4FP4A

Crystal structure of isoprenoid synthase a3mx09 (target efi-501993) from pyrobaculum calidifontis
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
252
structure length
243
Chain Sequence
MYSLPPEVLAALERVKARLNKVGEELEPISLRKAVRHYIETPGKLLRPLLLLTFTYSIDRRSIMDPRILEAAAIVELLHVVSLLQDDVMDQHDQRRGIKTPRAMYGDGRAIVASDWLIAESIKMAVNLGADVVTYLADVAQRLSVGQALDLEGERDKAAEFKTAPLIEAALVMPLVILGRRELIETAKKLGTKLGILYQYSRPETKSIANEIGRYLLKIKEHVGDAIAPFERLIKYLIGKALE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Polyprenyl synthetase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Pyrobaculum calidifontis
molecule tags Transferase
total genus 86
structure length 243
sequence length 252
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4fp4A00
3EFQA 3RBMA 1VG2A 4WK5A 5DGMF 1UBXA 2P1CA 5B0KA 4KK2A 1V4EA 1HM7A 2E90A 5DJPF 5IN8A 3WJKA 3EZ3A 5ILHA 5DGSF 5IK6A 3LK5A 2E8WA 4KFAA 3V1XA 3LMDA 2QISA 3ICMA 3ICKA 3TS7A 2F7MF 3OACA 3OACB 3P41A 3ZL6A 2F92F 4GP1A 2ZCOA 4UMJA 2O1OA 1WKZA 2AZKA 5ILZA 3Q1OA 4LOBA 3LOMA 3N49F 4KVYA 3WCFA 3WCJA 1YYTA 1YYSA 1N21A 3P8LA 2PS4A 2AELA 3RYWA 2PS8A 3LVSA 3M9UA 4LLSA 2E92A 5E8HA 4QXSF 1N1ZA 4LFGA 3WJNA 4KPDA 1VG4A 2ZCRA 3ACXA 1WL0A 3WCDA 3WEJA 1YJ4A 2Z50A 2F8ZF 4DI5A 2OA6A 1ZW5A 4KKMA 3WEKA 2Z78A 5EAUA 2PS7A 2ZEVA 3TFNA 4LZCA 5AFXA 5ILJA 5IK9A 3DYHA 1DGPA 1FPSA 3LGKA 3Q2ZA 2PS5A 1HM4A 1KIZA 3ADZA 3PYAA 4GA3A 3V66A 4DHDA 5DJRF 4KPJA 1VG7A 1N23A 3AQBB 4P0VA 3WEFA 5B01A 4KQ5A 3ZCDA 3N46F 5H9DA 5IMPA 1HXAA 3MAVA 4L2XF 2E8UA 2OPMA 5E8KA 2J5CA 5ERNA 3AQ0A 5AHUB 4NFIF 3KRAB 5JV1F 2AZJA 2E91A 3PYBA 3LJIA 1V4KA 2E93A 2Z7IA 4FJQA 4MC0A 1RTRA 5B03A 3SDVA 4LXWA 1WY0A 1WL3A 3KRPA 3WCLA 3KRFB 5I1UA 3KRPB 1UBVA 3N0FA 4FP4A 5IMNA 1KIYA 4GAXA 3TFPA 1WL2A 5EASA 5DZ2A 3LDWA 3UCAA 4DWGA 4NFJF 3N0GA 3OABB 3AE0A 5DGNF 4LTZA 3Q30A 1VG3A 5AELA 3KROB 4JVJF 3M01A 2E8XA 4JYXA 5IK0A 4KVWA 3N6KF 1VG6A 3RYEA 4NFKF 4K10A 5DIQF 1PS1A 5KSXF 2H8OA 1YYQA 3G4FA 3WJOA 2Z52A 5IKHA 5ILYA 2EWGA 2AETA 1V4IA 3CC9A 3QKCA 4OMHA 2J1PA 4E9ZA 3N45F 5A0JA 4KWDA 3N3LF 2ONGA 4ZQ8A 3ZOUA 3PH7A 4QPFA 5A0KA 4PVXF 3WE9A 4LUUA 3BNYA 3QQVA 1HXGA 2Z4WA 4Q23A 3ICZA 1JFAA 1YHMA 5ILKA 4RXAA 2ZEUA 4RXCA 4KVDA 3IBAA 5CG6A 4XQRF 2Q9YA 3TFVA 2E4OA 4GP2A 5B0IA 3NPKA 4N9UA 3DYGA 3WCAA 4JXYA 2Z4VA 4F6XA 3M00A 2ZY1A 1DI1A 1V4JA 3Q2QA 3WCCA 4JZXA 4LTVA 2PS6A 3VJCA 3ICNA 4NUAA 3ZMCA 5DW7A 5E8LA 1YV5A 4XQSF 4PVYF 5IL3A 3KRCB 4OGUA 5B0MA 3WEIA 5AYPA 3WSAA 4LA5A 3VJ9A 3WCIA 3WEHA 3PKOA 5ERMA 4P0XA 3LEEA 3AQCB 3N5HF 3MZVA 4EA1A 3KBKA 1YQ7A 2OGDA 3WCGA 3N1VF 4LZ3A 5IVGA 5JUZF 2VF6A 4LA6A 3KRAA 4RYPA 3S9VA 4H5DF 4OKMA 4P0WA 2Q58A 2Z7HA 4XQTF 3SDQA 4EA0A 5IM1A 3KRFA 5JV0F 3KB9A 5B00A 4NKFA 3ASXA 1RQJA 2ZCQA 3DYFA 3RMGA 5C05A 3WCEA 1YYUA 3N3DA 5DHIA 3WCHA 4JXNA 3SAEA 4KVIA 3OABA 2Z4YA 4OKZA 3VJAA 2ONHA 4DXJA 4JZBA 4H5CF 3KROA 2F9KF 2FTZA 4F6VA 3W7FA 3LZ9A 