5HN9A

Crystal structure of plasmodium vivax geranylgeranylpyrophosphate synthase complexed with bph-1186
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
360
structure length
351
Chain Sequence
FFRNMYDKYRDAFLSHLNEYSLEEEIKEHISKYYKLLFDYNCLGGKNNRGILVILIYEYVKRDINSSEWEKAACLAWCIEILQAAFLVADDIMDKGEMRRNKYCWYLLKDVETKNAVNDVLLLYNSIYKLIEIYLRNESCYVDVIATFRDATLKTIIGQHLDTNIFSDKYSEIDVNNINVPEQPVIDINMINFGVYKNIVIHKTAYYSFFLPIVCGMLLAGIDNLIYKKIEDISMLMGEYFQIHDDYLDIFDSTKTGKVSDIQNNKLTWPLIKTFELCSEPDKIKIVKNYGKNNLACVKVIDSLYEQYKIRKHYESYEKAQKAKILSAINELHHEGIEYVLKYLLEILFTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Farnesyl pyrophosphate synthase, putative
publication title Dynamic Structure and Inhibition of a Malaria Drug Target: Geranylgeranyl Diphosphate Synthase.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 141
structure length 351
sequence length 360
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5hn9A00
3WCCA 2AZKA 4E9ZA 3NPKA 5HN7A 5ILDA 3ZMCA 3AE0A 3OABA 3VJBA 4LA6A 3NRIA 3P5RA 3LOMA 3SAEA 2ZEUA 4KPJA 5IL3A 3AQBB 4N1ZF 4OKMA 4OKZA 3ID0A 3MAVA 5AFXA 3RBMA 4HD1A 4KK2A 4LZCA 4JZXA 3DYHA 5EASA 3RMGA 5EAUA 5IK0A 4EA1A 3WSAA 5AYPA 5IN8A 2Z4VA 4LIXA 1N21A 1VG2A 4LOBA 4LLTA 2E8WA 3M01A 3M0GA 3LG5A 2Z4ZA 5DJPF 3WSBA 5A0KA 4LFEA 5HNAA 1V4IA 3Q1OA 5B03A 4F6XA 3M00A 3M02A 1WY0A 2E8VA 5E8HA 3WEJA 3VJAA 3WCLA 1YHKA 3M9UA 5B0IA 5KSXF 4KVWA 3WJNA 3ASXA 3ADZA 1VG3A 3WC9A 4FJQA 2F8ZF 4MC8A 2ONGA 1ZW5A 3IPIA 5B0KA 3AQCB 3SDVA 2ZCQA 3Q2ZA 2I19A 3VJ9A 4E1EA 3UCAA 4LFVF 1KIYA 1VG7A 4RXEA 3KROA 3VJDA 1HXAA 4L2XF 2ONHA 3WCJA 3LLWA 3LSNA 3ICMA 5AELA 3LEEA 3ICZA 3PH7A 5ILJA 3CP6A 3KB9A 3LMDA 4EA2A 4LTVA 4KQSA 3N45F 3WJOA 5DJRF 4DXJA 2F8CF 5JV0F 5JA0F 5ILYA 3KRAB 2F92F 3LGZB 1UBWA 5ILZA 3TFPA 5EROA 2Z4YA 4KFAA 2E91A 4P0VA 5DJVF 3WE9A 4FP4A 3WEIA 2Z50A 4P0XA 5DGMF 3ZMBA 5E8KA 3WEHA 4P0WA 3P8LA 2PS4A 1HM4A 1YJ4A 2EWGA 4GP2A 3RYWA 2Q80A 4DZWA 1YYUA 3N46F 5H9DA 5DW7A 2Z52A 3TS7A 3N49F 4NUAA 5HN8A 4LFGA 3NF2A 4OMHA 5IVGA 3PYBA 3WCBA 4DWBA 2J1OA 2E4OA 1N1BA 4NFJF 3WEKA 1N24A 4JVJF 2Q9ZA 1YHLA 1VG4A 1YHMA 3PKOA 4OMGA 5IL8A 2E93A 2OA6A 3WCDA 4LXWA 3W7FA 1RQJA 4UMJA 4LPGF 5A0IA 3G4FA 1V4KA 3KRCA 3ZL6A 2Z7IA 5A0JA 2OPNA 3VJCA 4LLSA 3N1WF 4KUXA 2J1PA 2AETA 3P5PA 5ILHA 3LJIA 3S4JA 2FTZA 5B0JA 3KRPB 5DZ2A 4RNQA 3TC1A 1PS1A 4KQUA 4K10A 2Z4XA 3DYFA 4DEMF 2Q9YA 3OACA 3RYEA 1YYQA 3VJ8A 5IK9A 4KVIA 2H8OA 4LUUA 3IBAA 3ACWA 1DI1A 4N9UA 1V4HA 5AHUB 5ER8A 2DH4A 2Z7HA 2AZJA 2P1CA 1KIZA 2J5CA 3TFVA 3WCGA 1WL3A 2VF6A 1RTRA 1DGPA 5CG6A 1HXGA 4QPFA 4RXAA 4KQ5A 3KRAA 2E92A 1N23A 2OPMA 3ICNA 3KBKA 3KRFA 5JV1F 1V4EA 2E95A 1JFGA 4NG6A 5EATA 2F89F 4Q23A 1YV5A 3WCAA 1RQIA 4NFKF 3V1VA 3AQ0A 3EFQA 5ERMA 3SDRA 3WCHA 3EGTA 4OGUA 5B0MA 4JXNA 2FORA 4DHDA 4QXSF 4H5DF 3OYRA 3V1XA 3S9VA 3ACXA 1V4JA 4MC0A 5IK6A 3EZ3A 4PVXF 2E90A 3Q2QA 1FPSA 4F6VA 3LDWA 5DGSF 2F94F 1YQ7A 1UBXA 