 3LDWA 4JXYA 5HNAA 2E92A 3VJ9A 2E8TA 3WCIA 3Q2ZA 3WCDA 4LLSA 4E9ZA 1V4HA 3SDRA 4RXAA 1N23A 2AEKA 4DZWA 4XQSF 3LG5A 3WEJA 4H5EF 2Q9YA 3S4JA 4FP4A 4LOBA 5B01A 2E91A 3M9UA 4RXCA 3NPKA 2ONHA 5IK9A 3WCEA 2PS4A 3LMDA 1FPSA 2F7MF 5B0LA 4GA3A 4F62A 3LEEA 2AELA 1KIZA 5EAUA 2Z52A 3CC9A 3N6KF 1V4KA 4OMHA 3LSNA 4F6VA 5EATA 1RTRA 5DW7A 3WCAA 3LJIA 2E8XA 2Z7IA 5IMNA 5IMPA 3WCLA 1HM4A 2ZEUA 3PDEA 2EWGA 5IK0A 4H5CF 1WMWA 2F8ZF 2OGDA 3G4DA 3N3DA 3WSBA 1VG7A 1YYTA 3AQCB 3KROB 3WJNA 2E8UA 4N9UA 3OACA 5IL3A 5ERNA 4KVYA 5HN9A 2F8CF 1WL1A 3WE9A 3BNYA 5B00A 5HN7A 3DYHA 3PYAA 5JV0F 3KRPA 3MZVA 1WL3A 3KROA 2I19A 5B02A 1YYRA 1JFAA 1HX9A 4KK2A 3M0GA 3ZL6A 4LZ3A 2E8WA 4LXWA 2Z4VA 5ILIA 2OA6A 5ILKA 4OGUA 4MC3A 1WL0A 3P41A 4XQRF 2Z4WA 3WCJA 4EA1A 2Z4XA 2J1OA 4GP2A 5DGMF 5DGSF 3RMGA 5H9DA 3OABA 4PVYF 3IPIA 1PS1A 3EGTA 3PYBA 3G4FA 4NFJF 4NUAA 2E95A 3SDQA 3WCBA 5IN8A 2AZKA 2Q80A 5CG5A 4DWBA 4K10A 3TFPA 5A0IA 3ACYA 3LK5A 3PH7A 4KFAA 4EA2A 3S9VA 5B0MA 5EASA 3N46F 1DGPA 3WCGA 4LFGA 4EA0A 2DH4A 3QKCA 5DHKA 5ILHA 4N1ZF 4JVJF 3LGZB 3V66A 3MAVA 2PS7A 3ACXA 1YJ4A 1YHLA 2ONGA 5E8LA 5HN8A 5KSXF 3LLWA 3TS7A 4QPFA 1N21A 2F89F 4MC0A 2VF6A 1WL2A 3SAEA 5IVGA 3VJ8A 3WJOA 4DWGA 5AFXA 5DJVF 3EZ3A 2OPMA 3SDVA 3N45F 3OACB 4LPHF 3Q30A 1N24A 3ACWA 3N5JF 4KQSA 3NPRA 2J5CA 3WCMA 2ZEVA 2Z7HA 2ZCOA 1JFGA 3KRPB 4NG6A 3CKEA 4LA6A 1HM7A 4DHDA 3TFNA 4P0VA 4P0XA 4KUXA 4DEMF 3B7LA 4XQTF 1N20A 1N1BA 4LTZA 4DXJA 4P0WA 5JV2F 1YV5A 4PVXF 4QXSF 1ZW5A 5DIQF 4GP1A 4L2XF 4LZ0A 3W7FA 2E94A 1VG3A 3RYWA 4E9UA 3WCHA 3PKOA 5ILDA 4NFKF 4LUUA 3VJDA 3BNXA 2AETA 5IKHA 2OPNA 3VJBA 3ICMA 4KKMA 3P8LA 2FORA 3RYEA 2PS6A 3VJAA 5ERMA 2ZY1A 3WSAA 3OABB 2Z4YA 1RQIA 3V1XA 3ZCDA
chains in the Genus database with same CATH topology
4WK5A 4UMJA 3ZOUA 3IBAA 3WEKA 2O1OA 3KRFB 4RNQA 5B0IA 1N22A 5IL8A 4LLTA 3ICKA 3WEFA 3P5PA 3V1VA 3Q2QA 2Z78A 3ASXA 3ID0A 4JZBA 3N49F 4GAXA 2E93A 5ER8A 3ICNA 3UCAA 3OYRA 4NKFA 1DI1A 2Z4ZA 4RXEA 5B0JA 5E8HA 3ICZA 5JUZF 2E90A 3KRFA 3SDUA 5DJRF 3VJCA 4E1EA 3CP6A 3KRCB 4H5DF 5IMIA 3LGKA 1HXAA 5IKAA 1YHMA 2Q9ZA 3LOMA 1RQJA 5DHIA 5A0KA 1UBXA 5DJPF 4OKZA 4DI5A 1YYSA 3KRCA 4LZCA 3ZMCA 2FTZA 2RAHA 4KQUA 3RBMA 3WCFA 1HXCA 3M00A 3QQVA 2QISA 2H8OA 4LA5A 1V4EA 3APZA 5B03A 2E8VA 3N3LF 