5CG5A 1UBYA 2ZCSA 4RXDA 2E94A 4MC8A 1V4HA 3ACYA 5ILIA 3NF2A 3P8RA 3P5PA 1N22A 5IKAA 3VJ8A 5DJVF 2I19A 3S4JA 1WL1A 4DZWA 4H5EF 3ACWA 5HNAA 4NKEA 4MC3A 4E9UA 2RAHA 4KQSA 5B02A 3M0GA 5HN7A 4KUXA 3SDRA 3ZMBA 3M02A 1N1BA 4LFEA 4KQUA 3WCBA 2F8CF 5IMIA 1YHKA 2F94F 1EZFA 3LGZB 3TC1A 3B7LA 3NPRA 2AZLA 5DHKA 3EGTA 5B0LA 3LLWA 3PDEA 4N1ZF 1YYRA 3P5RA 4DEMF 5JA0F 5EROA 1UBWA 3VJEA 3KRCA 2E95A 4LPGF 4RNQA 4LIXA 1N20A 1JFGA 3WCMA 3OYRA 1HX9A 1RQIA 2DH4A 4RXEA 4LZ0A 4EA2A 5EATA 4NG6A 3CKEA 3WC9A 4HD1A 2AEKA 2E8VA 3G4DA 3NRIA 3VJBA 4LPHF 5IL8A 1WMWA 4LLTA 3V1VA 3N1WF 4F62A 5JV2F 2J1OA 3ID0A 5ER8A 2Q9ZA 3BNXA 3APZA 4LFVF 5B0JA 2OPNA 4DWBA 3N5JF 3WEGA 2E8TA 1N24A 3WSBA 5A0IA 5HN9A 1YHLA 2Z4XA 3CP6A 1HXCA 2F89F 4OMGA 3SDTA 3IPIA 3LG5A 3VJDA 2FORA 2Z4ZA 3LSNA 5HN8A 5ILDA 3SDUA 4E1EA 2Q80A
chains in the Genus database with same CATH superfamily
3EFQA 3RBMA 1VG2A 4WK5A 5DGMF 1UBXA 2P1CA 5B0KA 4KK2A 1V4EA 1HM7A 2E90A 5DJPF 5IN8A 3WJKA 3EZ3A 5ILHA 5DGSF 5IK6A 3LK5A 2E8WA 4KFAA 3V1XA 3LMDA 2QISA 3ICMA 3ICKA 3TS7A 2F7MF 3OACA 3OACB 3P41A 3ZL6A 2F92F 4GP1A 2ZCOA 4UMJA 2O1OA 1WKZA 2AZKA 5ILZA 3Q1OA 4LOBA 3LOMA 3N49F 4KVYA 3WCFA 3WCJA 1YYTA 1YYSA 1N21A 3P8LA 2PS4A 2AELA 3RYWA 2PS8A 3LVSA 3M9UA 4LLSA 2E92A 5E8HA 4QXSF 1N1ZA 4LFGA 3WJNA 4KPDA 1VG4A 2ZCRA 3ACXA 1WL0A 3WCDA 3WEJA 1YJ4A 2Z50A 2F8ZF 4DI5A 2OA6A 1ZW5A 4KKMA 3WEKA 2Z78A 5EAUA 2PS7A 2ZEVA 3TFNA 4LZCA 5AFXA 5ILJA 5IK9A 3DYHA 1DGPA 1FPSA 3LGKA 3Q2ZA 2PS5A 1HM4A 1KIZA 3ADZA 3PYAA 4GA3A 3V66A 4DHDA 5DJRF 4KPJA 1VG7A 1N23A 3AQBB 4P0VA 3WEFA 5B01A 4KQ5A 3ZCDA 3N46F 5H9DA 5IMPA 1HXAA 3MAVA 4L2XF 2E8UA 2OPMA 5E8KA 2J5CA 5ERNA 3AQ0A 5AHUB 4NFIF 3KRAB 5JV1F 2AZJA 2E91A 3PYBA 3LJIA 1V4KA 2E93A 2Z7IA 4FJQA 4MC0A 1RTRA 5B03A 3SDVA 4LXWA 1WY0A 1WL3A 3KRPA 3WCLA 3KRFB 5I1UA 3KRPB 1UBVA 3N0FA 4FP4A 5IMNA 1KIYA 4GAXA 3TFPA 1WL2A 5EASA 5DZ2A 3LDWA 3UCAA 4DWGA 4NFJF 3N0GA 3OABB 3AE0A 5DGNF 4LTZA 3Q30A 1VG3A 5AELA 3KROB 4JVJF 3M01A 2E8XA 4JYXA 5IK0A 4KVWA 3N6KF 1VG6A 3RYEA 4NFKF 4K10A 5DIQF 1PS1A 5KSXF 2H8OA 1YYQA 3G4FA 3WJOA 2Z52A 5IKHA 5ILYA 2EWGA 2AETA 1V4IA 3CC9A 3QKCA 4OMHA 2J1PA 4E9ZA 3N45F 5A0JA 4KWDA 3N3LF 2ONGA 4ZQ8A 3ZOUA 3PH7A 4QPFA 5A0KA 4PVXF 3WE9A 4LUUA 3BNYA 3QQVA 1HXGA 2Z4WA 4Q23A 3ICZA 1JFAA 1YHMA 5ILKA 4RXAA 2ZEUA 4RXCA 4KVDA 3IBAA 5CG6A 4XQRF 2Q9YA 3TFVA 2E4OA 4GP2A 5B0IA 3NPKA 4N9UA 3DYGA 3WCAA 4JXYA 2Z4VA 4F6XA 3M00A 2ZY1A 1DI1A 1V4JA 3Q2QA 3WCCA 4JZXA 4LTVA 2PS6A 3VJCA 3ICNA 4NUAA 3ZMCA 5DW7A 5E8LA 1YV5A 4XQSF 4PVYF 5IL3A 3KRCB 4OGUA 5B0MA 3WEIA 5AYPA 3WSAA 4LA5A 3VJ9A 3WCIA 3WEHA 3PKOA 5ERMA 4P0XA 3LEEA 3AQCB 3N5HF 3MZVA 4EA1A 3KBKA 1YQ7A 2OGDA 3WCGA 3N1VF 4LZ3A 5IVGA 5JUZF 2VF6A 4LA6A 3KRAA 4RYPA 3S9VA 4H5DF 4OKMA 4P0WA 2Q58A 2Z7HA 4XQTF 3SDQA 4EA0A 5IM1A 3KRFA 5JV0F 3KB9A 5B00A 4NKFA 3ASXA 1RQJA 2ZCQA 3DYFA 3RMGA 5C05A 3WCEA 1YYUA 3N3DA 5DHIA 3WCHA 4JXNA 