4JYXA 5HN9A 3CKEA 2OGDA 3G4DA 1HXCA 2E94A 5DGNF 5IKAA 2QISA 5IKHA 2Z4WA 3PDEA 4E9UA 1VG6A 5IMNA 5ERNA 4NKFA 5B01A 4NFIF 4MC3A 3P41A 4KVYA 3WJKA 2F9KF 3V66A 4F62A 3ZOUA 4PVYF 2AELA 5DHKA 3NPRA 4KVDA 3OABB 3B7LA 2ZY1A 4DWGA 2AEKA 1N20A 3KRPA 3N3LF 2PS8A 1WL1A 4H5EF 3SDTA 5B0LA 4GAXA 3SDQA 1YYTA 5JV2F 3PYAA 3QKCA 4H5CF 4KKMA 4KPDA 1EZFA 2PS6A 3N6KF 3Q30A 5B00A 2E8UA 3WEGA 3DYGA 4DI5A 4LPHF 3ICKA 3N5HF 4EA0A 1JFAA 4JXYA 4XQTF 4GA3A 5IM1A 4KWDA 3BNXA 3CC9A 5B02A 3BNYA 2ZCSA 3N3DA 4NKEA 5C05A 3LGKA 2ZCRA 4ZQ8A 3P8RA 3WCIA 2PS5A 3N0GA 2Z78A 4LTZA 4RXCA 5DIQF 5CG5A 2O1OA 5I1UA 1WL0A 3SDUA 1UBYA 2RAHA 5IMPA 2ZEVA 3KRCB 4XQRF 1WL2A 4LZ0A 2F7MF 4JZBA 3VJEA 1HM7A 1N22A 4LA5A 3ZCDA 3APZA 3LVSA 2E8TA 5DHIA 3N5JF 3OACB 1YYRA 4LZ3A 3WCFA 3LK5A 1YYSA 1HX9A 4GP1A 5IMIA 3QQVA 1WKZA 4WK5A 4RXDA 1UBVA 3WCMA 1N1ZA 3N0FA 3WCEA 5E8LA 3MZVA 2AZLA 5ILKA 3TFNA 1WMWA 3N1VF 4RYPA 2ZCOA 3KROB 2Q58A 3ACYA 5ILIA 2PS7A 4XQSF 5JUZF 3LZ9A 2E8XA 3KRFB 3WEFA
chains in the Genus database with same CATH superfamily
3WCCA 2AZKA 4E9ZA 3NPKA 5HN7A 5ILDA 3ZMCA 3AE0A 3OABA 3VJBA 4LA6A 3NRIA 3P5RA 3LOMA 3SAEA 2ZEUA 4KPJA 5IL3A 3AQBB 4N1ZF 4OKMA 4OKZA 3ID0A 3MAVA 5AFXA 3RBMA 4HD1A 4KK2A 4LZCA 4JZXA 3DYHA 5EASA 3RMGA 5EAUA 5IK0A 4EA1A 3WSAA 5AYPA 5IN8A 2Z4VA 4LIXA 1N21A 1VG2A 4LOBA 4LLTA 2E8WA 3M01A 3M0GA 3LG5A 2Z4ZA 5DJPF 3WSBA 5A0KA 4LFEA 5HNAA 1V4IA 3Q1OA 5B03A 4F6XA 3M00A 3M02A 1WY0A 2E8VA 5E8HA 3WEJA 3VJAA 3WCLA 1YHKA 3M9UA 5B0IA 5KSXF 4KVWA 3WJNA 3ASXA 3ADZA 1VG3A 3WC9A 4FJQA 2F8ZF 4MC8A 2ONGA 1ZW5A 3IPIA 5B0KA 3AQCB 3SDVA 2ZCQA 3Q2ZA 2I19A 3VJ9A 4E1EA 3UCAA 4LFVF 1KIYA 1VG7A 4RXEA 3KROA 3VJDA 1HXAA 4L2XF 2ONHA 3WCJA 3LLWA 3LSNA 3ICMA 5AELA 3LEEA 3ICZA 3PH7A 5ILJA 3CP6A 3KB9A 3LMDA 4EA2A 4LTVA 4KQSA 3N45F 3WJOA 5DJRF 4DXJA 2F8CF 5JV0F 5JA0F 5ILYA 3KRAB 2F92F 3LGZB 1UBWA 5ILZA 3TFPA 5EROA 2Z4YA 4KFAA 2E91A 4P0VA 5DJVF 3WE9A 4FP4A 3WEIA 2Z50A 4P0XA 5DGMF 3ZMBA 5E8KA 3WEHA 4P0WA 3P8LA 2PS4A 1HM4A 1YJ4A 2EWGA 4GP2A 3RYWA 2Q80A 4DZWA 1YYUA 3N46F 5H9DA 5DW7A 2Z52A 3TS7A 3N49F 4NUAA 5HN8A 4LFGA 3NF2A 4OMHA 5IVGA 3PYBA 3WCBA 4DWBA 2J1OA 2E4OA 1N1BA 4NFJF 3WEKA 1N24A 4JVJF 2Q9ZA 1YHLA 1VG4A 1YHMA 3PKOA 4OMGA 5IL8A 2E93A 2OA6A 3WCDA 4LXWA 3W7FA 1RQJA 4UMJA 4LPGF 5A0IA 3G4FA 1V4KA 3KRCA 3ZL6A 2Z7IA 5A0JA 2OPNA 3VJCA 4LLSA 3N1WF 4KUXA 2J1PA 2AETA 3P5PA 5ILHA 3LJIA 3S4JA 2FTZA 5B0JA 3KRPB 5DZ2A 4RNQA 3TC1A 1PS1A 4KQUA 4K10A 2Z4XA 3DYFA 4DEMF 2Q9YA 3OACA 3RYEA 1YYQA 3VJ8A 5IK9A 4KVIA 2H8OA 4LUUA 3IBAA 3ACWA 1DI1A 4N9UA 1V4HA 5AHUB 5ER8A 2DH4A 2Z7HA 2AZJA 2P1CA 1KIZA 2J5CA 3TFVA 3WCGA 1WL3A 2VF6A 1RTRA 1DGPA 5CG6A 1HXGA 4QPFA 4RXAA 4KQ5A 3KRAA 2E92A 1N23A 2OPMA 3ICNA 3KBKA 3KRFA 5JV1F 1V4EA 2E95A 1JFGA 4NG6A 5EATA 2F89F 4Q23A 1YV5A 3WCAA 1RQIA 4NFKF 3V1VA 3AQ0A 3EFQA 5ERMA 3SDRA 3WCHA 3EGTA 4OGUA 5B0MA 4JXNA 2FORA 4DHDA 4QXSF 4H5DF 3OYRA 3V1XA 3S9VA 3ACXA 1V4JA 