4HD1A 3VJEA 3AE0A 4FJQA 5E8KA 3EFQA 2ZCSA 2PS5A 5ILZA 1EZFA 2J1PA 5EROA 4ZQ8A 4LFEA 1WY0A 1UBVA 4LPGF 3WEIA 3SDTA 2ZCQA 1V4IA 5ILYA 2F9KF 5B0KA 5JV1F 4LIXA 4JXNA 3LVSA 3NRIA 4KVIA 3M02A 1YYQA 4LTVA 1HXGA 3Q1OA 4Q23A 3WCCA 3KB9A 4MC8A 5DZ2A 3N1WF 3DYGA 5AYPA 3WEHA 5I1UA 4KVWA 1VG2A 4KPJA 4KPDA 3N0GA 2F92F 4JZXA 5AHUB 4NKEA 5A0JA 3P8RA 3WJKA 3DYFA 4OKMA 2P1CA 2Z50A 1KIYA 1VG4A 4KQ5A 1UBYA 5CG6A 4RXDA 5C05A 4JYXA 3LZ9A 1YQ7A 4OMGA 3N5HF 1YHKA 3N1VF 3WEGA 1V4JA 5JA0F 3KBKA 5DGNF 4RYPA 5IM1A 2E4OA 3AQ0A 3TFVA 4F6XA 4NFIF 3NF2A 3N0FA 1UBWA 5AELA 2PS8A 3KRAB 2AZJA 2Q58A 3WC9A 3AQBB 2AZLA 4KWDA 1WKZA 5IK6A 1YYUA 3ADZA 3M01A 4KVDA 3ZMBA 3P5RA 5ILJA 1N1ZA 4LFVF 3KRAA 1VG6A 3TC1A 2ZCRA 2F94F 3LDWA 4JXYA 5HNAA 2E92A 3VJ9A 2E8TA 3WCIA 3Q2ZA 3WCDA 4LLSA 4E9ZA 1V4HA 3SDRA 4RXAA 1N23A 2AEKA 4DZWA 4XQSF 3LG5A 3WEJA 4H5EF 2Q9YA 3S4JA 4FP4A 4LOBA 5B01A 2E91A 3M9UA 4RXCA 3NPKA 2ONHA 5IK9A 3WCEA 2PS4A 3LMDA 1FPSA 2F7MF 5B0LA 4GA3A 4F62A 3LEEA 2AELA 1KIZA 5EAUA 2Z52A 3CC9A 3N6KF 1V4KA 4OMHA 3LSNA 4F6VA 5EATA 1RTRA 5DW7A 3WCAA 3LJIA 2E8XA 2Z7IA 5IMNA 5IMPA 3WCLA 1HM4A 2ZEUA 3PDEA 2EWGA 5IK0A 4H5CF 1WMWA 2F8ZF 2OGDA 3G4DA 3N3DA 3WSBA 1VG7A 1YYTA 3AQCB 3KROB 3WJNA 2E8UA 4N9UA 3OACA 5IL3A 5ERNA 4KVYA 5HN9A 2F8CF 1WL1A 3WE9A 3BNYA 5B00A 5HN7A 3DYHA 3PYAA 5JV0F 3KRPA 3MZVA 1WL3A 3KROA 2I19A 5B02A 1YYRA 1JFAA 1HX9A 4KK2A 3M0GA 3ZL6A 4LZ3A 2E8WA 4LXWA 2Z4VA 5ILIA 2OA6A 5ILKA 4OGUA 4MC3A 1WL0A 3P41A 4XQRF 2Z4WA 3WCJA 4EA1A 2Z4XA 2J1OA 4GP2A 5DGMF 5DGSF 3RMGA 5H9DA 3OABA 4PVYF 3IPIA 1PS1A 3EGTA 3PYBA 3G4FA 4NFJF 4NUAA 2E95A 3SDQA 3WCBA 5IN8A 2AZKA 2Q80A 5CG5A 4DWBA 4K10A 3TFPA 5A0IA 3ACYA 3LK5A 3PH7A 4KFAA 4EA2A 3S9VA 5B0MA 5EASA 3N46F 1DGPA 3WCGA 4LFGA 4EA0A 2DH4A 3QKCA 5DHKA 5ILHA 4N1ZF 4JVJF 3LGZB 3V66A 3MAVA 2PS7A 3ACXA 1YJ4A 1YHLA 2ONGA 5E8LA 5HN8A 5KSXF 3LLWA 3TS7A 4QPFA 1N21A 2F89F 4MC0A 2VF6A 1WL2A 3SAEA 5IVGA 3VJ8A 3WJOA 4DWGA 5AFXA 5DJVF 3EZ3A 2OPMA 3SDVA 3N45F 3OACB 4LPHF 3Q30A 1N24A 3ACWA 3N5JF 4KQSA 3NPRA 2J5CA 3WCMA 2ZEVA 2Z7HA 2ZCOA 1JFGA 3KRPB 4NG6A 3CKEA 4LA6A 1HM7A 4DHDA 3TFNA 4P0VA 4P0XA 4KUXA 4DEMF 3B7LA 4XQTF 1N20A 1N1BA 4LTZA 4DXJA 4P0WA 5JV2F 1YV5A 4PVXF 4QXSF 1ZW5A 5DIQF 4GP1A 4L2XF 4LZ0A 3W7FA 2E94A 1VG3A 3RYWA 4E9UA 