3SAEA 4KVIA 3OABA 2Z4YA 4OKZA 3VJAA 2ONHA 4DXJA 4JZBA 4H5CF 3KROA 2F9KF 2FTZA 4F6VA 3W7FA 3LZ9A 5CG5A 1UBYA 2ZCSA 4RXDA 2E94A 4MC8A 1V4HA 3ACYA 5ILIA 3NF2A 3P8RA 3P5PA 1N22A 5IKAA 3VJ8A 5DJVF 2I19A 3S4JA 1WL1A 4DZWA 4H5EF 3ACWA 5HNAA 4NKEA 4MC3A 4E9UA 2RAHA 4KQSA 5B02A 3M0GA 5HN7A 4KUXA 3SDRA 3ZMBA 3M02A 1N1BA 4LFEA 4KQUA 3WCBA 2F8CF 5IMIA 1YHKA 2F94F 1EZFA 3LGZB 3TC1A 3B7LA 3NPRA 2AZLA 5DHKA 3EGTA 5B0LA 3LLWA 3PDEA 4N1ZF 1YYRA 3P5RA 4DEMF 5JA0F 5EROA 1UBWA 3VJEA 3KRCA 2E95A 4LPGF 4RNQA 4LIXA 1N20A 1JFGA 3WCMA 3OYRA 1HX9A 1RQIA 2DH4A 4RXEA 4LZ0A 4EA2A 5EATA 4NG6A 3CKEA 3WC9A 4HD1A 2AEKA 2E8VA 3G4DA 3NRIA 3VJBA 4LPHF 5IL8A 1WMWA 4LLTA 3V1VA 3N1WF 4F62A 5JV2F 2J1OA 3ID0A 5ER8A 2Q9ZA 3BNXA 3APZA 4LFVF 5B0JA 2OPNA 4DWBA 3N5JF 3WEGA 2E8TA 1N24A 3WSBA 5A0IA 5HN9A 1YHLA 2Z4XA 3CP6A 1HXCA 2F89F 4OMGA 3SDTA 3IPIA 3LG5A 3VJDA 2FORA 2Z4ZA 3LSNA 5HN8A 5ILDA 3SDUA 4E1EA 2Q80A
chains in the Genus database with same CATH topology
3EFQA 3RBMA 1VG2A 4WK5A 5DGMF 1UBXA 2P1CA 5B0KA 4KK2A 1V4EA 1HM7A 2E90A 5DJPF 5IN8A 3WJKA 3EZ3A 5ILHA 5DGSF 5IK6A 3LK5A 2E8WA 4KFAA 3V1XA 3LMDA 2QISA 3ICMA 3ICKA 3TS7A 2F7MF 3OACA 3OACB 3P41A 3ZL6A 2F92F 4GP1A 2ZCOA 4UMJA 2O1OA 1WKZA 2AZKA 5ILZA 3Q1OA 4LOBA 3LOMA 3N49F 4KVYA 3WCFA 3WCJA 1YYTA 1YYSA 1N21A 3P8LA 2PS4A 2AELA 3RYWA 2PS8A 3LVSA 3M9UA 4LLSA 2E92A 5E8HA 4QXSF 1N1ZA 4LFGA 3WJNA 4KPDA 1VG4A 2ZCRA 3ACXA 1WL0A 3WCDA 3WEJA 1YJ4A 2Z50A 2F8ZF 4DI5A 2OA6A 1ZW5A 4KKMA 3WEKA 2Z78A 5EAUA 2PS7A 2ZEVA 3TFNA 4LZCA 5AFXA 5ILJA 5IK9A 3DYHA 1DGPA 1FPSA 3LGKA 3Q2ZA 2PS5A 1HM4A 1KIZA 3ADZA 3PYAA 4GA3A 3V66A 4DHDA 5DJRF 4KPJA 1VG7A 1N23A 3AQBB 4P0VA 3WEFA 5B01A 4KQ5A 3ZCDA 3N46F 5H9DA 5IMPA 1HXAA 3MAVA 4L2XF 2E8UA 2OPMA 5E8KA 2J5CA 5ERNA 3AQ0A 5AHUB 4NFIF 3KRAB 5JV1F 2AZJA 2E91A 3PYBA 3LJIA 1V4KA 2E93A 2Z7IA 4FJQA 4MC0A 1RTRA 5B03A 3SDVA 4LXWA 1WY0A 1WL3A 3KRPA 3WCLA 3KRFB 5I1UA 3KRPB 1UBVA 3N0FA 4FP4A 5IMNA 1KIYA 4GAXA 3TFPA 1WL2A 5EASA 5DZ2A 3LDWA 3UCAA 4DWGA 4NFJF 3N0GA 3OABB 3AE0A 5DGNF 4LTZA 3Q30A 1VG3A 5AELA 3KROB 4JVJF 3M01A 2E8XA 4JYXA 5IK0A 4KVWA 3N6KF 1VG6A 3RYEA 4NFKF 4K10A 5DIQF 1PS1A 5KSXF 2H8OA 1YYQA 3G4FA 3WJOA 2Z52A 5IKHA 5ILYA 2EWGA 2AETA 1V4IA 3CC9A 3QKCA 4OMHA 2J1PA 4E9ZA 3N45F 5A0JA 4KWDA 3N3LF 2ONGA 4ZQ8A 3ZOUA 3PH7A 4QPFA 5A0KA 4PVXF 3WE9A 4LUUA 3BNYA 3QQVA 1HXGA 2Z4WA 4Q23A 3ICZA 1JFAA 1YHMA 5ILKA 4RXAA 2ZEUA 4RXCA 4KVDA 3IBAA 5CG6A 4XQRF 2Q9YA 3TFVA 2E4OA 4GP2A 5B0IA 3NPKA 4N9UA 3DYGA 3WCAA 4JXYA 2Z4VA 4F6XA 3M00A 2ZY1A 1DI1A 1V4JA 3Q2QA 3WCCA 4JZXA 4LTVA 2PS6A 3VJCA 3ICNA 4NUAA 3ZMCA 5DW7A 5E8LA 1YV5A 4XQSF 4PVYF 5IL3A 3KRCB 4OGUA 5B0MA 3WEIA 5AYPA 3WSAA 4LA5A 3VJ9A 3WCIA 3WEHA 3PKOA 5ERMA 4P0XA 3LEEA 3AQCB 3N5HF 3MZVA 4EA1A 3KBKA 1YQ7A 2OGDA 3WCGA 3N1VF 4LZ3A 5IVGA 5JUZF 2VF6A 4LA6A 3KRAA 4RYPA 3S9VA 4H5DF 4OKMA 4P0WA 2Q58A 2Z7HA 4XQTF 3SDQA 4EA0A 5IM1A 3KRFA 