2AZJA

Crystal structure for the mutant d81c of sulfolobus solfataricus hexaprenyl pyrophosphate synthase
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
276
structure length
276
Chain Sequence
MSIIEFWLEAKATIDRLIEQFLNSNRDWDLVDISSYILKDGKRFRGTLNMFFTVALGGDIKDSYGGALAIEILHSASLALCDIVDLDATRRGDKAAWVVYGNRKVIFITNYLIPTALRIIQTSYGDDALNTSIELWKDTSVGALRDMYDNSDYIRTIELKTGSLFKLSTVLSAYASKHYNTKQQMLDVGKYLGIIYQVIDDFVDYKTKKVEEIDGSAKQLFKYYREGKLEEYVRSVYLEYKQKYDELISNIPFQSKYLSEIRSLPEFLANGLLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl pyrophosphate synthetase
publication title Homodimeric hexaprenyl pyrophosphate synthase from the thermoacidophilic crenarchaeon Sulfolobus solfataricus displays asymmetric subunit structures
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 110
structure length 276
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.5.1.82: Hexaprenyl diphosphate synthase (geranylgeranyl-diphosphate specific).
pdb deposition date 2005-09-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2azjA00
2OA6A 5IVGA 3S4JA 3BNYA 3NPRA 4NUAA 4KWDA 5DZ2A 4KPJA 2ZEVA 4RXEA 5C05A 3AQCB 1WL1A 4ZQ8A 3TFPA 4LFEA 3AQ0A 2PS4A 3N0FA 2E8XA 3LJIA 5DGNF 4FP4A 5IMNA 3N46F 3WEHA 4LIXA 4LPGF 3LK5A 5B0JA 2Z7HA 5DHKA 1WL0A 4RNQA 4K10A 2PS8A 5EATA 4JVJF 5AYPA 3KRPB 2QISA 4Q23A 5IMPA 1N1BA 4LZ0A 3N6KF 4NKEA 1EZFA 4RXCA 3WCBA 3LSNA 3VJ8A 3PYAA 3RYWA 1YHMA 2AZKA 3IPIA 3KB9A 4MC3A 3W7FA 1WMWA 2Z4VA 1N20A 1HX9A 2F8CF 5DIQF 5DGSF 3NPKA 1V4KA 1YQ7A 2E8TA 1YYTA 3DYFA 5B0KA 4OMGA 5B0LA 3WC9A 2Q80A 2ZCSA 3CKEA 3WCLA 5KSXF 3LLWA 5ERMA 4RYPA 4LFGA 2J1OA 3QQVA 4UMJA 5IKAA 4DZWA 3ACWA 2ZCQA 1HXGA 3APZA 4OKZA 3LEEA 3N0GA 4XQSF 1VG2A 5I1UA 2H8OA 4H5EF 4JYXA 3N3LF 3G4FA 3N1VF 3V66A 5DJVF 5ILJA 2E90A 3WCIA 3OABB 4DWGA 2Q9YA 3WEKA 3WJOA 2FORA 4LTVA 2E92A 1VG4A 1RQJA 3LOMA 5E8LA 2E8UA 3MZVA 3AE0A 4KPDA 3KRCB 3AQBB 2Q58A 3SDQA 3ID0A 2ZCRA 3ADZA 3WEIA 5JV1F 4RXDA 5ILIA 3LMDA 4JXYA 1N24A 2VF6A 3KBKA 5IL3A 3WCMA 3VJ9A 3WEJA 3LDWA 5B02A 2F92F 3VJCA 1WY0A 2E91A 2ONGA 3KROA 3V1VA 3ICNA 3WCCA 2Z4YA 3ICZA 4LOBA 5ILHA 3QKCA 1KIYA 4KKMA 3M02A 3ZMCA 3KRAB 2Z4WA 5JV2F 5HNAA 3SDTA 1N21A 3WCDA 2E8WA 1N23A 4DWBA 4P0WA 3M00A 2AZLA 2OPNA 5EROA 5EASA 3M0GA 1YV5A 4RXAA 3OABA 5ERNA 4DHDA 4EA0A 4DEMF 3WCEA 5HN8A 3B7LA 3N3DA 3Q2QA 4LA6A 3EGTA 1WL2A 2Q9ZA 1V4IA 4NG6A 3ZOUA 5EAUA 3P8RA 1WKZA 3BNXA 5IKHA 3PDEA 3OACB 1JFAA 4DI5A 2F8ZF 3CP6A 3LG5A 4QPFA 4E9UA 1V4EA 3WCFA 3Q30A 4F62A 5DJPF 4JXNA 3WCHA 4EA1A 4E9ZA 3ACXA 3WEGA 1DI1A 4N9UA 3RBMA 2ZEUA 3UCAA 3N45F 3P8LA 1UBYA 2J5CA 4KQSA 5E8KA 3TC1A 3WEFA 3RYEA 1HM4A 3LVSA 5AELA 3WE9A 2Z4XA 3PYBA 3MAVA 3EZ3A 4JZBA 4JZXA 3SDUA 5B01A 1HXAA 4NKFA 4PVYF 4KVDA 4MC8A 3DYHA 3N1WF 3ASXA 2E94A 3NRIA 1VG7A 3CC9A 2O1OA 2OPMA 3KRPA 3P5RA 4KUXA 1N1ZA 4KVYA 5DHIA 4WK5A 2P1CA 2ZCOA 5IN8A 2ZY1A 3PH7A 3N5HF 3RMGA 3VJEA 3M01A 3OACA 1PS1A 4LTZA 2AETA 3WSAA 2PS6A 