4MC0A 5IK6A 3EZ3A 4PVXF 2E90A 3Q2QA 1FPSA 4F6VA 3LDWA 5DGSF 2F94F 1YQ7A 1UBXA 4JYXA 5HN9A 3CKEA 2OGDA 3G4DA 1HXCA 2E94A 5DGNF 5IKAA 2QISA 5IKHA 2Z4WA 3PDEA 4E9UA 1VG6A 5IMNA 5ERNA 4NKFA 5B01A 4NFIF 4MC3A 3P41A 4KVYA 3WJKA 2F9KF 3V66A 4F62A 3ZOUA 4PVYF 2AELA 5DHKA 3NPRA 4KVDA 3OABB 3B7LA 2ZY1A 4DWGA 2AEKA 1N20A 3KRPA 3N3LF 2PS8A 1WL1A 4H5EF 3SDTA 5B0LA 4GAXA 3SDQA 1YYTA 5JV2F 3PYAA 3QKCA 4H5CF 4KKMA 4KPDA 1EZFA 2PS6A 3N6KF 3Q30A 5B00A 2E8UA 3WEGA 3DYGA 4DI5A 4LPHF 3ICKA 3N5HF 4EA0A 1JFAA 4JXYA 4XQTF 4GA3A 5IM1A 4KWDA 3BNXA 3CC9A 5B02A 3BNYA 2ZCSA 3N3DA 4NKEA 5C05A 3LGKA 2ZCRA 4ZQ8A 3P8RA 3WCIA 2PS5A 3N0GA 2Z78A 4LTZA 4RXCA 5DIQF 5CG5A 2O1OA 5I1UA 1WL0A 3SDUA 1UBYA 2RAHA 5IMPA 2ZEVA 3KRCB 4XQRF 1WL2A 4LZ0A 2F7MF 4JZBA 3VJEA 1HM7A 1N22A 4LA5A 3ZCDA 3APZA 3LVSA 2E8TA 5DHIA 3N5JF 3OACB 1YYRA 4LZ3A 3WCFA 3LK5A 1YYSA 1HX9A 4GP1A 5IMIA 3QQVA 1WKZA 4WK5A 4RXDA 1UBVA 3WCMA 1N1ZA 3N0FA 3WCEA 5E8LA 3MZVA 2AZLA 5ILKA 3TFNA 1WMWA 3N1VF 4RYPA 2ZCOA 3KROB 2Q58A 3ACYA 5ILIA 2PS7A 4XQSF 5JUZF 3LZ9A 2E8XA 3KRFB 3WEFA
chains in the Genus database with same CATH topology
3WCCA 2AZKA 4E9ZA 3NPKA 5HN7A 5ILDA 3ZMCA 3AE0A 3OABA 3VJBA 4LA6A 3NRIA 3P5RA 3LOMA 3SAEA 2ZEUA 4KPJA 5IL3A 3AQBB 4N1ZF 4OKMA 4OKZA 3ID0A 3MAVA 5AFXA 3RBMA 4HD1A 4KK2A 4LZCA 4JZXA 3DYHA 5EASA 3RMGA 5EAUA 5IK0A 4EA1A 3WSAA 5AYPA 5IN8A 2Z4VA 4LIXA 1N21A 1VG2A 4LOBA 4LLTA 2E8WA 3M01A 3M0GA 3LG5A 2Z4ZA 5DJPF 3WSBA 5A0KA 4LFEA 5HNAA 1V4IA 3Q1OA 5B03A 4F6XA 3M00A 3M02A 1WY0A 2E8VA 5E8HA 3WEJA 3VJAA 3WCLA 1YHKA 3M9UA 5B0IA 5KSXF 4KVWA 3WJNA 3ASXA 3ADZA 1VG3A 3WC9A 4FJQA 2F8ZF 4MC8A 2ONGA 1ZW5A 3IPIA 5B0KA 3AQCB 3SDVA 2ZCQA 3Q2ZA 2I19A 3VJ9A 4E1EA 3UCAA 4LFVF 1KIYA 1VG7A 4RXEA 3KROA 3VJDA 1HXAA 4L2XF 2ONHA 3WCJA 3LLWA 3LSNA 3ICMA 5AELA 3LEEA 3ICZA 3PH7A 5ILJA 3CP6A 3KB9A 3LMDA 4EA2A 4LTVA 4KQSA 3N45F 3WJOA 5DJRF 4DXJA 2F8CF 5JV0F 5JA0F 5ILYA 3KRAB 2F92F 3LGZB 1UBWA 5ILZA 3TFPA 5EROA 2Z4YA 4KFAA 2E91A 4P0VA 5DJVF 3WE9A 4FP4A 3WEIA 2Z50A 4P0XA 5DGMF 3ZMBA 5E8KA 3WEHA 4P0WA 3P8LA 2PS4A 1HM4A 1YJ4A 2EWGA 4GP2A 3RYWA 2Q80A 4DZWA 1YYUA 3N46F 5H9DA 5DW7A 2Z52A 3TS7A 3N49F 4NUAA 5HN8A 4LFGA 3NF2A 4OMHA 5IVGA 3PYBA 3WCBA 4DWBA 2J1OA 2E4OA 1N1BA 4NFJF 3WEKA 1N24A 4JVJF 2Q9ZA 1YHLA 1VG4A 1YHMA 3PKOA 4OMGA 5IL8A 2E93A 2OA6A 3WCDA 4LXWA 3W7FA 1RQJA 4UMJA 4LPGF 5A0IA 3G4FA 1V4KA 3KRCA 3ZL6A 2Z7IA 5A0JA 2OPNA 3VJCA 4LLSA 3N1WF 4KUXA 2J1PA 2AETA 3P5PA 5ILHA 3LJIA 3S4JA 2FTZA 5B0JA 3KRPB 5DZ2A 4RNQA 3TC1A 1PS1A 4KQUA 4K10A 2Z4XA 3DYFA 4DEMF 2Q9YA 3OACA 3RYEA 1YYQA 3VJ8A 5IK9A 4KVIA 2H8OA 4LUUA 3IBAA 3ACWA 1DI1A 4N9UA 1V4HA 5AHUB 5ER8A 2DH4A 2Z7HA 2AZJA 2P1CA 1KIZA 2J5CA 3TFVA 3WCGA 1WL3A 2VF6A 1RTRA 1DGPA 5CG6A 1HXGA 4QPFA 4RXAA 4KQ5A 3KRAA 2E92A 1N23A 2OPMA 3ICNA 3KBKA 3KRFA 5JV1F 1V4EA 2E95A 1JFGA 4NG6A 5EATA 2F89F 4Q23A 1YV5A 3WCAA 1RQIA 4NFKF 3V1VA 3AQ0A 3EFQA 5ERMA 3SDRA 3WCHA 3EGTA 