5JV0F 3KB9A 5B00A 4NKFA 3ASXA 1RQJA 2ZCQA 3DYFA 3RMGA 5C05A 3WCEA 1YYUA 3N3DA 5DHIA 3WCHA 4JXNA 3SAEA 4KVIA 3OABA 2Z4YA 4OKZA 3VJAA 2ONHA 4DXJA 4JZBA 4H5CF 3KROA 2F9KF 2FTZA 4F6VA 3W7FA 3LZ9A 5CG5A 1UBYA 2ZCSA 4RXDA 2E94A 4MC8A 1V4HA 3ACYA 5ILIA 3NF2A 3P8RA 3P5PA 1N22A 5IKAA 3VJ8A 5DJVF 2I19A 3S4JA 1WL1A 4DZWA 4H5EF 3ACWA 5HNAA 4NKEA 4MC3A 4E9UA 2RAHA 4KQSA 5B02A 3M0GA 5HN7A 4KUXA 3SDRA 3ZMBA 3M02A 1N1BA 4LFEA 4KQUA 3WCBA 2F8CF 5IMIA 1YHKA 2F94F 1EZFA 3LGZB 3TC1A 3B7LA 3NPRA 2AZLA 5DHKA 3EGTA 5B0LA 3LLWA 3PDEA 4N1ZF 1YYRA 3P5RA 4DEMF 5JA0F 5EROA 1UBWA 3VJEA 3KRCA 2E95A 4LPGF 4RNQA 4LIXA 1N20A 1JFGA 3WCMA 3OYRA 1HX9A 1RQIA 2DH4A 4RXEA 4LZ0A 4EA2A 5EATA 4NG6A 3CKEA 3WC9A 4HD1A 2AEKA 2E8VA 3G4DA 3NRIA 3VJBA 4LPHF 5IL8A 1WMWA 4LLTA 3V1VA 3N1WF 4F62A 5JV2F 2J1OA 3ID0A 5ER8A 2Q9ZA 3BNXA 3APZA 4LFVF 5B0JA 2OPNA 4DWBA 3N5JF 3WEGA 2E8TA 1N24A 3WSBA 5A0IA 5HN9A 1YHLA 2Z4XA 3CP6A 1HXCA 2F89F 4OMGA 3SDTA 3IPIA 3LG5A 3VJDA 2FORA 2Z4ZA 3LSNA 5HN8A 5ILDA 3SDUA 4E1EA 2Q80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EFQ A;  3RBM A;  1VG2 A;  4WK5 A;  5DGM F;  1UBX A;  2P1C A;  5B0K A;  4KK2 A;  1V4E A;  1HM7 A;  2E90 A;  5DJP F;  5IN8 A;  3WJK A;  3EZ3 A;  5ILH A;  5DGS F;  5IK6 A;  3LK5 A;  2E8W A;  4KFA A;  3V1X A;  3LMD A;  2QIS A;  3ICM A;  3ICK A;  3TS7 A;  2F7M F;  3OAC A;  3OAC B;  3P41 A;  3ZL6 A;  2F92 F;  4GP1 A;  2ZCO A;  4UMJ A;  2O1O A;  1WKZ A;  2AZK A;  5ILZ A;  3Q1O A;  4LOB A;  3LOM A;  3N49 F;  4KVY A;  3WCF A;  3WCJ A;  1YYT A;  1YYS A;  1N21 A;  3P8L A;  2PS4 A;  2AEL A;  3RYW A;  2PS8 A;  3LVS A;  3M9U A;  4LLS A;  2E92 A;  5E8H A;  4QXS F;  1N1Z A;  4LFG A;  3WJN A;  4KPD A;  1VG4 A;  2ZCR A;  3ACX A;  1WL0 A;  3WCD A;  3WEJ A;  1YJ4 A;  2Z50 A;  2F8Z F;  4DI5 A;  2OA6 A;  1ZW5 A;  4KKM A;  3WEK A;  2Z78 A;  5EAU A;  2PS7 A;  2ZEV A;  3TFN A;  4LZC A;  5AFX A;  5ILJ A;  5IK9 A;  3DYH A;  1DGP A;  1FPS A;  3LGK A;  3Q2Z A;  2PS5 A;  1HM4 A;  1KIZ A;  3ADZ A;  3PYA A;  4GA3 A;  3V66 A;  4DHD A;  5DJR F;  4KPJ A;  1VG7 A;  1N23 A;  3AQB B;  4P0V A;  3WEF A;  5B01 A;  4KQ5 A;  3ZCD A;  3N46 F;  5H9D A;  5IMP A;  1HXA A;  3MAV A;  4L2X F;  2E8U A;  2OPM A;  5E8K A;  2J5C A;  5ERN A;  3AQ0 A;  5AHU B;  4NFI F;  3KRA B;  5JV1 F;  2AZJ A;  2E91 A;  3PYB A;  3LJI A;  1V4K A;  2E93 A;  2Z7I A;  4FJQ A;  4MC0 A;  1RTR A;  5B03 A;  3SDV A;  4LXW A;  1WY0 A;  1WL3 A;  3KRP A;  3WCL A;  3KRF B;  5I1U A;  3KRP B;  1UBV A;  3N0F A;  4FP4 A;  5IMN A;  1KIY A;  4GAX A;  3TFP A;  1WL2 A;  5EAS A;  5DZ2 A;  3LDW A;  3UCA A;  4DWG A;  4NFJ F;  3N0G A;  3OAB B;  3AE0 A;  5DGN F;  4LTZ A;  3Q30 A;  1VG3 A;  5AEL A;  3KRO B;  4JVJ F;  3M01 A;  2E8X A;  4JYX A;  5IK0 A;  4KVW A;  3N6K F;  1VG6 A;  3RYE A;  4NFK F;  4K10 A;  5DIQ F;  1PS1 A;  5KSX F;  2H8O A;  1YYQ A;  3G4F A;  3WJO A;  2Z52 A;  5IKH