4LFVF 3P5PA 3NF2A 5DJRF 4OMHA 3WCJA 2PS7A 1YHLA 3SDRA 1DGPA 2E4OA 1V4JA 5IL8A 3KRFB 1RTRA 4P0VA 5HN9A 1YHKA 5A0JA 2EWGA 2F89F 4KQ5A 3S9VA 1UBXA 3ACYA 3VJAA 3G4DA 3IBAA 4F6VA 5B03A 1YYUA 3TFVA 4DXJA 1V4HA 5AHUB 5DW7A 3OYRA 4KVIA 3ICMA 5JV0F 4NFJF 3TFNA 3ZL6A 4L2XF 5A0IA 3WCAA 4GP2A 4LA5A 5ILDA 2I19A 5B0MA 5JA0F 1YYQA 2F7MF 1VG6A 2E8VA 3WJKA 3ICKA 3N5JF 3KRCA 5IK9A 2J1PA 4N1ZF 2FTZA 3ZCDA 2AELA 1HXCA 2Z78A 2AEKA 4LZCA 2AZJA 5ER8A 4F6XA 4LPHF 5HN7A 5IK0A 4OGUA 3N49F 3VJBA 2Z7IA 5JUZF 3SAEA 4LXWA 3ZMBA 3KRFA 5E8HA 2E95A 1KIZA 1VG3A 4NFKF 3KRAA 1FPSA 4XQTF 5A0KA 4MC0A 4EA2A 3SDVA 2F94F 4NFIF 1YYRA 3DYGA 3KROB 5H9DA 1HM7A 3V1XA 5B0IA 5ILYA 2ONHA 4KVWA 5ILKA 4P0XA 1YYSA 3LZ9A 4PVXF 4QXSF 2PS5A 1YJ4A 2Z52A 3WSBA 5IM1A 1ZW5A 5IK6A 1WL3A 4H5CF 2DH4A 3EFQA 3Q1OA 4H5DF 1JFGA 1UBWA 4LLSA 5CG6A 3WJNA 2F9KF 1N22A 4FJQA 3PKOA 5DGMF 4E1EA 4OKMA 4LZ3A 4GP1A 3TS7A 3LGKA 3Q2ZA 3VJDA 5AFXA 2Z50A 3M9UA 5IMIA 3WCGA 4LLTA 2RAHA 4LUUA 4GAXA 3P41A 1RQIA 2OGDA 4KFAA 1UBVA 3LGZB 4KK2A 2Z4ZA 5B00A 2E93A 4HD1A 5CG5A 5ILZA 4GA3A 4KQUA 4XQRF
chains in the Genus database with same CATH superfamily
2OA6A 5IVGA 3S4JA 3BNYA 3NPRA 4NUAA 4KWDA 5DZ2A 4KPJA 2ZEVA 4RXEA 5C05A 3AQCB 1WL1A 4ZQ8A 3TFPA 4LFEA 3AQ0A 2PS4A 3N0FA 2E8XA 3LJIA 5DGNF 4FP4A 5IMNA 3N46F 3WEHA 4LIXA 4LPGF 3LK5A 5B0JA 2Z7HA 5DHKA 1WL0A 4RNQA 4K10A 2PS8A 5EATA 4JVJF 5AYPA 3KRPB 2QISA 4Q23A 5IMPA 1N1BA 4LZ0A 3N6KF 4NKEA 1EZFA 4RXCA 3WCBA 3LSNA 3VJ8A 3PYAA 3RYWA 1YHMA 2AZKA 3IPIA 3KB9A 4MC3A 3W7FA 1WMWA 2Z4VA 1N20A 1HX9A 2F8CF 5DIQF 5DGSF 3NPKA 1V4KA 1YQ7A 2E8TA 1YYTA 3DYFA 5B0KA 4OMGA 5B0LA 3WC9A 2Q80A 2ZCSA 3CKEA 3WCLA 5KSXF 3LLWA 5ERMA 4RYPA 4LFGA 2J1OA 3QQVA 4UMJA 5IKAA 4DZWA 3ACWA 2ZCQA 1HXGA 3APZA 4OKZA 3LEEA 3N0GA 4XQSF 1VG2A 5I1UA 2H8OA 4H5EF 4JYXA 3N3LF 3G4FA 3N1VF 3V66A 5DJVF 5ILJA 2E90A 3WCIA 3OABB 4DWGA 2Q9YA 3WEKA 3WJOA 2FORA 4LTVA 2E92A 1VG4A 1RQJA 3LOMA 5E8LA 2E8UA 3MZVA 3AE0A 4KPDA 3KRCB 3AQBB 2Q58A 3SDQA 3ID0A 2ZCRA 3ADZA 3WEIA 5JV1F 4RXDA 5ILIA 3LMDA 4JXYA 1N24A 2VF6A 3KBKA 5IL3A 3WCMA 3VJ9A 3WEJA 3LDWA 5B02A 2F92F 3VJCA 1WY0A 2E91A 2ONGA 3KROA 3V1VA 3ICNA 3WCCA 2Z4YA 3ICZA 4LOBA 5ILHA 3QKCA 1KIYA 4KKMA 3M02A 3ZMCA 3KRAB 2Z4WA 5JV2F 5HNAA 3SDTA 1N21A 3WCDA 2E8WA 1N23A 4DWBA 4P0WA 3M00A 2AZLA 2OPNA 5EROA 5EASA 3M0GA 1YV5A 4RXAA 3OABA 5ERNA 4DHDA 4EA0A 4DEMF 3WCEA 5HN8A 3B7LA 3N3DA 3Q2QA 4LA6A 3EGTA 1WL2A 2Q9ZA 1V4IA 4NG6A 3ZOUA 5EAUA 3P8RA 1WKZA 3BNXA 5IKHA 3PDEA 3OACB 1JFAA 4DI5A 2F8ZF 3CP6A 3LG5A 4QPFA 4E9UA 1V4EA 3WCFA 3Q30A 4F62A 5DJPF 4JXNA 3WCHA 4EA1A 4E9ZA 3ACXA 3WEGA 1DI1A 4N9UA 3RBMA 2ZEUA 3UCAA 3N45F 3P8LA 1UBYA 2J5CA 4KQSA 5E8KA 3TC1A 3WEFA 3RYEA 1HM4A 3LVSA 5AELA 3WE9A 2Z4XA 3PYBA 3MAVA 3EZ3A 4JZBA 4JZXA 3SDUA 5B01A 1HXAA 4NKFA 4PVYF 4KVDA 4MC8A 3DYHA 3N1WF 3ASXA 2E94A 3NRIA 1VG7A 3CC9A 2O1OA 2OPMA 3KRPA 3P5RA 4KUXA 1N1ZA 4KVYA 5DHIA 4WK5A 2P1CA 2ZCOA 5IN8A 2ZY1A 3PH7A 