4OGUA 5B0MA 4JXNA 2FORA 4DHDA 4QXSF 4H5DF 3OYRA 3V1XA 3S9VA 3ACXA 1V4JA 4MC0A 5IK6A 3EZ3A 4PVXF 2E90A 3Q2QA 1FPSA 4F6VA 3LDWA 5DGSF 2F94F 1YQ7A 1UBXA 4JYXA 5HN9A 3CKEA 2OGDA 3G4DA 1HXCA 2E94A 5DGNF 5IKAA 2QISA 5IKHA 2Z4WA 3PDEA 4E9UA 1VG6A 5IMNA 5ERNA 4NKFA 5B01A 4NFIF 4MC3A 3P41A 4KVYA 3WJKA 2F9KF 3V66A 4F62A 3ZOUA 4PVYF 2AELA 5DHKA 3NPRA 4KVDA 3OABB 3B7LA 2ZY1A 4DWGA 2AEKA 1N20A 3KRPA 3N3LF 2PS8A 1WL1A 4H5EF 3SDTA 5B0LA 4GAXA 3SDQA 1YYTA 5JV2F 3PYAA 3QKCA 4H5CF 4KKMA 4KPDA 1EZFA 2PS6A 3N6KF 3Q30A 5B00A 2E8UA 3WEGA 3DYGA 4DI5A 4LPHF 3ICKA 3N5HF 4EA0A 1JFAA 4JXYA 4XQTF 4GA3A 5IM1A 4KWDA 3BNXA 3CC9A 5B02A 3BNYA 2ZCSA 3N3DA 4NKEA 5C05A 3LGKA 2ZCRA 4ZQ8A 3P8RA 3WCIA 2PS5A 3N0GA 2Z78A 4LTZA 4RXCA 5DIQF 5CG5A 2O1OA 5I1UA 1WL0A 3SDUA 1UBYA 2RAHA 5IMPA 2ZEVA 3KRCB 4XQRF 1WL2A 4LZ0A 2F7MF 4JZBA 3VJEA 1HM7A 1N22A 4LA5A 3ZCDA 3APZA 3LVSA 2E8TA 5DHIA 3N5JF 3OACB 1YYRA 4LZ3A 3WCFA 3LK5A 1YYSA 1HX9A 4GP1A 5IMIA 3QQVA 1WKZA 4WK5A 4RXDA 1UBVA 3WCMA 1N1ZA 3N0FA 3WCEA 5E8LA 3MZVA 2AZLA 5ILKA 3TFNA 1WMWA 3N1VF 4RYPA 2ZCOA 3KROB 2Q58A 3ACYA 5ILIA 2PS7A 4XQSF 5JUZF 3LZ9A 2E8XA 3KRFB 3WEFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCC A;  2AZK A;  4E9Z A;  3NPK A;  5HN7 A;  5ILD A;  3ZMC A;  3AE0 A;  3OAB A;  3VJB A;  4LA6 A;  3NRI A;  3P5R A;  3LOM A;  3SAE A;  2ZEU A;  4KPJ A;  5IL3 A;  3AQB B;  4N1Z F;  4OKM A;  4OKZ A;  3ID0 A;  3MAV A;  5AFX A;  3RBM A;  4HD1 A;  4KK2 A;  4LZC A;  4JZX A;  3DYH A;  5EAS A;  3RMG A;  5EAU A;  5IK0 A;  4EA1 A;  3WSA A;  5AYP A;  5IN8 A;  2Z4V A;  4LIX A;  1N21 A;  1VG2 A;  4LOB A;  4LLT A;  2E8W A;  3M01 A;  3M0G A;  3LG5 A;  2Z4Z A;  5DJP F;  3WSB A;  5A0K A;  4LFE A;  5HNA A;  1V4I A;  3Q1O A;  5B03 A;  4F6X A;  3M00 A;  3M02 A;  1WY0 A;  2E8V A;  5E8H A;  3WEJ A;  3VJA A;  3WCL A;  1YHK A;  3M9U A;  5B0I A;  5KSX F;  4KVW A;  3WJN A;  3ASX A;  3ADZ A;  1VG3 A;  3WC9 A;  4FJQ A;  2F8Z F;  4MC8 A;  2ONG A;  1ZW5 A;  3IPI A;  5B0K A;  3AQC B;  3SDV A;  2ZCQ A;  3Q2Z A;  2I19 A;  3VJ9 A;  4E1E A;  3UCA A;  4LFV F;  1KIY A;  1VG7 A;  4RXE A;  3KRO A;  3VJD A;  1HXA A;  4L2X F;  2ONH A;  3WCJ A;  3LLW A;  3LSN A;  3ICM A;  5AEL A;  3LEE A;  3ICZ A;  3PH7 A;  5ILJ A;  3CP6 A;  3KB9 A;  3LMD A;  4EA2 A;  4LTV A;  4KQS A;  3N45 F;  3WJO A;  5DJR F;  4DXJ A;  2F8C F;  5JV0 F;  5JA0 F;  5ILY A;  3KRA B;  2F92 F;  3LGZ B;  1UBW A;  5ILZ A;  3TFP A;  5ERO A;  2Z4Y A;  4KFA A;  2E91 A;  4P0V A;  5DJV F;  3WE9 A;  4FP4 A;  3WEI A;  2Z50 A;  4P0X A;  5DGM F;  3ZMB A;  5E8K A;  3WEH A;  4P0W A;  3P8L A;  2PS4 A;  1HM4 A;  1YJ4 A;  2EWG A;  4GP2 A;  3RYW A;  2Q80 A;  4DZW A;  1YYU A;  3N46 F;  5H9D A;  5DW7 A;  2Z52 A;  3TS7 A;  3N49 F;  4NUA A;  5HN8 A;  4LFG A;  3NF2 A;  4OMH A;  5IVG A;  3PYB A;  3WCB A;  4DWB A;  2J1O A;  2E4O A;  1N1B A;  4NFJ F;  3WEK A;  1N24 A;  4JVJ F;  2Q9Z A;  1YHL A;  1VG4 