3WCHA 3PKOA 5ILDA 4NFKF 4LUUA 3VJDA 3BNXA 2AETA 5IKHA 2OPNA 3VJBA 3ICMA 4KKMA 3P8LA 2FORA 3RYEA 2PS6A 3VJAA 5ERMA 2ZY1A 3WSAA 3OABB 2Z4YA 1RQIA 3V1XA 3ZCDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WK5 A;  4UMJ A;  3ZOU A;  3IBA A;  3WEK A;  2O1O A;  3KRF B;  4RNQ A;  5B0I A;  1N22 A;  5IL8 A;  4LLT A;  3ICK A;  3WEF A;  3P5P A;  3V1V A;  3Q2Q A;  2Z78 A;  3ASX A;  3ID0 A;  4JZB A;  3N49 F;  4GAX A;  2E93 A;  5ER8 A;  3ICN A;  3UCA A;  3OYR A;  4NKF A;  1DI1 A;  2Z4Z A;  4RXE A;  5B0J A;  5E8H A;  3ICZ A;  5JUZ F;  2E90 A;  3KRF A;  3SDU A;  5DJR F;  3VJC A;  4E1E A;  3CP6 A;  3KRC B;  4H5D F;  5IMI A;  3LGK A;  1HXA A;  5IKA A;  1YHM A;  2Q9Z A;  3LOM A;  1RQJ A;  5DHI A;  5A0K A;  1UBX A;  5DJP F;  4OKZ A;  4DI5 A;  1YYS A;  3KRC A;  4LZC A;  3ZMC A;  2FTZ A;  2RAH A;  4KQU A;  3RBM A;  3WCF A;  1HXC A;  3M00 A;  3QQV A;  2QIS A;  2H8O A;  4LA5 A;  1V4E A;  3APZ A;  5B03 A;  2E8V A;  3N3L F;  4HD1 A;  3VJE A;  3AE0 A;  4FJQ A;  5E8K A;  3EFQ A;  2ZCS A;  2PS5 A;  5ILZ A;  1EZF A;  2J1P A;  5ERO A;  4ZQ8 A;  4LFE A;  1WY0 A;  1UBV A;  4LPG F;  3WEI A;  3SDT A;  2ZCQ A;  1V4I A;  5ILY A;  2F9K F;  5B0K A;  5JV1 F;  4LIX A;  4JXN A;  3LVS A;  3NRI A;  4KVI A;  3M02 A;  1YYQ A;  4LTV A;  1HXG A;  3Q1O A;  4Q23 A;  3WCC A;  3KB9 A;  4MC8 A;  5DZ2 A;  3N1W F;  3DYG A;  5AYP A;  3WEH A;  5I1U A;  4KVW A;  1VG2 A;  4KPJ A;  4KPD A;  3N0G A;  2F92 F;  4JZX A;  5AHU B;  4NKE A;  5A0J A;  3P8R A;  3WJK A;  3DYF A;  4OKM A;  2P1C A;  2Z50 A;  1KIY A;  1VG4 A;  4KQ5 A;  1UBY A;  5CG6 A;  4RXD A;  5C05 A;  4JYX A;  3LZ9 A;  1YQ7 A;  4OMG A;  3N5H F;  1YHK A;  3N1V F;  3WEG A;  1V4J A;  5JA0 F;  3KBK A;  5DGN F;  4RYP A;  5IM1 A;  2E4O A;  3AQ0 A;  3TFV A;  4F6X A;  4NFI F;  3NF2 A;  3N0F A;  1UBW A;  5AEL A;  2PS8 A;  3KRA B;  2AZJ A;  2Q58 A;  3WC9 A;  3AQB B;  2AZL A;  4KWD A;  1WKZ A;  5IK6 A;  1YYU A;  3ADZ A;  3M01 A;  4KVD A;  3ZMB A;  3P5R A;  5ILJ A;  1N1Z A;  4LFV F;  3KRA A;  1VG6 A;  3TC1 A;  2ZCR A;  2F94 F;  3LDW A;  4JXY A;  5HNA A;  2E92 A;  3VJ9 A;  2E8T A;  3WCI A;  3Q2Z A;  3WCD A;  4LLS A;  4E9Z A;  1V4H A;  3SDR A;  4RXA A;  1N23 A;  2AEK A;  4DZW A;  4XQS F;  3LG5 A;  3WEJ A;  4H5E F;  2Q9Y