3N5HF 3RMGA 3VJEA 3M01A 3OACA 1PS1A 4LTZA 2AETA 3WSAA 2PS6A 4LFVF 3P5PA 3NF2A 5DJRF 4OMHA 3WCJA 2PS7A 1YHLA 3SDRA 1DGPA 2E4OA 1V4JA 5IL8A 3KRFB 1RTRA 4P0VA 5HN9A 1YHKA 5A0JA 2EWGA 2F89F 4KQ5A 3S9VA 1UBXA 3ACYA 3VJAA 3G4DA 3IBAA 4F6VA 5B03A 1YYUA 3TFVA 4DXJA 1V4HA 5AHUB 5DW7A 3OYRA 4KVIA 3ICMA 5JV0F 4NFJF 3TFNA 3ZL6A 4L2XF 5A0IA 3WCAA 4GP2A 4LA5A 5ILDA 2I19A 5B0MA 5JA0F 1YYQA 2F7MF 1VG6A 2E8VA 3WJKA 3ICKA 3N5JF 3KRCA 5IK9A 2J1PA 4N1ZF 2FTZA 3ZCDA 2AELA 1HXCA 2Z78A 2AEKA 4LZCA 2AZJA 5ER8A 4F6XA 4LPHF 5HN7A 5IK0A 4OGUA 3N49F 3VJBA 2Z7IA 5JUZF 3SAEA 4LXWA 3ZMBA 3KRFA 5E8HA 2E95A 1KIZA 1VG3A 4NFKF 3KRAA 1FPSA 4XQTF 5A0KA 4MC0A 4EA2A 3SDVA 2F94F 4NFIF 1YYRA 3DYGA 3KROB 5H9DA 1HM7A 3V1XA 5B0IA 5ILYA 2ONHA 4KVWA 5ILKA 4P0XA 1YYSA 3LZ9A 4PVXF 4QXSF 2PS5A 1YJ4A 2Z52A 3WSBA 5IM1A 1ZW5A 5IK6A 1WL3A 4H5CF 2DH4A 3EFQA 3Q1OA 4H5DF 1JFGA 1UBWA 4LLSA 5CG6A 3WJNA 2F9KF 1N22A 4FJQA 3PKOA 5DGMF 4E1EA 4OKMA 4LZ3A 4GP1A 3TS7A 3LGKA 3Q2ZA 3VJDA 5AFXA 2Z50A 3M9UA 5IMIA 3WCGA 4LLTA 2RAHA 4LUUA 4GAXA 3P41A 1RQIA 2OGDA 4KFAA 1UBVA 3LGZB 4KK2A 2Z4ZA 5B00A 2E93A 4HD1A 5CG5A 5ILZA 4GA3A 4KQUA 4XQRF
chains in the Genus database with same CATH topology
2OA6A 5IVGA 3S4JA 3BNYA 3NPRA 4NUAA 4KWDA 5DZ2A 4KPJA 2ZEVA 4RXEA 5C05A 3AQCB 1WL1A 4ZQ8A 3TFPA 4LFEA 3AQ0A 2PS4A 3N0FA 2E8XA 3LJIA 5DGNF 4FP4A 5IMNA 3N46F 3WEHA 4LIXA 4LPGF 3LK5A 5B0JA 2Z7HA 5DHKA 1WL0A 4RNQA 4K10A 2PS8A 5EATA 4JVJF 5AYPA 3KRPB 2QISA 4Q23A 5IMPA 1N1BA 4LZ0A 3N6KF 4NKEA 1EZFA 4RXCA 3WCBA 3LSNA 3VJ8A 3PYAA 3RYWA 1YHMA 2AZKA 3IPIA 3KB9A 4MC3A 3W7FA 1WMWA 2Z4VA 1N20A 1HX9A 2F8CF 5DIQF 5DGSF 3NPKA 1V4KA 1YQ7A 2E8TA 1YYTA 3DYFA 5B0KA 4OMGA 5B0LA 3WC9A 2Q80A 2ZCSA 3CKEA 3WCLA 5KSXF 3LLWA 5ERMA 4RYPA 4LFGA 2J1OA 3QQVA 4UMJA 5IKAA 4DZWA 3ACWA 2ZCQA 1HXGA 3APZA 4OKZA 3LEEA 3N0GA 4XQSF 1VG2A 5I1UA 2H8OA 4H5EF 4JYXA 3N3LF 3G4FA 3N1VF 3V66A 5DJVF 5ILJA 2E90A 3WCIA 3OABB 4DWGA 2Q9YA 3WEKA 3WJOA 2FORA 4LTVA 2E92A 1VG4A 1RQJA 3LOMA 5E8LA 2E8UA 3MZVA 3AE0A 4KPDA 3KRCB 3AQBB 2Q58A 3SDQA 3ID0A 2ZCRA 3ADZA 3WEIA 5JV1F 4RXDA 5ILIA 3LMDA 4JXYA 1N24A 2VF6A 3KBKA 5IL3A 3WCMA 3VJ9A 3WEJA 3LDWA 5B02A 2F92F 3VJCA 1WY0A 2E91A 2ONGA 3KROA 3V1VA 3ICNA 3WCCA 2Z4YA 3ICZA 4LOBA 5ILHA 3QKCA 1KIYA 4KKMA 3M02A 3ZMCA 3KRAB 2Z4WA 5JV2F 5HNAA 3SDTA 1N21A 3WCDA 2E8WA 1N23A 4DWBA 4P0WA 3M00A 2AZLA 2OPNA 5EROA 5EASA 3M0GA 1YV5A 4RXAA 3OABA 5ERNA 4DHDA 4EA0A 4DEMF 3WCEA 5HN8A 3B7LA 3N3DA 3Q2QA 4LA6A 3EGTA 1WL2A 2Q9ZA 1V4IA 4NG6A 3ZOUA 5EAUA 3P8RA 1WKZA 3BNXA 5IKHA 3PDEA 3OACB 1JFAA 4DI5A 2F8ZF 3CP6A 3LG5A 4QPFA 4E9UA 1V4EA 3WCFA 3Q30A 4F62A 5DJPF 4JXNA 3WCHA 4EA1A 4E9ZA 3ACXA 3WEGA 1DI1A 4N9UA 3RBMA 2ZEUA 3UCAA 3N45F 3P8LA 1UBYA 2J5CA 4KQSA 5E8KA 3TC1A 3WEFA 3RYEA 1HM4A 3LVSA 5AELA 3WE9A 2Z4XA 3PYBA 3MAVA 3EZ3A 4JZBA 4JZXA 3SDUA 5B01A 1HXAA 4NKFA 4PVYF 4KVDA 4MC8A 3DYHA 3N1WF 3ASXA 2E94A 3NRIA 1VG7A 3CC9A 2O1OA 2OPMA 3KRPA 3P5RA 