A;  5ILY A;  2EWG A;  2AET A;  1V4I A;  3CC9 A;  3QKC A;  4OMH A;  2J1P A;  4E9Z A;  3N45 F;  5A0J A;  4KWD A;  3N3L F;  2ONG A;  4ZQ8 A;  3ZOU A;  3PH7 A;  4QPF A;  5A0K A;  4PVX F;  3WE9 A;  4LUU A;  3BNY A;  3QQV A;  1HXG A;  2Z4W A;  4Q23 A;  3ICZ A;  1JFA A;  1YHM A;  5ILK A;  4RXA A;  2ZEU A;  4RXC A;  4KVD A;  3IBA A;  5CG6 A;  4XQR F;  2Q9Y A;  3TFV A;  2E4O A;  4GP2 A;  5B0I A;  3NPK A;  4N9U A;  3DYG A;  3WCA A;  4JXY A;  2Z4V A;  4F6X A;  3M00 A;  2ZY1 A;  1DI1 A;  1V4J A;  3Q2Q A;  3WCC A;  4JZX A;  4LTV A;  2PS6 A;  3VJC A;  3ICN A;  4NUA A;  3ZMC A;  5DW7 A;  5E8L A;  1YV5 A;  4XQS F;  4PVY F;  5IL3 A;  3KRC B;  4OGU A;  5B0M A;  3WEI A;  5AYP A;  3WSA A;  4LA5 A;  3VJ9 A;  3WCI A;  3WEH A;  3PKO A;  5ERM A;  4P0X A;  3LEE A;  3AQC B;  3N5H F;  3MZV A;  4EA1 A;  3KBK A;  1YQ7 A;  2OGD A;  3WCG A;  3N1V F;  4LZ3 A;  5IVG A;  5JUZ F;  2VF6 A;  4LA6 A;  3KRA A;  4RYP A;  3S9V A;  4H5D F;  4OKM A;  4P0W A;  2Q58 A;  2Z7H A;  4XQT F;  3SDQ A;  4EA0 A;  5IM1 A;  3KRF A;  5JV0 F;  3KB9 A;  5B00 A;  4NKF A;  3ASX A;  1RQJ A;  2ZCQ A;  3DYF A;  3RMG A;  5C05 A;  3WCE A;  1YYU A;  3N3D A;  5DHI A;  3WCH A;  4JXN A;  3SAE A;  4KVI A;  3OAB A;  2Z4Y A;  4OKZ A;  3VJA A;  2ONH A;  4DXJ A;  4JZB A;  4H5C F;  3KRO A;  2F9K F;  2FTZ A;  4F6V A;  3W7F A;  3LZ9 A;  5CG5 A;  1UBY A;  2ZCS A;  4RXD A;  2E94 A;  4MC8 A;  1V4H A;  3ACY A;  5ILI A;  3NF2 A;  3P8R A;  3P5P A;  1N22 A;  5IKA A;  3VJ8 A;  5DJV F;  2I19 A;  3S4J A;  1WL1 A;  4DZW A;  4H5E F;  3ACW A;  5HNA A;  4NKE A;  4MC3 A;  4E9U A;  2RAH A;  4KQS A;  5B02 A;  3M0G A;  5HN7 A;  4KUX A;  3SDR A;  3ZMB A;  3M02 A;  1N1B A;  4LFE A;  4KQU A;  3WCB A;  2F8C F;  5IMI A;  1YHK A;  2F94 F;  1EZF A;  3LGZ B;  3TC1 A;  3B7L A;  3NPR A;  2AZL A;  5DHK A;  3EGT A;  5B0L A;  3LLW A;  3PDE A;  4N1Z F;  1YYR A;  3P5R A;  4DEM F;  5JA0 F;  5ERO A;  1UBW A;  3VJE A;  3KRC A;  2E95 A;  4LPG F;  4RNQ A;  4LIX A;  1N20 A;  1JFG A;  3WCM A;  3OYR A;  1HX9 A;  1RQI A;  2DH4 A;  4RXE A;  4LZ0 A;  4EA2 A;  5EAT A;  4NG6 A;  3CKE A;  3WC9 A;  4HD1 A;  2AEK A;  2E8V A;  3G4D A;  3NRI A;  3VJB A;  4LPH F;  5IL8 A;  1WMW A;  4LLT A;  3V1V A;  3N1W F;  4F62 A;  5JV2 F;  2J1O A;  3ID0 A;  5ER8 A;  2Q9Z A;  3BNX A;  3APZ A;  4LFV F;  5B0J A;  2OPN A;  4DWB A;  3N5J F;  3WEG A;  2E8T A;  1N24 A;  3WSB A;  5A0I A;  5HN9 A;  1YHL A;  2Z4X A;  3CP6 A;  1HXC A;  2F89 F;  4OMG A;  3SDT A;  3IPI A;  3LG5 A;  3VJD A;  2FOR A;  2Z4Z A;  3LSN A;  5HN8 A;  5ILD A;  3SDU A;  4E1E A;  2Q80 A; 
#chains in the Genus database with same CATH topology