A;  1YHM A;  3PKO A;  4OMG A;  5IL8 A;  2E93 A;  2OA6 A;  3WCD A;  4LXW A;  3W7F A;  1RQJ A;  4UMJ A;  4LPG F;  5A0I A;  3G4F A;  1V4K A;  3KRC A;  3ZL6 A;  2Z7I A;  5A0J A;  2OPN A;  3VJC A;  4LLS A;  3N1W F;  4KUX A;  2J1P A;  2AET A;  3P5P A;  5ILH A;  3LJI A;  3S4J A;  2FTZ A;  5B0J A;  3KRP B;  5DZ2 A;  4RNQ A;  3TC1 A;  1PS1 A;  4KQU A;  4K10 A;  2Z4X A;  3DYF A;  4DEM F;  2Q9Y A;  3OAC A;  3RYE A;  1YYQ A;  3VJ8 A;  5IK9 A;  4KVI A;  2H8O A;  4LUU A;  3IBA A;  3ACW A;  1DI1 A;  4N9U A;  1V4H A;  5AHU B;  5ER8 A;  2DH4 A;  2Z7H A;  2AZJ A;  2P1C A;  1KIZ A;  2J5C A;  3TFV A;  3WCG A;  1WL3 A;  2VF6 A;  1RTR A;  1DGP A;  5CG6 A;  1HXG A;  4QPF A;  4RXA A;  4KQ5 A;  3KRA A;  2E92 A;  1N23 A;  2OPM A;  3ICN A;  3KBK A;  3KRF A;  5JV1 F;  1V4E A;  2E95 A;  1JFG A;  4NG6 A;  5EAT A;  2F89 F;  4Q23 A;  1YV5 A;  3WCA A;  1RQI A;  4NFK F;  3V1V A;  3AQ0 A;  3EFQ A;  5ERM A;  3SDR A;  3WCH A;  3EGT A;  4OGU A;  5B0M A;  4JXN A;  2FOR A;  4DHD A;  4QXS F;  4H5D F;  3OYR A;  3V1X A;  3S9V A;  3ACX A;  1V4J A;  4MC0 A;  5IK6 A;  3EZ3 A;  4PVX F;  2E90 A;  3Q2Q A;  1FPS A;  4F6V A;  3LDW A;  5DGS F;  2F94 F;  1YQ7 A;  1UBX A;  4JYX A;  5HN9 A;  3CKE A;  2OGD A;  3G4D A;  1HXC A;  2E94 A;  5DGN F;  5IKA A;  2QIS A;  5IKH A;  2Z4W A;  3PDE A;  4E9U A;  1VG6 A;  5IMN A;  5ERN A;  4NKF A;  5B01 A;  4NFI F;  4MC3 A;  3P41 A;  4KVY A;  3WJK A;  2F9K F;  3V66 A;  4F62 A;  3ZOU A;  4PVY F;  2AEL A;  5DHK A;  3NPR A;  4KVD A;  3OAB B;  3B7L A;  2ZY1 A;  4DWG A;  2AEK A;  1N20 A;  3KRP A;  3N3L F;  2PS8 A;  1WL1 A;  4H5E F;  3SDT A;  5B0L A;  4GAX A;  3SDQ A;  1YYT A;  5JV2 F;  3PYA A;  3QKC A;  4H5C F;  4KKM A;  4KPD A;  1EZF A;  2PS6 A;  3N6K F;  3Q30 A;  5B00 A;  2E8U A;  3WEG A;  3DYG A;  4DI5 A;  4LPH F;  3ICK A;  3N5H F;  4EA0 A;  1JFA A;  4JXY A;  4XQT F;  4GA3 A;  5IM1 A;  4KWD A;  3BNX A;  3CC9 A;  5B02 A;  3BNY A;  2ZCS A;  3N3D A;  4NKE A;  5C05 A;  3LGK A;  2ZCR A;  4ZQ8 A;  3P8R A;  3WCI A;  2PS5 A;  3N0G A;  2Z78 A;  4LTZ A;  4RXC A;  5DIQ F;  5CG5 A;  2O1O A;  5I1U A;  1WL0 A;  3SDU A;  1UBY A;  2RAH A;  5IMP A;  2ZEV A;  3KRC B;  4XQR F;  1WL2 A;  4LZ0 A;  2F7M F;  4JZB A;  3VJE A;  1HM7 A;  1N22 A;  4LA5 A;  3ZCD A;  3APZ A;  3LVS A;  2E8T A;  5DHI A;  3N5J F;  3OAC B;  1YYR A;  4LZ3 A;  3WCF A;  3LK5 A;  1YYS A;  1HX9 A;  4GP1 A;  5IMI A;  3QQV A;  1WKZ A;  4WK5 A;  4RXD A;  1UBV A;  3WCM A;  1N1Z A;  3N0F A;  3WCE A;  5E8L A;  3MZV A;  2AZL A;  5ILK A;  3TFN A;  1WMW A;  3N1V F;  4RYP A;  2ZCO A;  3KRO B;  2Q58 A;  3ACY A;  5ILI A;  2PS7 A;  4XQS F;  5JUZ F;  3LZ9 A;  2E8X A;  3KRF B;  3WEF A; 
#chains in the Genus database with same CATH topology