4KUXA 1N1ZA 4KVYA 5DHIA 4WK5A 2P1CA 2ZCOA 5IN8A 2ZY1A 3PH7A 3N5HF 3RMGA 3VJEA 3M01A 3OACA 1PS1A 4LTZA 2AETA 3WSAA 2PS6A 4LFVF 3P5PA 3NF2A 5DJRF 4OMHA 3WCJA 2PS7A 1YHLA 3SDRA 1DGPA 2E4OA 1V4JA 5IL8A 3KRFB 1RTRA 4P0VA 5HN9A 1YHKA 5A0JA 2EWGA 2F89F 4KQ5A 3S9VA 1UBXA 3ACYA 3VJAA 3G4DA 3IBAA 4F6VA 5B03A 1YYUA 3TFVA 4DXJA 1V4HA 5AHUB 5DW7A 3OYRA 4KVIA 3ICMA 5JV0F 4NFJF 3TFNA 3ZL6A 4L2XF 5A0IA 3WCAA 4GP2A 4LA5A 5ILDA 2I19A 5B0MA 5JA0F 1YYQA 2F7MF 1VG6A 2E8VA 3WJKA 3ICKA 3N5JF 3KRCA 5IK9A 2J1PA 4N1ZF 2FTZA 3ZCDA 2AELA 1HXCA 2Z78A 2AEKA 4LZCA 2AZJA 5ER8A 4F6XA 4LPHF 5HN7A 5IK0A 4OGUA 3N49F 3VJBA 2Z7IA 5JUZF 3SAEA 4LXWA 3ZMBA 3KRFA 5E8HA 2E95A 1KIZA 1VG3A 4NFKF 3KRAA 1FPSA 4XQTF 5A0KA 4MC0A 4EA2A 3SDVA 2F94F 4NFIF 1YYRA 3DYGA 3KROB 5H9DA 1HM7A 3V1XA 5B0IA 5ILYA 2ONHA 4KVWA 5ILKA 4P0XA 1YYSA 3LZ9A 4PVXF 4QXSF 2PS5A 1YJ4A 2Z52A 3WSBA 5IM1A 1ZW5A 5IK6A 1WL3A 4H5CF 2DH4A 3EFQA 3Q1OA 4H5DF 1JFGA 1UBWA 4LLSA 5CG6A 3WJNA 2F9KF 1N22A 4FJQA 3PKOA 5DGMF 4E1EA 4OKMA 4LZ3A 4GP1A 3TS7A 3LGKA 3Q2ZA 3VJDA 5AFXA 2Z50A 3M9UA 5IMIA 3WCGA 4LLTA 2RAHA 4LUUA 4GAXA 3P41A 1RQIA 2OGDA 4KFAA 1UBVA 3LGZB 4KK2A 2Z4ZA 5B00A 2E93A 4HD1A 5CG5A 5ILZA 4GA3A 4KQUA 4XQRF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OA6 A;  5IVG A;  3S4J A;  3BNY A;  3NPR A;  4NUA A;  4KWD A;  5DZ2 A;  4KPJ A;  2ZEV A;  4RXE A;  5C05 A;  3AQC B;  1WL1 A;  4ZQ8 A;  3TFP A;  4LFE A;  3AQ0 A;  2PS4 A;  3N0F A;  2E8X A;  3LJI A;  5DGN F;  4FP4 A;  5IMN A;  3N46 F;  3WEH A;  4LIX A;  4LPG F;  3LK5 A;  5B0J A;  2Z7H A;  5DHK A;  1WL0 A;  4RNQ A;  4K10 A;  2PS8 A;  5EAT A;  4JVJ F;  5AYP A;  3KRP B;  2QIS A;  4Q23 A;  5IMP A;  1N1B A;  4LZ0 A;  3N6K F;  4NKE A;  1EZF A;  4RXC A;  3WCB A;  3LSN A;  3VJ8 A;  3PYA A;  3RYW A;  1YHM A;  2AZK A;  3IPI A;  3KB9 A;  4MC3 A;  3W7F A;  1WMW A;  2Z4V A;  1N20 A;  1HX9 A;  2F8C F;  5DIQ F;  5DGS F;  3NPK A;  1V4K A;  1YQ7 A;  2E8T A;  1YYT A;  3DYF A;  5B0K A;  4OMG A;  5B0L A;  3WC9 A;  2Q80 A;  2ZCS A;  3CKE A;  3WCL A;  5KSX F;  3LLW A;  5ERM A;  4RYP A;  4LFG A;  2J1O A;  3QQV A;  4UMJ A;  5IKA A;  4DZW A;  3ACW A;  2ZCQ A;  1HXG A;  3APZ A;  4OKZ A;  3LEE A;  3N0G A;  4XQS F;  1VG2 A;  5I1U A;  2H8O A;  4H5E F;  4JYX A;  3N3L F;  3G4F A;  3N1V F;  3V66 A;  5DJV F;  5ILJ A;  2E90 A;  3WCI A;  3OAB B;  4DWG A;  2Q9Y A;  3WEK A;  3WJO A;  2FOR A;  4LTV A;  2E92 A;  1VG4 A;  1RQJ A;  3LOM A;  5E8L A;  2E8U A;  3MZV A;  3AE0 A;  4KPD A;  3KRC B;  3AQB B;  2Q58 A;  3SDQ A;  3ID0 A;  2ZCR A;  3ADZ A;  3WEI A;  5JV1 F;  4RXD A;  5ILI A;  3LMD A;  4JXY A;  1N24 A;  2VF6 A;  3KBK A;  5IL3 A;  3WCM A;  3VJ9 A;  3WEJ A;  3LDW A;  5B02 A;  2F92 F;  3VJC A;  1WY0 A;  2E91 A;  2ONG A;  3KRO A;  3V1V A;  3ICN A;  3WCC A;  2Z4Y A;  3ICZ A;  4LOB A;  5ILH A;  3QKC A;  1KIY A;  4KKM A;  3M02 A;  3ZMC A;  3KRA B;  2Z4W A;  5JV2 F;  5HNA A;  3SDT A;  1N21 A;  