A;  3S4J A;  4FP4 A;  4LOB A;  5B01 A;  2E91 A;  3M9U A;  4RXC A;  3NPK A;  2ONH A;  5IK9 A;  3WCE A;  2PS4 A;  3LMD A;  1FPS A;  2F7M F;  5B0L A;  4GA3 A;  4F62 A;  3LEE A;  2AEL A;  1KIZ A;  5EAU A;  2Z52 A;  3CC9 A;  3N6K F;  1V4K A;  4OMH A;  3LSN A;  4F6V A;  5EAT A;  1RTR A;  5DW7 A;  3WCA A;  3LJI A;  2E8X A;  2Z7I A;  5IMN A;  5IMP A;  3WCL A;  1HM4 A;  2ZEU A;  3PDE A;  2EWG A;  5IK0 A;  4H5C F;  1WMW A;  2F8Z F;  2OGD A;  3G4D A;  3N3D A;  3WSB A;  1VG7 A;  1YYT A;  3AQC B;  3KRO B;  3WJN A;  2E8U A;  4N9U A;  3OAC A;  5IL3 A;  5ERN A;  4KVY A;  5HN9 A;  2F8C F;  1WL1 A;  3WE9 A;  3BNY A;  5B00 A;  5HN7 A;  3DYH A;  3PYA A;  5JV0 F;  3KRP A;  3MZV A;  1WL3 A;  3KRO A;  2I19 A;  5B02 A;  1YYR A;  1JFA A;  1HX9 A;  4KK2 A;  3M0G A;  3ZL6 A;  4LZ3 A;  2E8W A;  4LXW A;  2Z4V A;  5ILI A;  2OA6 A;  5ILK A;  4OGU A;  4MC3 A;  1WL0 A;  3P41 A;  4XQR F;  2Z4W A;  3WCJ A;  4EA1 A;  2Z4X A;  2J1O A;  4GP2 A;  5DGM F;  5DGS F;  3RMG A;  5H9D A;  3OAB A;  4PVY F;  3IPI A;  1PS1 A;  3EGT A;  3PYB A;  3G4F A;  4NFJ F;  4NUA A;  2E95 A;  3SDQ A;  3WCB A;  5IN8 A;  2AZK A;  2Q80 A;  5CG5 A;  4DWB A;  4K10 A;  3TFP A;  5A0I A;  3ACY A;  3LK5 A;  3PH7 A;  4KFA A;  4EA2 A;  3S9V A;  5B0M A;  5EAS A;  3N46 F;  1DGP A;  3WCG A;  4LFG A;  4EA0 A;  2DH4 A;  3QKC A;  5DHK A;  5ILH A;  4N1Z F;  4JVJ F;  3LGZ B;  3V66 A;  3MAV A;  2PS7 A;  3ACX A;  1YJ4 A;  1YHL A;  2ONG A;  5E8L A;  5HN8 A;  5KSX F;  3LLW A;  3TS7 A;  4QPF A;  1N21 A;  2F89 F;  4MC0 A;  2VF6 A;  1WL2 A;  3SAE A;  5IVG A;  3VJ8 A;  3WJO A;  4DWG A;  5AFX A;  5DJV F;  3EZ3 A;  2OPM A;  3SDV A;  3N45 F;  3OAC B;  4LPH F;  3Q30 A;  1N24 A;  3ACW A;  3N5J F;  4KQS A;  3NPR A;  2J5C A;  3WCM A;  2ZEV A;  2Z7H A;  2ZCO A;  1JFG A;  3KRP B;  4NG6 A;  3CKE A;  4LA6 A;  1HM7 A;  4DHD A;  3TFN A;  4P0V A;  4P0X A;  4KUX A;  4DEM F;  3B7L A;  4XQT F;  1N20 A;  1N1B A;  4LTZ A;  4DXJ A;  4P0W A;  5JV2 F;  1YV5 A;  4PVX F;  4QXS F;  1ZW5 A;  5DIQ F;  4GP1 A;  4L2X F;  4LZ0 A;  3W7F A;  2E94 A;  1VG3 A;  3RYW A;  4E9U A;  3WCH A;  3PKO A;  5ILD A;  4NFK F;  4LUU A;  3VJD A;  3BNX A;  2AET A;  5IKH A;  2OPN A;  3VJB A;  3ICM A;  4KKM A;  3P8L A;  2FOR A;  3RYE A;  2PS6 A;  3VJA A;  5ERM A;  2ZY1 A;  3WSA A;  3OAB B;  2Z4Y A;  1RQI A;  3V1X A;  3ZCD A; 