 3EFQ A;  3RBM A;  1VG2 A;  4WK5 A;  5DGM F;  1UBX A;  2P1C A;  5B0K A;  4KK2 A;  1V4E A;  1HM7 A;  2E90 A;  5DJP F;  5IN8 A;  3WJK A;  3EZ3 A;  5ILH A;  5DGS F;  5IK6 A;  3LK5 A;  2E8W A;  4KFA A;  3V1X A;  3LMD A;  2QIS A;  3ICM A;  3ICK A;  3TS7 A;  2F7M F;  3OAC A;  3OAC B;  3P41 A;  3ZL6 A;  2F92 F;  4GP1 A;  2ZCO A;  4UMJ A;  2O1O A;  1WKZ A;  2AZK A;  5ILZ A;  3Q1O A;  4LOB A;  3LOM A;  3N49 F;  4KVY A;  3WCF A;  3WCJ A;  1YYT A;  1YYS A;  1N21 A;  3P8L A;  2PS4 A;  2AEL A;  3RYW A;  2PS8 A;  3LVS A;  3M9U A;  4LLS A;  2E92 A;  5E8H A;  4QXS F;  1N1Z A;  4LFG A;  3WJN A;  4KPD A;  1VG4 A;  2ZCR A;  3ACX A;  1WL0 A;  3WCD A;  3WEJ A;  1YJ4 A;  2Z50 A;  2F8Z F;  4DI5 A;  2OA6 A;  1ZW5 A;  4KKM A;  3WEK A;  2Z78 A;  5EAU A;  2PS7 A;  2ZEV A;  3TFN A;  4LZC A;  5AFX A;  5ILJ A;  5IK9 A;  3DYH A;  1DGP A;  1FPS A;  3LGK A;  3Q2Z A;  2PS5 A;  1HM4 A;  1KIZ A;  3ADZ A;  3PYA A;  4GA3 A;  3V66 A;  4DHD A;  5DJR F;  4KPJ A;  1VG7 A;  1N23 A;  3AQB B;  4P0V A;  3WEF A;  5B01 A;  4KQ5 A;  3ZCD A;  3N46 F;  5H9D A;  5IMP A;  1HXA A;  3MAV A;  4L2X F;  2E8U A;  2OPM A;  5E8K A;  2J5C A;  5ERN A;  3AQ0 A;  5AHU B;  4NFI F;  3KRA B;  5JV1 F;  2AZJ A;  2E91 A;  3PYB A;  3LJI A;  1V4K A;  2E93 A;  2Z7I A;  4FJQ A;  4MC0 A;  1RTR A;  5B03 A;  3SDV A;  4LXW A;  1WY0 A;  1WL3 A;  3KRP A;  3WCL A;  3KRF B;  5I1U A;  3KRP B;  1UBV A;  3N0F A;  4FP4 A;  5IMN A;  1KIY A;  4GAX A;  3TFP A;  1WL2 A;  5EAS A;  5DZ2 A;  3LDW A;  3UCA A;  4DWG A;  4NFJ F;  3N0G A;  3OAB B;  3AE0 A;  5DGN F;  4LTZ A;  3Q30 A;  1VG3 A;  5AEL A;  3KRO B;  4JVJ F;  3M01 A;  2E8X A;  4JYX A;  5IK0 A;  4KVW A;  3N6K F;  1VG6 A;  3RYE A;  4NFK F;  4K10 A;  5DIQ F;  1PS1 A;  5KSX F;  2H8O A;  1YYQ A;  3G4F A;  3WJO A;  2Z52 A;  5IKH A;  5ILY A;  2EWG A;  2AET A;  1V4I A;  3CC9 A;  3QKC A;  4OMH A;  2J1P A;  4E9Z A;  3N45 F;  5A0J A;  4KWD A;  3N3L F;  2ONG A;  4ZQ8 A;  3ZOU A;  3PH7 A;  4QPF A;  5A0K A;  4PVX F;  3WE9 A;  4LUU A;  3BNY A;  3QQV A;  1HXG A;  2Z4W A;  4Q23 A;  3ICZ A;  1JFA A;  1YHM A;  5ILK A;  4RXA A;  2ZEU A;  4RXC A;  4KVD A;  3IBA A;  5CG6 A;  4XQR F;  2Q9Y A;  3TFV A;  2E4O A;  4GP2 A;  5B0I A;  3NPK A;  4N9U A;  3DYG A;  3WCA A;  4JXY A;  2Z4V A;  4F6X A;  3M00 A;  2ZY1 A;  1DI1 A;  1V4J A;  3Q2Q A;  3WCC A;  4JZX A;  4LTV A;  2PS6 A;  3VJC A;  3ICN A;  4NUA A;  3ZMC A;  5DW7 A;  5E8L A;  1YV5 A;  4XQS F;  4PVY F;  5IL3 A;  3KRC B;  4OGU A;  5B0M A;  3WEI A;  5AYP A;  3WSA A;  4LA5 A;  3VJ9 A;  3WCI A;  3WEH A;  3PKO A;  5ERM A;  4P0X A;  3LEE A;  3AQC B;  3N5H F;  3MZV A;  4EA1 A;  3KBK A;  1YQ7 A;  2OGD A;  3WCG A;  3N1V F;  4LZ3 A;  5IVG A;  5JUZ F;  2VF6 A;  4LA6 A;  3KRA A;  4RYP A;  3S9V A;  4H5D F;  4OKM A;  4P0W A;  2Q58 A;  2Z7H A;  4XQT F;  3SDQ A;  4EA0 A;  5IM1 A;  3KRF A;  5JV0 F;  3KB9 A;  5B00 A;  4NKF A;  3ASX A;  1RQJ A;  2ZCQ A;  3DYF A;  3RMG A;  5C05 A;  3WCE A;  1YYU A;  3N3D A;  5DHI A;  3WCH A;  4JXN A;  3SAE A;  4KVI A;  3OAB A;  2Z4Y A;  4OKZ A;  3VJA A;  2ONH A;  4DXJ A;  4JZB A;  4H5C F;  3KRO A;  2F9K F;  2FTZ A;  4F6V A;  3W7F A;  3LZ9 A;  5CG5 A;  1UBY A;  2ZCS A;  4RXD A;  2E94 A;  4MC8 A;  1V4H A;  3ACY A;  5ILI A;  3NF2 A;  3P8R A;  3P5P A;  1N22 A;  5IKA A;  3VJ8 A;  5DJV F;  2I19 A;  3S4J A;  1WL1 A;  4DZW A;  4H5E F;  3ACW A;  5HNA A;  4NKE A;  4MC3 A;  4E9U A;  2RAH A;  4KQS A;  5B02 A;  3M0G A;  5HN7 A;  4KUX A;  3SDR A;  3ZMB A;  3M02 A;  1N1B A;  4LFE A;  4KQU A;  3WCB A;  2F8C F;  5IMI A;  1YHK A;  2F94 F;  1EZF A;  3LGZ B;  3TC1 A;  3B7L A;  3NPR A;  2AZL A;  5DHK A;  3EGT A;  5B0L A;  3LLW A;  3PDE A;  4N1Z F;  1YYR A;  3P5R A;  4DEM F;  5JA0 F;  5ERO A;  1UBW A;  3VJE A;  3KRC A;  2E95 A;  4LPG F;  4RNQ A;  4LIX A;  1N20 A;  1JFG A;  3WCM A;  3OYR A;  1HX9 A;  1RQI A;  2DH4 A;  4RXE A;  4LZ0 A;  4EA2 A;  5EAT A;  4NG6 A;  3CKE A;  3WC9 A;  4HD1 A;  2AEK A;  2E8V A;  3G4D A;  3NRI A;  3VJB A;  4LPH F;  5IL8 A;  1WMW A;  4LLT A;  3V1V A;  3N1W F;  4F62 A;  5JV2 F;  2J1O A;  3ID0 A;  5ER8 A;  2Q9Z A;  3BNX A;  3APZ A;  4LFV F;  5B0J A;  2OPN A;  4DWB A;  3N5J F;  3WEG A;  2E8T A;  1N24 A;  3WSB A;  5A0I A;  5HN9 A;  1YHL A;  2Z4X A;  3CP6 A;  1HXC A;  2F89 F;  4OMG A;  3SDT A;  3IPI A;  3LG5 A;  3VJD A;  2FOR A;  2Z4Z A;  3LSN A;  5HN8 A;  5ILD A;  3SDU A;  4E1E A;  2Q80 A; 
#chains in the Genus database with same CATH homology
 3EFQ A;  3RBM A;  1VG2 A;  4WK5 A;  5DGM F;  1UBX A;  2P1C A;  5B0K A;  4KK2 A;  1V4E A;  1HM7 A;  2E90 A;  5DJP F;  5IN8 A;  3WJK A;  3EZ3 A;  5ILH A;  5DGS F;  5IK6 A;  3LK5 A;  2E8W A;  4KFA A;  3V1X A;  3LMD A;  2QIS A;  3ICM A;  3ICK A;  3TS7 A;  2F7M F;  3OAC A;  3OAC B;  3P41 A;  3ZL6 A;  2F92 F;  4GP1 A;  2ZCO A;  4UMJ A;  2O1O A;  1WKZ A;  2AZK A;  5ILZ A;  3Q1O A;  4LOB A;  3LOM A;  3N49 F;  4KVY A;  3WCF A;  3WCJ A;  1YYT A;  1YYS A;  1N21 A;  3P8L A;  2PS4 A;  2AEL A;  3RYW A;  2PS8 A;  3LVS A;  3M9U A;  4LLS A;  2E92 A;  5E8H A;  4QXS F;  1N1Z A;  4LFG A;  3WJN A;  4KPD A;  1VG4 A;  2ZCR A;  3ACX A;  1WL0 A;  3WCD A;  3WEJ A;  1YJ4 A;  2Z50 A;  2F8Z F;  4DI5 A;  2OA6 A;  1ZW5 A;  4KKM A;  3WEK A;  2Z78 A;  5EAU A;  2PS7 A;  2ZEV A;  3TFN A;  4LZC A;  5AFX A;  5ILJ A;  5IK9 A;  3DYH A;  1DGP A;  1FPS A;  3LGK A;  3Q2Z A;  2PS5 A;  1HM4 A;  1KIZ A;  3ADZ A;  3PYA A;  4GA3 A;  3V66 A;  4DHD A;  5DJR F;  4KPJ A;  1VG7 A;  1N23 A;  3AQB B;  4P0V A;  3WEF A;  5B01 A;  4KQ5 A;  3ZCD A;  3N46 F;  5H9D A;  5IMP A;  1HXA A;  3MAV A;  4L2X F;  2E8U A;  2OPM A;  5E8K A;  2J5C A;  5ERN A;  3AQ0 A;  5AHU B;  4NFI F;  3KRA B;  5JV1 F;  2AZJ A;  2E91 A;  3PYB A;  3LJI A;  1V4K A;  2E93 A;  2Z7I A;  4FJQ A;  4MC0 A;  1RTR A;  5B03 A;  3SDV A;  4LXW A;  1WY0 A;  1WL3 A;  3KRP A;  3WCL A;  3KRF B;  5I1U A;  3KRP B;  1UBV A;  3N0F A;  4FP4 A;  5IMN A;  1KIY A;  4GAX A;  3TFP A;  1WL2 A;  5EAS A;  5DZ2 A;  3LDW A;  3UCA A;  4DWG A;  4NFJ F;  3N0G A;  3OAB B;  3AE0 