3WCD A;  2E8W A;  1N23 A;  4DWB A;  4P0W A;  3M00 A;  2AZL A;  2OPN A;  5ERO A;  5EAS A;  3M0G A;  1YV5 A;  4RXA A;  3OAB A;  5ERN A;  4DHD A;  4EA0 A;  4DEM F;  3WCE A;  5HN8 A;  3B7L A;  3N3D A;  3Q2Q A;  4LA6 A;  3EGT A;  1WL2 A;  2Q9Z A;  1V4I A;  4NG6 A;  3ZOU A;  5EAU A;  3P8R A;  1WKZ A;  3BNX A;  5IKH A;  3PDE A;  3OAC B;  1JFA A;  4DI5 A;  2F8Z F;  3CP6 A;  3LG5 A;  4QPF A;  4E9U A;  1V4E A;  3WCF A;  3Q30 A;  4F62 A;  5DJP F;  4JXN A;  3WCH A;  4EA1 A;  4E9Z A;  3ACX A;  3WEG A;  1DI1 A;  4N9U A;  3RBM A;  2ZEU A;  3UCA A;  3N45 F;  3P8L A;  1UBY A;  2J5C A;  4KQS A;  5E8K A;  3TC1 A;  3WEF A;  3RYE A;  1HM4 A;  3LVS A;  5AEL A;  3WE9 A;  2Z4X A;  3PYB A;  3MAV A;  3EZ3 A;  4JZB A;  4JZX A;  3SDU A;  5B01 A;  1HXA A;  4NKF A;  4PVY F;  4KVD A;  4MC8 A;  3DYH A;  3N1W F;  3ASX A;  2E94 A;  3NRI A;  1VG7 A;  3CC9 A;  2O1O A;  2OPM A;  3KRP A;  3P5R A;  4KUX A;  1N1Z A;  4KVY A;  5DHI A;  4WK5 A;  2P1C A;  2ZCO A;  5IN8 A;  2ZY1 A;  3PH7 A;  3N5H F;  3RMG A;  3VJE A;  3M01 A;  3OAC A;  1PS1 A;  4LTZ A;  2AET A;  3WSA A;  2PS6 A;  4LFV F;  3P5P A;  3NF2 A;  5DJR F;  4OMH A;  3WCJ A;  2PS7 A;  1YHL A;  3SDR A;  1DGP A;  2E4O A;  1V4J A;  5IL8 A;  3KRF B;  1RTR A;  4P0V A;  5HN9 A;  1YHK A;  5A0J A;  2EWG A;  2F89 F;  4KQ5 A;  3S9V A;  1UBX A;  3ACY A;  3VJA A;  3G4D A;  3IBA A;  4F6V A;  5B03 A;  1YYU A;  3TFV A;  4DXJ A;  1V4H A;  5AHU B;  5DW7 A;  3OYR A;  4KVI A;  3ICM A;  5JV0 F;  4NFJ F;  3TFN A;  3ZL6 A;  4L2X F;  5A0I A;  3WCA A;  4GP2 A;  4LA5 A;  5ILD A;  2I19 A;  5B0M A;  5JA0 F;  1YYQ A;  2F7M F;  1VG6 A;  2E8V A;  3WJK A;  3ICK A;  3N5J F;  3KRC A;  5IK9 A;  2J1P A;  4N1Z F;  2FTZ A;  3ZCD A;  2AEL A;  1HXC A;  2Z78 A;  2AEK A;  4LZC A;  2AZJ A;  5ER8 A;  4F6X A;  4LPH F;  5HN7 A;  5IK0 A;  4OGU A;  3N49 F;  3VJB A;  2Z7I A;  5JUZ F;  3SAE A;  4LXW A;  3ZMB A;  3KRF A;  5E8H A;  2E95 A;  1KIZ A;  1VG3 A;  4NFK F;  3KRA A;  1FPS A;  4XQT F;  5A0K A;  4MC0 A;  4EA2 A;  3SDV A;  2F94 F;  4NFI F;  1YYR A;  3DYG A;  3KRO B;  5H9D A;  1HM7 A;  3V1X A;  5B0I A;  5ILY A;  2ONH A;  4KVW A;  5ILK A;  4P0X A;  1YYS A;  3LZ9 A;  4PVX F;  4QXS F;  2PS5 A;  1YJ4 A;  2Z52 A;  3WSB A;  5IM1 A;  1ZW5 A;  5IK6 A;  1WL3 A;  4H5C F;  2DH4 A;  3EFQ A;  3Q1O A;  4H5D F;  1JFG A;  1UBW A;  4LLS A;  5CG6 A;  3WJN A;  2F9K F;  1N22 A;  4FJQ A;  3PKO A;  5DGM F;  4E1E A;  4OKM A;  4LZ3 A;  4GP1 A;  3TS7 A;  3LGK A;  3Q2Z A;  3VJD A;  5AFX A;  2Z50 A;  3M9U A;  5IMI A;  3WCG A;  4LLT A;  2RAH A;  4LUU A;  4GAX A;  3P41 A;  1RQI A;  2OGD A;  4KFA A;  1UBV A;  3LGZ B;  4KK2 A;  2Z4Z A;  5B00 A;  2E93 A;  4HD1 A;  5CG5 A;  5ILZ A;  4GA3 A;  4KQU A;  4XQR F; 
#chains in the Genus database with same CATH topology