#chains in the Genus database with same CATH topology
 4WK5 A;  4UMJ A;  3ZOU A;  3IBA A;  3WEK A;  2O1O A;  3KRF B;  4RNQ A;  5B0I A;  1N22 A;  5IL8 A;  4LLT A;  3ICK A;  3WEF A;  3P5P A;  3V1V A;  3Q2Q A;  2Z78 A;  3ASX A;  3ID0 A;  4JZB A;  3N49 F;  4GAX A;  2E93 A;  5ER8 A;  3ICN A;  3UCA A;  3OYR A;  4NKF A;  1DI1 A;  2Z4Z A;  4RXE A;  5B0J A;  5E8H A;  3ICZ A;  5JUZ F;  2E90 A;  3KRF A;  3SDU A;  5DJR F;  3VJC A;  4E1E A;  3CP6 A;  3KRC B;  4H5D F;  5IMI A;  3LGK A;  1HXA A;  5IKA A;  1YHM A;  2Q9Z A;  3LOM A;  1RQJ A;  5DHI A;  5A0K A;  1UBX A;  5DJP F;  4OKZ A;  4DI5 A;  1YYS A;  3KRC A;  4LZC A;  3ZMC A;  2FTZ A;  2RAH A;  4KQU A;  3RBM A;  3WCF A;  1HXC A;  3M00 A;  3QQV A;  2QIS A;  2H8O A;  4LA5 A;  1V4E A;  3APZ A;  5B03 A;  2E8V A;  3N3L F;  4HD1 A;  3VJE A;  3AE0 A;  4FJQ A;  5E8K A;  3EFQ A;  2ZCS A;  2PS5 A;  5ILZ A;  1EZF A;  2J1P A;  5ERO A;  4ZQ8 A;  4LFE A;  1WY0 A;  1UBV A;  4LPG F;  3WEI A;  3SDT A;  2ZCQ A;  1V4I A;  5ILY A;  2F9K F;  5B0K A;  5JV1 F;  4LIX A;  4JXN A;  3LVS A;  3NRI A;  4KVI A;  3M02 A;  1YYQ A;  4LTV A;  1HXG A;  3Q1O A;  4Q23 A;  3WCC A;  3KB9 A;  4MC8 A;  5DZ2 A;  3N1W F;  3DYG A;  5AYP A;  3WEH A;  5I1U A;  4KVW A;  1VG2 A;  4KPJ A;  4KPD A;  3N0G A;  2F92 F;  4JZX A;  5AHU B;  4NKE A;  5A0J A;  3P8R A;  3WJK A;  3DYF A;  4OKM A;  2P1C A;  2Z50 A;  1KIY A;  1VG4 A;  4KQ5 A;  1UBY A;  5CG6 A;  4RXD A;  5C05 A;  4JYX A;  3LZ9 A;  1YQ7 A;  4OMG A;  3N5H F;  1YHK A;  3N1V F;  3WEG A;  1V4J A;  5JA0 F;  3KBK A;  5DGN F;  4RYP A;  5IM1 A;  2E4O A;  3AQ0 A;  3TFV A;  4F6X A;  4NFI F;  3NF2 A;  3N0F A;  1UBW A;  5AEL A;  2PS8 A;  3KRA B;  2AZJ A;  2Q58 A;  3WC9 A;  3AQB B;  2AZL A;  4KWD A;  1WKZ A;  5IK6 A;  1YYU A;  3ADZ A;  3M01 A;  4KVD A;  3ZMB A;  3P5R A;  5ILJ A;  1N1Z A;  4LFV F;  3KRA A;  1VG6 A;  3TC1 A;  2ZCR A;  2F94 F;  3LDW A;  4JXY A;  5HNA A;  2E92 A;  3VJ9 A;  2E8T A;  3WCI A;  3Q2Z A;  3WCD A;  4LLS A;  4E9Z A;  1V4H A;  3SDR A;  4RXA A;  1N23 A;  2AEK A;  4DZW A;  4XQS F;  3LG5 A;  3WEJ A;  4H5E F;  2Q9Y A;  3S4J A;  4FP4 A;  4LOB A;  5B01 A;  2E91 A;  3M9U A;  4RXC A;  