 3WCC A;  2AZK A;  4E9Z A;  3NPK A;  5HN7 A;  5ILD A;  3ZMC A;  3AE0 A;  3OAB A;  3VJB A;  4LA6 A;  3NRI A;  3P5R A;  3LOM A;  3SAE A;  2ZEU A;  4KPJ A;  5IL3 A;  3AQB B;  4N1Z F;  4OKM A;  4OKZ A;  3ID0 A;  3MAV A;  5AFX A;  3RBM A;  4HD1 A;  4KK2 A;  4LZC A;  4JZX A;  3DYH A;  5EAS A;  3RMG A;  5EAU A;  5IK0 A;  4EA1 A;  3WSA A;  5AYP A;  5IN8 A;  2Z4V A;  4LIX A;  1N21 A;  1VG2 A;  4LOB A;  4LLT A;  2E8W A;  3M01 A;  3M0G A;  3LG5 A;  2Z4Z A;  5DJP F;  3WSB A;  5A0K A;  4LFE A;  5HNA A;  1V4I A;  3Q1O A;  5B03 A;  4F6X A;  3M00 A;  3M02 A;  1WY0 A;  2E8V A;  5E8H A;  3WEJ A;  3VJA A;  3WCL A;  1YHK A;  3M9U A;  5B0I A;  5KSX F;  4KVW A;  3WJN A;  3ASX A;  3ADZ A;  1VG3 A;  3WC9 A;  4FJQ A;  2F8Z F;  4MC8 A;  2ONG A;  1ZW5 A;  3IPI A;  5B0K A;  3AQC B;  3SDV A;  2ZCQ A;  3Q2Z A;  2I19 A;  3VJ9 A;  4E1E A;  3UCA A;  4LFV F;  1KIY A;  1VG7 A;  4RXE A;  3KRO A;  3VJD A;  1HXA A;  4L2X F;  2ONH A;  3WCJ A;  3LLW A;  3LSN A;  3ICM A;  5AEL A;  3LEE A;  3ICZ A;  3PH7 A;  5ILJ A;  3CP6 A;  3KB9 A;  3LMD A;  4EA2 A;  4LTV A;  4KQS A;  3N45 F;  3WJO A;  5DJR F;  4DXJ A;  2F8C F;  5JV0 F;  5JA0 F;  5ILY A;  3KRA B;  2F92 F;  3LGZ B;  1UBW A;  5ILZ A;  3TFP A;  5ERO A;  2Z4Y A;  4KFA A;  2E91 A;  4P0V A;  5DJV F;  3WE9 A;  4FP4 A;  3WEI A;  2Z50 A;  4P0X A;  5DGM F;  3ZMB A;  5E8K A;  3WEH A;  4P0W A;  3P8L A;  2PS4 A;  1HM4 A;  1YJ4 A;  2EWG A;  4GP2 A;  3RYW A;  2Q80 A;  4DZW A;  1YYU A;  3N46 F;  5H9D A;  5DW7 A;  2Z52 A;  3TS7 A;  3N49 F;  4NUA A;  5HN8 A;  4LFG A;  3NF2 A;  4OMH A;  5IVG A;  3PYB A;  3WCB A;  4DWB A;  2J1O A;  2E4O A;  1N1B A;  4NFJ F;  3WEK A;  1N24 A;  4JVJ F;  2Q9Z A;  1YHL A;  1VG4 A;  1YHM A;  3PKO A;  4OMG A;  5IL8 A;  2E93 A;  2OA6 A;  3WCD A;  4LXW A;  3W7F A;  1RQJ A;  4UMJ A;  4LPG F;  5A0I A;  3G4F A;  1V4K A;  3KRC A;  3ZL6 A;  2Z7I A;  5A0J A;  2OPN A;  3VJC A;  4LLS A;  3N1W F;  4KUX A;  2J1P A;  2AET A;  3P5P A;  5ILH A;  3LJI A;  3S4J A;  2FTZ A;  5B0J A;  3KRP B;  5DZ2 A;  4RNQ A;  3TC1 A;  1PS1 A;  4KQU A;  4K10 A;  2Z4X A;  3DYF A;  4DEM F;  2Q9Y A;  3OAC A;  3RYE A;  1YYQ A;  3VJ8 A;  5IK9 A;  4KVI A;  2H8O A;  4LUU A;  3IBA A;  3ACW A;  1DI1 A;  4N9U A;  1V4H A;  5AHU B;  5ER8 A;  2DH4 A;  2Z7H A;  2AZJ A;  2P1C A;  1KIZ A;  2J5C A;  3TFV A;  3WCG A;  1WL3 A;  2VF6 A;  1RTR A;  1DGP A;  5CG6 A;  1HXG A;  4QPF A;  4RXA A;  4KQ5 A;  3KRA A;  2E92 A;  1N23 A;  2OPM A;  3ICN A;  3KBK A;  3KRF A;  5JV1 F;  1V4E A;  2E95 A;  1JFG A;  4NG6 A;  5EAT A;  2F89 F;  4Q23 A;  1YV5 A;  3WCA A;  1RQI A;  4NFK F;  3V1V A;  3AQ0 A;  3EFQ A;  5ERM A;  3SDR A;  3WCH A;  3EGT A;  4OGU A;  5B0M A;  4JXN A;  2FOR A;  4DHD A;  4QXS F;  4H5D F;  3OYR A;  3V1X A;  3S9V A;  3ACX A;  1V4J A;  4MC0 A;  5IK6 A;  3EZ3 A;  4PVX F;  2E90 A;  3Q2Q A;  1FPS A;  4F6V A;  3LDW A;  5DGS F;  2F94 F;  1YQ7 A;  1UBX A;  4JYX A;  5HN9 A;  3CKE A;  2OGD A;  3G4D A;  1HXC A;  2E94 A;  5DGN F;  5IKA A;  2QIS A;  5IKH A;  2Z4W A;  3PDE A;  4E9U A;  1VG6 A;  5IMN A;  5ERN A;  4NKF