A;  5DGN F;  4LTZ A;  3Q30 A;  1VG3 A;  5AEL A;  3KRO B;  4JVJ F;  3M01 A;  2E8X A;  4JYX A;  5IK0 A;  4KVW A;  3N6K F;  1VG6 A;  3RYE A;  4NFK F;  4K10 A;  5DIQ F;  1PS1 A;  5KSX F;  2H8O A;  1YYQ A;  3G4F A;  3WJO A;  2Z52 A;  5IKH A;  5ILY A;  2EWG A;  2AET A;  1V4I A;  3CC9 A;  3QKC A;  4OMH A;  2J1P A;  4E9Z A;  3N45 F;  5A0J A;  4KWD A;  3N3L F;  2ONG A;  4ZQ8 A;  3ZOU A;  3PH7 A;  4QPF A;  5A0K A;  4PVX F;  3WE9 A;  4LUU A;  3BNY A;  3QQV A;  1HXG A;  2Z4W A;  4Q23 A;  3ICZ A;  1JFA A;  1YHM A;  5ILK A;  4RXA A;  2ZEU A;  4RXC A;  4KVD A;  3IBA A;  5CG6 A;  4XQR F;  2Q9Y A;  3TFV A;  2E4O A;  4GP2 A;  5B0I A;  3NPK A;  4N9U A;  3DYG A;  3WCA A;  4JXY A;  2Z4V A;  4F6X A;  3M00 A;  2ZY1 A;  1DI1 A;  1V4J A;  3Q2Q A;  3WCC A;  4JZX A;  4LTV A;  2PS6 A;  3VJC A;  3ICN A;  4NUA A;  3ZMC A;  5DW7 A;  5E8L A;  1YV5 A;  4XQS F;  4PVY F;  5IL3 A;  3KRC B;  4OGU A;  5B0M A;  3WEI A;  5AYP A;  3WSA A;  4LA5 A;  3VJ9 A;  3WCI A;  3WEH A;  3PKO A;  5ERM A;  4P0X A;  3LEE A;  3AQC B;  3N5H F;  3MZV A;  4EA1 A;  3KBK A;  1YQ7 A;  2OGD A;  3WCG A;  3N1V F;  4LZ3 A;  5IVG A;  5JUZ F;  2VF6 A;  4LA6 A;  3KRA A;  4RYP A;  3S9V A;  4H5D F;  4OKM A;  4P0W A;  2Q58 A;  2Z7H A;  4XQT F;  3SDQ A;  4EA0 A;  5IM1 A;  3KRF A;  5JV0 F;  3KB9 A;  5B00 A;  4NKF A;  3ASX A;  1RQJ A;  2ZCQ A;  3DYF A;  3RMG A;  5C05 A;  3WCE A;  1YYU A;  3N3D A;  5DHI A;  3WCH A;  4JXN A;  3SAE A;  4KVI A;  3OAB A;  2Z4Y A;  4OKZ A;  3VJA A;  2ONH A;  4DXJ A;  4JZB A;  4H5C F;  3KRO A;  2F9K F;  2FTZ A;  4F6V A;  3W7F A;  3LZ9 A;  5CG5 A;  1UBY A;  2ZCS A;  4RXD A;  2E94 A;  4MC8 A;  1V4H A;  3ACY A;  5ILI A;  3NF2 A;  3P8R A;  3P5P A;  1N22 A;  5IKA A;  3VJ8 A;  5DJV F;  2I19 A;  3S4J A;  1WL1 A;  4DZW A;  4H5E F;  3ACW A;  5HNA A;  4NKE A;  4MC3 A;  4E9U A;  2RAH A;  4KQS A;  5B02 A;  3M0G A;  5HN7 A;  4KUX A;  3SDR A;  3ZMB A;  3M02 A;  1N1B A;  4LFE A;  4KQU A;  3WCB A;  2F8C F;  5IMI A;  1YHK A;  2F94 F;  1EZF A;  3LGZ B;  3TC1 A;  3B7L A;  3NPR A;  2AZL A;  5DHK A;  3EGT A;  5B0L A;  3LLW A;  3PDE A;  4N1Z F;  1YYR A;  3P5R A;  4DEM F;  5JA0 F;  5ERO A;  1UBW A;  3VJE A;  3KRC A;  2E95 A;  4LPG F;  4RNQ A;  4LIX A;  1N20 A;  1JFG A;  3WCM A;  3OYR A;  1HX9 A;  1RQI A;  2DH4 A;  4RXE A;  4LZ0 A;  4EA2 A;  5EAT A;  4NG6 A;  3CKE A;  3WC9 A;  4HD1 A;  2AEK A;  2E8V A;  3G4D A;  3NRI A;  3VJB A;  4LPH F;  5IL8 A;  1WMW A;  4LLT A;  3V1V A;  3N1W F;  4F62 A;  5JV2 F;  2J1O A;  3ID0 A;  5ER8 A;  2Q9Z A;  3BNX A;  3APZ A;  4LFV F;  5B0J A;  2OPN A;  4DWB A;  3N5J F;  3WEG A;  2E8T A;  1N24 A;  3WSB A;  5A0I A;  5HN9 A;  1YHL A;  2Z4X A;  3CP6 A;  1HXC A;  2F89 F;  4OMG A;  3SDT A;  3IPI A;  3LG5 A;  3VJD A;  2FOR A;  2Z4Z A;  3LSN A;  5HN8 A;  5ILD A;  3SDU A;  4E1E A;  2Q80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...