3NPK A;  2ONH A;  5IK9 A;  3WCE A;  2PS4 A;  3LMD A;  1FPS A;  2F7M F;  5B0L A;  4GA3 A;  4F62 A;  3LEE A;  2AEL A;  1KIZ A;  5EAU A;  2Z52 A;  3CC9 A;  3N6K F;  1V4K A;  4OMH A;  3LSN A;  4F6V A;  5EAT A;  1RTR A;  5DW7 A;  3WCA A;  3LJI A;  2E8X A;  2Z7I A;  5IMN A;  5IMP A;  3WCL A;  1HM4 A;  2ZEU A;  3PDE A;  2EWG A;  5IK0 A;  4H5C F;  1WMW A;  2F8Z F;  2OGD A;  3G4D A;  3N3D A;  3WSB A;  1VG7 A;  1YYT A;  3AQC B;  3KRO B;  3WJN A;  2E8U A;  4N9U A;  3OAC A;  5IL3 A;  5ERN A;  4KVY A;  5HN9 A;  2F8C F;  1WL1 A;  3WE9 A;  3BNY A;  5B00 A;  5HN7 A;  3DYH A;  3PYA A;  5JV0 F;  3KRP A;  3MZV A;  1WL3 A;  3KRO A;  2I19 A;  5B02 A;  1YYR A;  1JFA A;  1HX9 A;  4KK2 A;  3M0G A;  3ZL6 A;  4LZ3 A;  2E8W A;  4LXW A;  2Z4V A;  5ILI A;  2OA6 A;  5ILK A;  4OGU A;  4MC3 A;  1WL0 A;  3P41 A;  4XQR F;  2Z4W A;  3WCJ A;  4EA1 A;  2Z4X A;  2J1O A;  4GP2 A;  5DGM F;  5DGS F;  3RMG A;  5H9D A;  3OAB A;  4PVY F;  3IPI A;  1PS1 A;  3EGT A;  3PYB A;  3G4F A;  4NFJ F;  4NUA A;  2E95 A;  3SDQ A;  3WCB A;  5IN8 A;  2AZK A;  2Q80 A;  5CG5 A;  4DWB A;  4K10 A;  3TFP A;  5A0I A;  3ACY A;  3LK5 A;  3PH7 A;  4KFA A;  4EA2 A;  3S9V A;  5B0M A;  5EAS A;  3N46 F;  1DGP A;  3WCG A;  4LFG A;  4EA0 A;  2DH4 A;  3QKC A;  5DHK A;  5ILH A;  4N1Z F;  4JVJ F;  3LGZ B;  3V66 A;  3MAV A;  2PS7 A;  3ACX A;  1YJ4 A;  1YHL A;  2ONG A;  5E8L A;  5HN8 A;  5KSX F;  3LLW A;  3TS7 A;  4QPF A;  1N21 A;  2F89 F;  4MC0 A;  2VF6 A;  1WL2 A;  3SAE A;  5IVG A;  3VJ8 A;  3WJO A;  4DWG A;  5AFX A;  5DJV F;  3EZ3 A;  2OPM A;  3SDV A;  3N45 F;  3OAC B;  4LPH F;  3Q30 A;  1N24 A;  3ACW A;  3N5J F;  4KQS A;  3NPR A;  2J5C A;  3WCM A;  2ZEV A;  2Z7H A;  2ZCO A;  1JFG A;  3KRP B;  4NG6 A;  3CKE A;  4LA6 A;  1HM7 A;  4DHD A;  3TFN A;  4P0V A;  4P0X A;  4KUX A;  4DEM F;  3B7L A;  4XQT F;  1N20 A;  1N1B A;  4LTZ A;  4DXJ A;  4P0W A;  5JV2 F;  1YV5 A;  4PVX F;  4QXS F;  1ZW5 A;  5DIQ F;  4GP1 A;  4L2X F;  4LZ0 A;  3W7F A;  2E94 A;  1VG3 A;  3RYW A;  4E9U A;  3WCH A;  3PKO A;  5ILD A;  4NFK F;  4LUU A;  3VJD A;  3BNX A;  2AET A;  5IKH A;  2OPN A;  3VJB A;  3ICM A;  4KKM A;  3P8L A;  2FOR A;  3RYE A;  2PS6 A;  3VJA A;  5ERM A;  2ZY1 A;  3WSA A;  3OAB B;  2Z4Y A;  1RQI A;  3V1X A;  3ZCD A; 