A;  5B01 A;  4NFI F;  4MC3 A;  3P41 A;  4KVY A;  3WJK A;  2F9K F;  3V66 A;  4F62 A;  3ZOU A;  4PVY F;  2AEL A;  5DHK A;  3NPR A;  4KVD A;  3OAB B;  3B7L A;  2ZY1 A;  4DWG A;  2AEK A;  1N20 A;  3KRP A;  3N3L F;  2PS8 A;  1WL1 A;  4H5E F;  3SDT A;  5B0L A;  4GAX A;  3SDQ A;  1YYT A;  5JV2 F;  3PYA A;  3QKC A;  4H5C F;  4KKM A;  4KPD A;  1EZF A;  2PS6 A;  3N6K F;  3Q30 A;  5B00 A;  2E8U A;  3WEG A;  3DYG A;  4DI5 A;  4LPH F;  3ICK A;  3N5H F;  4EA0 A;  1JFA A;  4JXY A;  4XQT F;  4GA3 A;  5IM1 A;  4KWD A;  3BNX A;  3CC9 A;  5B02 A;  3BNY A;  2ZCS A;  3N3D A;  4NKE A;  5C05 A;  3LGK A;  2ZCR A;  4ZQ8 A;  3P8R A;  3WCI A;  2PS5 A;  3N0G A;  2Z78 A;  4LTZ A;  4RXC A;  5DIQ F;  5CG5 A;  2O1O A;  5I1U A;  1WL0 A;  3SDU A;  1UBY A;  2RAH A;  5IMP A;  2ZEV A;  3KRC B;  4XQR F;  1WL2 A;  4LZ0 A;  2F7M F;  4JZB A;  3VJE A;  1HM7 A;  1N22 A;  4LA5 A;  3ZCD A;  3APZ A;  3LVS A;  2E8T A;  5DHI A;  3N5J F;  3OAC B;  1YYR A;  4LZ3 A;  3WCF A;  3LK5 A;  1YYS A;  1HX9 A;  4GP1 A;  5IMI A;  3QQV A;  1WKZ A;  4WK5 A;  4RXD A;  1UBV A;  3WCM A;  1N1Z A;  3N0F A;  3WCE A;  5E8L A;  3MZV A;  2AZL A;  5ILK A;  3TFN A;  1WMW A;  3N1V F;  4RYP A;  2ZCO A;  3KRO B;  2Q58 A;  3ACY A;  5ILI A;  2PS7 A;  4XQS F;  5JUZ F;  3LZ9 A;  2E8X A;  3KRF B;  3WEF A; 
#chains in the Genus database with same CATH homology
 3WCC A;  2AZK A;  4E9Z A;  3NPK A;  5HN7 A;  5ILD A;  3ZMC A;  3AE0 A;  3OAB A;  3VJB A;  4LA6 A;  3NRI A;  3P5R A;  3LOM A;  3SAE A;  2ZEU A;  4KPJ A;  5IL3 A;  3AQB B;  4N1Z F;  4OKM A;  4OKZ A;  3ID0 A;  3MAV A;  5AFX A;  3RBM A;  4HD1 A;  4KK2 A;  4LZC A;  4JZX A;  3DYH A;  5EAS A;  3RMG A;  5EAU A;  5IK0 A;  4EA1 A;  3WSA A;  5AYP A;  5IN8 A;  2Z4V A;  4LIX A;  1N21 A;  1VG2 A;  4LOB A;  4LLT A;  2E8W A;  3M01 A;  3M0G A;  3LG5 A;  2Z4Z A;  5DJP F;  3WSB A;  5A0K A;  4LFE A;  5HNA A;  1V4I A;  3Q1O A;  5B03 A;  4F6X A;  3M00 A;  3M02 A;  1WY0 A;  2E8V A;  5E8H A;  3WEJ A;  3VJA A;  3WCL A;  1YHK A;  3M9U A;  5B0I A;  5KSX F;  4KVW A;  3WJN A;  3ASX A;  3ADZ A;  1VG3 A;  3WC9 A;  4FJQ A;  2F8Z F;  4MC8 A;  2ONG A;  1ZW5 A;  3IPI A;  5B0K A;  3AQC B;  3SDV A;  2ZCQ A;  3Q2Z A;  2I19 A;  3VJ9 A;  4E1E A;  3UCA A;  4LFV F;  1KIY A;  1VG7 A;  4RXE A;  3KRO A;  3VJD A;  1HXA A;  4L2X F;  2ONH A;  3WCJ A;  3LLW A;  3LSN A;  3ICM A;  5AEL A;  3LEE A;  3ICZ A;  3PH7 A;  5ILJ A;  3CP6 A;  3KB9 A;  3LMD A;  4EA2 A;  4LTV A;  4KQS A;  3N45 F;  3WJO A;  5DJR F;  4DXJ A;  2F8C F;  5JV0 F;  5JA0 F;  5ILY A;  3KRA B;  2F92 F;  3LGZ B;  1UBW A;  5ILZ A;  3TFP A;  5ERO A;  2Z4Y A;  4KFA A;  2E91 A;  4P0V A;  5DJV F;  3WE9 A;  4FP4 A;  3WEI A;  2Z50 A;  4P0X A;  5DGM F;  3ZMB A;  5E8K A;  3WEH A;  4P0W A;  3P8L A;  2PS4 A;  1HM4 A;  1YJ4 A;  2EWG A;  4GP2 A;  3RYW A;  2Q80 A;  4DZW A;  1YYU A;  3N46 F;  5H9D A;  5DW7 A;  2Z52 A;  3TS7 A;  3N49 F;  