4F6VA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with bph-1034, mg2+ and fmp.
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
281
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title HIV-1 Integrase Inhibitor-Inspired Antibacterials Targeting Isoprenoid Biosynthesis.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 114
structure length 281
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4f6vA00
1WL0A 1N1ZA 3P8LA 2F94F 1HM4A 3AQBB 3TS7A 3SDQA 1KIYA 3LOMA 3Q30A 1V4IA 5HN8A 4WK5A 3EGTA 5EASA 3RBMA 2P1CA 1N23A 4E9ZA 2E90A 4PVYF 4KVDA 4E9UA 3WCBA 4H5EF 2ZCQA 1KIZA 3LEEA 5ILHA 5ERNA 3WEGA 3N1WF 3ZOUA 5DIQF 5A0JA 4GP2A 1JFGA 4LA5A 3N1VF 4RXDA 2E8XA 3ICMA 4RXEA 3N46F 4F62A 3LJIA 3DYHA 2ZEVA 2RAHA 3WCHA 1RQJA 5I1UA 3LZ9A 5KSXF 2E4OA 2ONGA 4H5DF 4MC8A 4DWGA 3KROB 4OMGA 3WSAA 3ZL6A 3LMDA 4NUAA 5IL8A 4OKZA 1WY0A 5B02A 1FPSA 4LXWA 3N49F 4LFGA 5IN8A 3N3LF 3N45F 2AEKA 4NFIF 4MC0A 3WE9A 5DJPF 3LSNA 3PYBA 4RXCA 3KRPB 3ZMCA 2Q58A 2E92A 3NPRA 3S9VA 1YHMA 3WCLA 1UBXA 1N20A 3KB9A 4DI5A 2FTZA 3V66A 3OABB 5B03A 2O1OA 4FJQA 3VJAA 3ACWA 2ONHA 3CP6A 1N1BA 4K10A 2E8WA 4LFEA 4NKFA 4H5CF 3QQVA 1HM7A 3ICKA 4PVXF 4XQTF 4KVWA 3Q2QA 4MC3A 3PH7A 1V4JA 3LDWA 4JXYA 3WCEA 2ZEUA 3WEIA 5DJVF 3VJDA 1N22A 2FORA 2Z78A 3APZA 4DZWA 1V4HA 2Z7IA 3ADZA 5ILYA 2I19A 2PS5A 3SDTA 5B01A 3KRFB 3M01A 3NPKA 4KFAA 3N5HF 5HN7A 4RYPA 3V1VA 3LVSA 3DYFA 1VG6A 5ERMA 4P0VA 3ASXA 4KQ5A 4KQSA 2AZKA 5EROA 2Z4VA 2Z4YA 5B0JA 3WC9A 3IPIA 1UBVA 1YYRA 5JV1F 1JFAA 4LTVA 5IK9A 4OGUA 1HXCA 2H8OA 4NG6A 5IK6A 3WCGA 1VG3A 4KUXA 1HXGA 3WEHA 3G4FA 5IMIA 3SAEA 5JV0F 3P5PA 3LLWA 1N24A 3KBKA 3ACYA 3P5RA 3KROA 3QKCA 2Q80A 4LZ0A 3Q2ZA 4LPHF 5CG6A 5B0LA 3OYRA 5E8KA 3TFNA 1VG7A 4N1ZF 5DGNF 2J5CA 4ZQ8A 5EATA 3MAVA 1HXAA 3KRPA 4NFKF 5AFXA 1PS1A 4OMHA 4DXJA 4LOBA 2F8CF 3BNXA 4KPJA 4RNQA 1DI1A 5E8HA 5IKHA 3Q1OA 3N5JF 4KWDA 3OABA 3RMGA 2E95A 4NFJF 2Z4ZA 3NF2A 5DJRF 4L2XF 2DH4A 4P0XA 3ACXA 1WL1A 2Q9ZA 5IM1A 5ILJA 5IVGA 4KKMA 4LTZA 3OACB 3G4DA 4QXSF 3V1XA 4DHDA 3LGZB 4RXAA 1YQ7A 3WCCA 2Z50A 3TC1A 1YYQA 3P8RA 5JUZF 4EA1A 2ZCOA 3VJ9A 2ZCSA 3EZ3A 3BNYA 5DHIA 3KRFA 3WCMA 4GP1A 5A0IA 5DW7A 4DWBA 2VF6A 4EA0A 4LIXA 5IK0A 4JYXA 5H9DA 3WJKA 3WCIA 5IMPA 4N9UA 3SDUA 3LG5A 5AYPA 2ZCRA 3M9UA 2E91A 2PS4A 4GAXA 1RTRA 1WMWA 2OPMA 4LLTA 3KRCB 1N21A 4LZ3A 2Z4XA 3UCAA 5CG5A 