#chains in the Genus database with same CATH homology
 4WK5 A;  4UMJ A;  3ZOU A;  3IBA A;  3WEK A;  2O1O A;  3KRF B;  4RNQ A;  5B0I A;  1N22 A;  5IL8 A;  4LLT A;  3ICK A;  3WEF A;  3P5P A;  3V1V A;  3Q2Q A;  2Z78 A;  3ASX A;  3ID0 A;  4JZB A;  3N49 F;  4GAX A;  2E93 A;  5ER8 A;  3ICN A;  3UCA A;  3OYR A;  4NKF A;  1DI1 A;  2Z4Z A;  4RXE A;  5B0J A;  5E8H A;  3ICZ A;  5JUZ F;  2E90 A;  3KRF A;  3SDU A;  5DJR F;  3VJC A;  4E1E A;  3CP6 A;  3KRC B;  4H5D F;  5IMI A;  3LGK A;  1HXA A;  5IKA A;  1YHM A;  2Q9Z A;  3LOM A;  1RQJ A;  5DHI A;  5A0K A;  1UBX A;  5DJP F;  4OKZ A;  4DI5 A;  1YYS A;  3KRC A;  4LZC A;  3ZMC A;  2FTZ A;  2RAH A;  4KQU A;  3RBM A;  3WCF A;  1HXC A;  3M00 A;  3QQV A;  2QIS A;  2H8O A;  4LA5 A;  1V4E A;  3APZ A;  5B03 A;  2E8V A;  3N3L F;  4HD1 A;  3VJE A;  3AE0 A;  4FJQ A;  5E8K A;  3EFQ A;  2ZCS A;  2PS5 A;  5ILZ A;  1EZF A;  2J1P A;  5ERO A;  4ZQ8 A;  4LFE A;  1WY0 A;  1UBV A;  4LPG F;  3WEI A;  3SDT A;  2ZCQ A;  1V4I A;  5ILY A;  2F9K F;  5B0K A;  5JV1 F;  4LIX A;  4JXN A;  3LVS A;  3NRI A;  4KVI A;  3M02 A;  1YYQ A;  4LTV A;  1HXG A;  3Q1O A;  4Q23 A;  3WCC A;  3KB9 A;  4MC8 A;  5DZ2 A;  3N1W F;  3DYG A;  5AYP A;  3WEH A;  5I1U A;  4KVW A;  1VG2 A;  4KPJ A;  4KPD A;  3N0G A;  2F92 F;  4JZX A;  5AHU B;  4NKE A;  5A0J A;  3P8R A;  3WJK A;  3DYF A;  4OKM A;  2P1C A;  2Z50 A;  1KIY A;  1VG4 A;  4KQ5 A;  1UBY A;  5CG6 A;  4RXD A;  5C05 A;  4JYX A;  3LZ9 A;  1YQ7 A;  4OMG A;  3N5H F;  1YHK A;  3N1V F;  3WEG A;  1V4J A;  5JA0 F;  3KBK A;  5DGN F;  4RYP A;  5IM1 A;  2E4O A;  3AQ0 A;  3TFV A;  4F6X A;  4NFI F;  3NF2 A;  3N0F A;  1UBW A;  5AEL A;  2PS8 A;  3KRA B;  2AZJ A;  2Q58 A;  3WC9 A;  3AQB B;  2AZL A;  4KWD A;  1WKZ A;  5IK6 A;  1YYU A;  3ADZ A;  3M01 A;  4KVD A;  3ZMB A;  3P5R A;  5ILJ A;  1N1Z A;  4LFV F;  3KRA A;  1VG6 A;  3TC1 A;  2ZCR A;  2F94 F;  3LDW A;  4JXY A;  5HNA A;  2E92 A;  3VJ9 A;  2E8T A;  3WCI A;  3Q2Z A;  3WCD A;  4LLS A;  4E9Z A;  1V4H A;  3SDR A;  4RXA A;  1N23 A;  2AEK A;  4DZW A;  4XQS F;  3LG5 A;  3WEJ A;  4H5E F;  2Q9Y A;  3S4J A;  4FP4 A;  4LOB A;  5B01 A;  2E91 A;  3M9U A;  4RXC A;  3NPK A;  2ONH A;  5IK9 A;  3WCE A;  2PS4 A;  3LMD A;  1FPS A;  2F7M