 2OA6 A;  5IVG A;  3S4J A;  3BNY A;  3NPR A;  4NUA A;  4KWD A;  5DZ2 A;  4KPJ A;  2ZEV A;  4RXE A;  5C05 A;  3AQC B;  1WL1 A;  4ZQ8 A;  3TFP A;  4LFE A;  3AQ0 A;  2PS4 A;  3N0F A;  2E8X A;  3LJI A;  5DGN F;  4FP4 A;  5IMN A;  3N46 F;  3WEH A;  4LIX A;  4LPG F;  3LK5 A;  5B0J A;  2Z7H A;  5DHK A;  1WL0 A;  4RNQ A;  4K10 A;  2PS8 A;  5EAT A;  4JVJ F;  5AYP A;  3KRP B;  2QIS A;  4Q23 A;  5IMP A;  1N1B A;  4LZ0 A;  3N6K F;  4NKE A;  1EZF A;  4RXC A;  3WCB A;  3LSN A;  3VJ8 A;  3PYA A;  3RYW A;  1YHM A;  2AZK A;  3IPI A;  3KB9 A;  4MC3 A;  3W7F A;  1WMW A;  2Z4V A;  1N20 A;  1HX9 A;  2F8C F;  5DIQ F;  5DGS F;  3NPK A;  1V4K A;  1YQ7 A;  2E8T A;  1YYT A;  3DYF A;  5B0K A;  4OMG A;  5B0L A;  3WC9 A;  2Q80 A;  2ZCS A;  3CKE A;  3WCL A;  5KSX F;  3LLW A;  5ERM A;  4RYP A;  4LFG A;  2J1O A;  3QQV A;  4UMJ A;  5IKA A;  4DZW A;  3ACW A;  2ZCQ A;  1HXG A;  3APZ A;  4OKZ A;  3LEE A;  3N0G A;  4XQS F;  1VG2 A;  5I1U A;  2H8O A;  4H5E F;  4JYX A;  3N3L F;  3G4F A;  3N1V F;  3V66 A;  5DJV F;  5ILJ A;  2E90 A;  3WCI A;  3OAB B;  4DWG A;  2Q9Y A;  3WEK A;  3WJO A;  2FOR A;  4LTV A;  2E92 A;  1VG4 A;  1RQJ A;  3LOM A;  5E8L A;  2E8U A;  3MZV A;  3AE0 A;  4KPD A;  3KRC B;  3AQB B;  2Q58 A;  3SDQ A;  3ID0 A;  2ZCR A;  3ADZ A;  3WEI A;  5JV1 F;  4RXD A;  5ILI A;  3LMD A;  4JXY A;  1N24 A;  2VF6 A;  3KBK A;  5IL3 A;  3WCM A;  3VJ9 A;  3WEJ A;  3LDW A;  5B02 A;  2F92 F;  3VJC A;  1WY0 A;  2E91 A;  2ONG A;  3KRO A;  3V1V A;  3ICN A;  3WCC A;  2Z4Y A;  3ICZ A;  4LOB A;  5ILH A;  3QKC A;  1KIY A;  4KKM A;  3M02 A;  3ZMC A;  3KRA B;  2Z4W A;  5JV2 F;  5HNA A;  3SDT A;  1N21 A;  3WCD A;  2E8W A;  1N23 A;  4DWB A;  4P0W A;  3M00 A;  2AZL A;  2OPN A;  5ERO A;  5EAS A;  3M0G A;  1YV5 A;  4RXA A;  3OAB A;  5ERN A;  4DHD A;  4EA0 A;  4DEM F;  3WCE A;  5HN8 A;  3B7L A;  3N3D A;  3Q2Q A;  4LA6 A;  3EGT A;  1WL2 A;  2Q9Z A;  1V4I A;  4NG6 A;  3ZOU A;  5EAU A;  3P8R A;  1WKZ A;  3BNX A;  5IKH A;  3PDE A;  3OAC B;  1JFA A;  4DI5 A;  2F8Z F;  3CP6 A;  3LG5 A;  4QPF A;  4E9U A;  1V4E A;  3WCF A;  3Q30 A;  4F62 A;  5DJP F;  4JXN A;  3WCH A;  4EA1 A;  4E9Z A;  3ACX A;  3WEG A;  1DI1 A;  4N9U A;  3RBM A;  2ZEU A;  3UCA A;  3N45 F;  3P8L A;  1UBY A;  2J5C A;  4KQS A;  5E8K A;  3TC1 A;  3WEF A;  3RYE A;  1HM4 A;  3LVS A;  5AEL A;  3WE9 A;  2Z4X A;  3PYB A;  3MAV A;  3EZ3 A;  4JZB A;  4JZX A;  3SDU A;  5B01 A;  1HXA A;  4NKF A;  4PVY F;  4KVD A;  4MC8 A;  3DYH A;  3N1W F;  3ASX A;  2E94 A;  3NRI A;  1VG7 A;  3CC9 A;  2O1O A;  2OPM A;  3KRP A;  3P5R A;  4KUX A;  1N1Z A;  4KVY A;  5DHI A;  4WK5 A;  2P1C A;  2ZCO A;  5IN8 A;  2ZY1 A;  3PH7 A;  3N5H F;  3RMG A;  3VJE A;  3M01 A;  3OAC A;  1PS1 A;  4LTZ A;  2AET A;  3WSA A;  2PS6 A;  4LFV F;  3P5P A;  3NF2 A;  5DJR F;  4OMH A;  3WCJ A;  2PS7 A;  1YHL A;  3SDR A;  1DGP A;  2E4O A;  1V4J A;  5IL8 A;  3KRF B;  1RTR A;  4P0V A;  5HN9 A;  1YHK A;  5A0J A;  2EWG A;  2F89 F;  4KQ5 A;  3S9V A;  1UBX A;  3ACY A;  3VJA A;  3G4D A;  3IBA A;  4F6V A;  5B03 A;  1YYU A;  3TFV A;  4DXJ A;  1V4H A;  5AHU B;  5DW7 A;  3OYR A;  4KVI A;  3ICM A;  5JV0 F;  4NFJ F;  3TFN A;  3ZL6 A;  4L2X F;  5A0I A;  3WCA A;  4GP2 A;  4LA5 A;  5ILD A;  2I19 A;  5B0M A;  5JA0 F;  1YYQ A;  2F7M F;  1VG6 A;  2E8V A;  3WJK A;  3ICK A;  3N5J F;  3KRC A;  5IK9 A;  2J1P A;  4N1Z F;  2FTZ A;  3ZCD A;  2AEL A;  1HXC A;  2Z78 A;  2AEK A;  4LZC A;  2AZJ A;  5ER8 A;  4F6X A;  4LPH F;  5HN7 A;  5IK0 A;  4OGU A;  3N49 F;  3VJB A;  2Z7I A;  5JUZ F;  3SAE A;  4LXW A;  3ZMB A;  3KRF A;  5E8H A;  2E95 A;  1KIZ A;  1VG3 A;  4NFK F;  3KRA A;  1FPS A;  4XQT F;  5A0K A;  4MC0 A;  4EA2 A;  3SDV A;  2F94 F;  4NFI F;  1YYR A;  3DYG A;  3KRO B;  5H9D A;  1HM7 A;  3V1X A;  5B0I A;  5ILY A;  2ONH A;  4KVW A;  5ILK A;  4P0X A;  1YYS A;  3LZ9 A;  4PVX F;  4QXS F;  2PS5 A;  1YJ4 A;  2Z52 A;  3WSB A;  5IM1 A;  1ZW5 A;  5IK6 A;  1WL3 A;  4H5C F;  2DH4 A;  3EFQ A;  3Q1O A;  4H5D F;  1JFG A;  1UBW A;  4LLS A;  5CG6 A;  3WJN A;  2F9K F;  1N22 A;  4FJQ A;  3PKO A;  5DGM F;  4E1E A;  4OKM A;  4LZ3 A;  4GP1 A;  3TS7 A;  3LGK A;  3Q2Z A;  3VJD A;  5AFX A;  2Z50 A;  3M9U A;  5IMI A;  3WCG A;  4LLT A;  2RAH A;  4LUU A;  4GAX A;  3P41 A;  1RQI A;  2OGD A;  4KFA A;  1UBV A;  3LGZ B;  4KK2 A;  2Z4Z A;  5B00 A;  2E93 A;  4HD1 A;  5CG5 A;  5ILZ A;  4GA3 A;  4KQU A;  4XQR F; 
#chains in the Genus database with same CATH homology
 2OA6 A;  5IVG A;  3S4J A;  3BNY A;  3NPR A;  4NUA A;  4KWD A;  5DZ2 A;  4KPJ A;  2ZEV A;  4RXE A;  5C05 A;  3AQC B;  1WL1 A;  4ZQ8 A;  3TFP A;  4LFE A;  3AQ0 A;  2PS4 A;  3N0F A;  2E8X A;  3LJI A;  5DGN F;  4FP4 A;  5IMN A;  3N46 F;  3WEH A;  4LIX A;  4LPG F;  3LK5 A;  5B0J A;  2Z7H A;  5DHK A;  1WL0 A;  4RNQ A;  4K10 A;  2PS8 A;  5EAT A;  4JVJ F;  5AYP A;  3KRP B;  2QIS A;  4Q23 A;  5IMP A;  1N1B A;  4LZ0 A;  3N6K F;  4NKE A;  1EZF A;  4RXC A;  3WCB A;  3LSN A;  3VJ8 A;  3PYA A;  3RYW A;  1YHM A;  2AZK A;  3IPI A;  3KB9 A;  4MC3 A;  3W7F A;  1WMW A;  2Z4V A;  1N20 A;  1HX9 A;  2F8C F;  5DIQ F;  5DGS F;  3NPK A;  1V4K A;  1YQ7 A;  2E8T A;  1YYT A;  3DYF A;  5B0K A;  4OMG A;  5B0L A;  3WC9 A;  2Q80 A;  2ZCS A;  3CKE A;  3WCL A;  5KSX F;  3LLW A;  5ERM A;  4RYP A;  4LFG A;  2J1O A;  3QQV A;  4UMJ A;  5IKA A;  4DZW A;  3ACW A;  2ZCQ A;  1HXG A;  3APZ A;  4OKZ A;  3LEE A;  3N0G A;  4XQS F;  1VG2 A;  5I1U A;  2H8O A;  4H5E F;  4JYX A;  3N3L F;  3G4F A;  3N1V F;  3V66 A;  5DJV F;  5ILJ A;  2E90 A;  3WCI A;  3OAB B;  4DWG A;  2Q9Y A;  3WEK A;  3WJO A;  2FOR A;  4LTV A;  2E92 A;  1VG4 A;  1RQJ A;  3LOM A;  5E8L A;  2E8U A;  3MZV A;  3AE0 A;  4KPD A;  3KRC B;  3AQB B;  2Q58 A;  3SDQ A;  3ID0 A;  2ZCR A;  3ADZ A;  3WEI A;  5JV1 F;  4RXD A;  5ILI A;  3LMD A;  4JXY A;  1N24 A;  2VF6 A;  3KBK A;  5IL3 A;  3WCM A;  3VJ9 A;  3WEJ A;  3LDW A;  5B02 A;  2F92 F;  3VJC A;  1WY0 A;  2E91 A;  2ONG A;  3KRO A;  3V1V A;  3ICN A;  3WCC A;  2Z4Y A;  