4NUA A;  5HN8 A;  4LFG A;  3NF2 A;  4OMH A;  5IVG A;  3PYB A;  3WCB A;  4DWB A;  2J1O A;  2E4O A;  1N1B A;  4NFJ F;  3WEK A;  1N24 A;  4JVJ F;  2Q9Z A;  1YHL A;  1VG4 A;  1YHM A;  3PKO A;  4OMG A;  5IL8 A;  2E93 A;  2OA6 A;  3WCD A;  4LXW A;  3W7F A;  1RQJ A;  4UMJ A;  4LPG F;  5A0I A;  3G4F A;  1V4K A;  3KRC A;  3ZL6 A;  2Z7I A;  5A0J A;  2OPN A;  3VJC A;  4LLS A;  3N1W F;  4KUX A;  2J1P A;  2AET A;  3P5P A;  5ILH A;  3LJI A;  3S4J A;  2FTZ A;  5B0J A;  3KRP B;  5DZ2 A;  4RNQ A;  3TC1 A;  1PS1 A;  4KQU A;  4K10 A;  2Z4X A;  3DYF A;  4DEM F;  2Q9Y A;  3OAC A;  3RYE A;  1YYQ A;  3VJ8 A;  5IK9 A;  4KVI A;  2H8O A;  4LUU A;  3IBA A;  3ACW A;  1DI1 A;  4N9U A;  1V4H A;  5AHU B;  5ER8 A;  2DH4 A;  2Z7H A;  2AZJ A;  2P1C A;  1KIZ A;  2J5C A;  3TFV A;  3WCG A;  1WL3 A;  2VF6 A;  1RTR A;  1DGP A;  5CG6 A;  1HXG A;  4QPF A;  4RXA A;  4KQ5 A;  3KRA A;  2E92 A;  1N23 A;  2OPM A;  3ICN A;  3KBK A;  3KRF A;  5JV1 F;  1V4E A;  2E95 A;  1JFG A;  4NG6 A;  5EAT A;  2F89 F;  4Q23 A;  1YV5 A;  3WCA A;  1RQI A;  4NFK F;  3V1V A;  3AQ0 A;  3EFQ A;  5ERM A;  3SDR A;  3WCH A;  3EGT A;  4OGU A;  5B0M A;  4JXN A;  2FOR A;  4DHD A;  4QXS F;  4H5D F;  3OYR A;  3V1X A;  3S9V A;  3ACX A;  1V4J A;  4MC0 A;  5IK6 A;  3EZ3 A;  4PVX F;  2E90 A;  3Q2Q A;  1FPS A;  4F6V A;  3LDW A;  5DGS F;  2F94 F;  1YQ7 A;  1UBX A;  4JYX A;  5HN9 A;  3CKE A;  2OGD A;  3G4D A;  1HXC A;  2E94 A;  5DGN F;  5IKA A;  2QIS A;  5IKH A;  2Z4W A;  3PDE A;  4E9U A;  1VG6 A;  5IMN A;  5ERN A;  4NKF A;  5B01 A;  4NFI F;  4MC3 A;  3P41 A;  4KVY A;  3WJK A;  2F9K F;  3V66 A;  4F62 A;  3ZOU A;  4PVY F;  2AEL A;  5DHK A;  3NPR A;  4KVD A;  3OAB B;  3B7L A;  2ZY1 A;  4DWG A;  2AEK A;  1N20 A;  3KRP A;  3N3L F;  2PS8 A;  1WL1 A;  4H5E F;  3SDT A;  5B0L A;  4GAX A;  3SDQ A;  1YYT A;  5JV2 F;  3PYA A;  3QKC A;  4H5C F;  4KKM A;  4KPD A;  1EZF A;  2PS6 A;  3N6K F;  3Q30 A;  5B00 A;  2E8U A;  3WEG A;  3DYG A;  4DI5 A;  4LPH F;  3ICK A;  3N5H F;  4EA0 A;  1JFA A;  4JXY A;  4XQT F;  4GA3 A;  5IM1 A;  4KWD A;  3BNX A;  3CC9 A;  5B02 A;  3BNY A;  2ZCS A;  3N3D A;  4NKE A;  5C05 A;  3LGK A;  2ZCR A;  4ZQ8 A;  3P8R A;  3WCI A;  2PS5 A;  3N0G A;  2Z78 A;  4LTZ A;  4RXC A;  5DIQ F;  5CG5 A;  2O1O A;  5I1U A;  1WL0 A;  3SDU A;  1UBY A;  2RAH A;  5IMP A;  2ZEV A;  3KRC B;  4XQR F;  1WL2 A;  4LZ0 A;  2F7M F;  4JZB A;  3VJE A;  1HM7 A;  1N22 A;  4LA5 A;  3ZCD A;  3APZ A;  3LVS A;  2E8T A;  5DHI A;  3N5J F;  3OAC B;  1YYR A;  4LZ3 A;  3WCF A;  3LK5 A;  1YYS A;  1HX9 A;  4GP1 A;  5IMI A;  3QQV A;  1WKZ A;  4WK5 A;  4RXD A;  1UBV A;  3WCM A;  1N1Z A;  3N0F A;  3WCE A;  5E8L A;  3MZV A;  2AZL A;  5ILK A;  3TFN A;  1WMW A;  3N1V F;  4RYP A;  2ZCO A;  3KRO B;  2Q58 A;  3ACY A;  5ILI A;  2PS7 A;  4XQS F;  5JUZ F;  3LZ9 A;  2E8X A;  3KRF B;  3WEF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...