F;  5B0L A;  4GA3 A;  4F62 A;  3LEE A;  2AEL A;  1KIZ A;  5EAU A;  2Z52 A;  3CC9 A;  3N6K F;  1V4K A;  4OMH A;  3LSN A;  4F6V A;  5EAT A;  1RTR A;  5DW7 A;  3WCA A;  3LJI A;  2E8X A;  2Z7I A;  5IMN A;  5IMP A;  3WCL A;  1HM4 A;  2ZEU A;  3PDE A;  2EWG A;  5IK0 A;  4H5C F;  1WMW A;  2F8Z F;  2OGD A;  3G4D A;  3N3D A;  3WSB A;  1VG7 A;  1YYT A;  3AQC B;  3KRO B;  3WJN A;  2E8U A;  4N9U A;  3OAC A;  5IL3 A;  5ERN A;  4KVY A;  5HN9 A;  2F8C F;  1WL1 A;  3WE9 A;  3BNY A;  5B00 A;  5HN7 A;  3DYH A;  3PYA A;  5JV0 F;  3KRP A;  3MZV A;  1WL3 A;  3KRO A;  2I19 A;  5B02 A;  1YYR A;  1JFA A;  1HX9 A;  4KK2 A;  3M0G A;  3ZL6 A;  4LZ3 A;  2E8W A;  4LXW A;  2Z4V A;  5ILI A;  2OA6 A;  5ILK A;  4OGU A;  4MC3 A;  1WL0 A;  3P41 A;  4XQR F;  2Z4W A;  3WCJ A;  4EA1 A;  2Z4X A;  2J1O A;  4GP2 A;  5DGM F;  5DGS F;  3RMG A;  5H9D A;  3OAB A;  4PVY F;  3IPI A;  1PS1 A;  3EGT A;  3PYB A;  3G4F A;  4NFJ F;  4NUA A;  2E95 A;  3SDQ A;  3WCB A;  5IN8 A;  2AZK A;  2Q80 A;  5CG5 A;  4DWB A;  4K10 A;  3TFP A;  5A0I A;  3ACY A;  3LK5 A;  3PH7 A;  4KFA A;  4EA2 A;  3S9V A;  5B0M A;  5EAS A;  3N46 F;  1DGP A;  3WCG A;  4LFG A;  4EA0 A;  2DH4 A;  3QKC A;  5DHK A;  5ILH A;  4N1Z F;  4JVJ F;  3LGZ B;  3V66 A;  3MAV A;  2PS7 A;  3ACX A;  1YJ4 A;  1YHL A;  2ONG A;  5E8L A;  5HN8 A;  5KSX F;  3LLW A;  3TS7 A;  4QPF A;  1N21 A;  2F89 F;  4MC0 A;  2VF6 A;  1WL2 A;  3SAE A;  5IVG A;  3VJ8 A;  3WJO A;  4DWG A;  5AFX A;  5DJV F;  3EZ3 A;  2OPM A;  3SDV A;  3N45 F;  3OAC B;  4LPH F;  3Q30 A;  1N24 A;  3ACW A;  3N5J F;  4KQS A;  3NPR A;  2J5C A;  3WCM A;  2ZEV A;  2Z7H A;  2ZCO A;  1JFG A;  3KRP B;  4NG6 A;  3CKE A;  4LA6 A;  1HM7 A;  4DHD A;  3TFN A;  4P0V A;  4P0X A;  4KUX A;  4DEM F;  3B7L A;  4XQT F;  1N20 A;  1N1B A;  4LTZ A;  4DXJ A;  4P0W A;  5JV2 F;  1YV5 A;  4PVX F;  4QXS F;  1ZW5 A;  5DIQ F;  4GP1 A;  4L2X F;  4LZ0 A;  3W7F A;  2E94 A;  1VG3 A;  3RYW A;  4E9U A;  3WCH A;  3PKO A;  5ILD A;  4NFK F;  4LUU A;  3VJD A;  3BNX A;  2AET A;  5IKH A;  2OPN A;  3VJB A;  3ICM A;  4KKM A;  3P8L A;  2FOR A;  3RYE A;  2PS6 A;  3VJA A;  5ERM A;  2ZY1 A;  3WSA A;  3OAB B;  2Z4Y A;  1RQI A;  3V1X A;  3ZCD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...