3ICZ A;  4LOB A;  5ILH A;  3QKC A;  1KIY A;  4KKM A;  3M02 A;  3ZMC A;  3KRA B;  2Z4W A;  5JV2 F;  5HNA A;  3SDT A;  1N21 A;  3WCD A;  2E8W A;  1N23 A;  4DWB A;  4P0W A;  3M00 A;  2AZL A;  2OPN A;  5ERO A;  5EAS A;  3M0G A;  1YV5 A;  4RXA A;  3OAB A;  5ERN A;  4DHD A;  4EA0 A;  4DEM F;  3WCE A;  5HN8 A;  3B7L A;  3N3D A;  3Q2Q A;  4LA6 A;  3EGT A;  1WL2 A;  2Q9Z A;  1V4I A;  4NG6 A;  3ZOU A;  5EAU A;  3P8R A;  1WKZ A;  3BNX A;  5IKH A;  3PDE A;  3OAC B;  1JFA A;  4DI5 A;  2F8Z F;  3CP6 A;  3LG5 A;  4QPF A;  4E9U A;  1V4E A;  3WCF A;  3Q30 A;  4F62 A;  5DJP F;  4JXN A;  3WCH A;  4EA1 A;  4E9Z A;  3ACX A;  3WEG A;  1DI1 A;  4N9U A;  3RBM A;  2ZEU A;  3UCA A;  3N45 F;  3P8L A;  1UBY A;  2J5C A;  4KQS A;  5E8K A;  3TC1 A;  3WEF A;  3RYE A;  1HM4 A;  3LVS A;  5AEL A;  3WE9 A;  2Z4X A;  3PYB A;  3MAV A;  3EZ3 A;  4JZB A;  4JZX A;  3SDU A;  5B01 A;  1HXA A;  4NKF A;  4PVY F;  4KVD A;  4MC8 A;  3DYH A;  3N1W F;  3ASX A;  2E94 A;  3NRI A;  1VG7 A;  3CC9 A;  2O1O A;  2OPM A;  3KRP A;  3P5R A;  4KUX A;  1N1Z A;  4KVY A;  5DHI A;  4WK5 A;  2P1C A;  2ZCO A;  5IN8 A;  2ZY1 A;  3PH7 A;  3N5H F;  3RMG A;  3VJE A;  3M01 A;  3OAC A;  1PS1 A;  4LTZ A;  2AET A;  3WSA A;  2PS6 A;  4LFV F;  3P5P A;  3NF2 A;  5DJR F;  4OMH A;  3WCJ A;  2PS7 A;  1YHL A;  3SDR A;  1DGP A;  2E4O A;  1V4J A;  5IL8 A;  3KRF B;  1RTR A;  4P0V A;  5HN9 A;  1YHK A;  5A0J A;  2EWG A;  2F89 F;  4KQ5 A;  3S9V A;  1UBX A;  3ACY A;  3VJA A;  3G4D A;  3IBA A;  4F6V A;  5B03 A;  1YYU A;  3TFV A;  4DXJ A;  1V4H A;  5AHU B;  5DW7 A;  3OYR A;  4KVI A;  3ICM A;  5JV0 F;  4NFJ F;  3TFN A;  3ZL6 A;  4L2X F;  5A0I A;  3WCA A;  4GP2 A;  4LA5 A;  5ILD A;  2I19 A;  5B0M A;  5JA0 F;  1YYQ A;  2F7M F;  1VG6 A;  2E8V A;  3WJK A;  3ICK A;  3N5J F;  3KRC A;  5IK9 A;  2J1P A;  4N1Z F;  2FTZ A;  3ZCD A;  2AEL A;  1HXC A;  2Z78 A;  2AEK A;  4LZC A;  2AZJ A;  5ER8 A;  4F6X A;  4LPH F;  5HN7 A;  5IK0 A;  4OGU A;  3N49 F;  3VJB A;  2Z7I A;  5JUZ F;  3SAE A;  4LXW A;  3ZMB A;  3KRF A;  5E8H A;  2E95 A;  1KIZ A;  1VG3 A;  4NFK F;  3KRA A;  1FPS A;  4XQT F;  5A0K A;  4MC0 A;  4EA2 A;  3SDV A;  2F94 F;  4NFI F;  1YYR A;  3DYG A;  3KRO B;  5H9D A;  1HM7 A;  3V1X A;  5B0I A;  5ILY A;  2ONH A;  4KVW A;  5ILK A;  4P0X A;  1YYS A;  3LZ9 A;  4PVX F;  4QXS F;  2PS5 A;  1YJ4 A;  2Z52 A;  3WSB A;  5IM1 A;  1ZW5 A;  5IK6 A;  1WL3 A;  4H5C F;  2DH4 A;  3EFQ A;  3Q1O A;  4H5D F;  1JFG A;  1UBW A;  4LLS A;  5CG6 A;  3WJN A;  2F9K F;  1N22 A;  4FJQ A;  3PKO A;  5DGM F;  4E1E A;  4OKM A;  4LZ3 A;  4GP1 A;  3TS7 A;  3LGK A;  3Q2Z A;  3VJD A;  5AFX A;  2Z50 A;  3M9U A;  5IMI A;  3WCG A;  4LLT A;  2RAH A;  4LUU A;  4GAX A;  3P41 A;  1RQI A;  2OGD A;  4KFA A;  1UBV A;  3LGZ B;  4KK2 A;  2Z4Z A;  5B00 A;  2E93 A;  4HD1 A;  5CG5 A;  5ILZ A;  4GA3 A;  4KQU A;  4XQR F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...