1EZFA 4F6VA 3ID0A 4KVYA 3ICNA 2E8TA 5EAUA 3S4JA 1VG2A 3N0GA 1YYTA 2E94A 5ILKA 5HN9A 5A0KA 3VJCA 2F9KF 3ICZA 3MZVA 3DYGA 4OKMA 5E8LA 4KVIA 2F7MF 3N6KF 3SDRA 3SDVA 1YHLA 2E8VA 4DEMF 3ZCDA 1WL3A 2F89F 4P0WA 2QISA 3CKEA 3M0GA 2J1PA 2ZY1A 5JA0F 3KRAB 1V4KA 3WEJA 5ER8A 3VJBA 3OACA 2AELA 4JZBA 3N0FA 1ZW5A 1YJ4A 5C05A 1VG4A 4EA2A 4LFVF 3TFVA 1YV5A 4E1EA 3WCDA 1UBYA 2PS7A 2E8UA 2F92F 3VJEA 3WSBA 4Q23A 5ILDA 3TFPA 3WCJA 5DHKA 2F8ZF 4JXNA 3M02A 4LZCA 5AHUB 1YYSA 2PS6A 3WJOA 1DGPA 2AETA 5DZ2A 1YHKA 5AELA 3LK5A 3ZMBA 3AQCB 5ILIA 2Q9YA 2Z4WA 2EWGA 5IMNA 2OGDA 4HD1A 4LPGF 2OPNA 2OA6A 3M00A 4UMJA 4QPFA 5B0IA 1RQIA 1YYUA 4KQUA 3KRCA 3CC9A 3PYAA 1UBWA 4KK2A 3W7FA 5HNAA 1WL2A 3IBAA 1V4EA 4XQSF 3B7LA 5B0KA 2AZJA 4XQRF 3WEFA 5IKAA 2AZLA 5IL3A 5JV2F 5DGMF 3N3DA 5B00A 3VJ8A 3WCFA 2J1OA 4JZXA 2Z52A 3WCAA 2E93A 3P41A 3WEKA 4GA3A 3AE0A 3PKOA 4LA6A 4LUUA 5DGSF 1WKZA 4NKEA 4FP4A 3AQ0A 3RYWA 3LGKA 3PDEA 3RYEA 4JVJF 3NRIA 3WJNA 2Z7HA 3KRAA 5B0MA 4F6XA 5ILZA 2PS8A 4LLSA 4KPDA 1HX9A 3EFQA
chains in the Genus database with same CATH superfamily
1WL0A 1N1ZA 3P8LA 2F94F 1HM4A 3AQBB 3TS7A 3SDQA 1KIYA 3LOMA 3Q30A 1V4IA 5HN8A 4WK5A 3EGTA 5EASA 3RBMA 2P1CA 1N23A 4E9ZA 2E90A 4PVYF 4KVDA 4E9UA 3WCBA 4H5EF 2ZCQA 1KIZA 3LEEA 5ILHA 5ERNA 3WEGA 3N1WF 3ZOUA 5DIQF 5A0JA 4GP2A 1JFGA 4LA5A 3N1VF 4RXDA 2E8XA 3ICMA 4RXEA 3N46F 4F62A 3LJIA 3DYHA 2ZEVA 2RAHA 3WCHA 1RQJA 5I1UA 3LZ9A 5KSXF 2E4OA 2ONGA 4H5DF 4MC8A 4DWGA 3KROB 4OMGA 3WSAA 3ZL6A 3LMDA 4NUAA 5IL8A 4OKZA 1WY0A 5B02A 1FPSA 4LXWA 3N49F 4LFGA 5IN8A 3N3LF 3N45F 2AEKA 4NFIF 4MC0A 3WE9A 5DJPF 3LSNA 3PYBA 4RXCA 3KRPB 3ZMCA 2Q58A 2E92A 3NPRA 3S9VA 1YHMA 3WCLA 1UBXA 1N20A 3KB9A 4DI5A 2FTZA 3V66A 3OABB 5B03A 2O1OA 4FJQA 3VJAA 3ACWA 2ONHA 3CP6A 1N1BA 4K10A 2E8WA 4LFEA 4NKFA 4H5CF 3QQVA 1HM7A 3ICKA 4PVXF 4XQTF 4KVWA 3Q2QA 4MC3A 3PH7A 1V4JA 3LDWA 4JXYA 3WCEA 2ZEUA 3WEIA 5DJVF 3VJDA 1N22A 2FORA 2Z78A 3APZA 4DZWA 1V4HA 2Z7IA 3ADZA 5ILYA 2I19A 2PS5A 3SDTA 5B01A 3KRFB 3M01A 3NPKA 4KFAA 3N5HF 5HN7A 4RYPA 3V1VA 3LVSA 3DYFA 1VG6A 5ERMA 4P0VA 3ASXA 4KQ5A 4KQSA 2AZKA 5EROA 2Z4VA 2Z4YA 5B0JA 3WC9A 3IPIA 1UBVA 1YYRA 5JV1F 1JFAA 4LTVA 5IK9A 4OGUA 1HXCA 2H8OA 4NG6A 5IK6A 3WCGA 1VG3A 4KUXA 1HXGA 3WEHA 3G4FA 5IMIA 3SAEA 5JV0F 3P5PA 3LLWA 1N24A 3KBKA 3ACYA 3P5RA 3KROA 3QKCA 2Q80A 4LZ0A 3Q2ZA 4LPHF 5CG6A 5B0LA 3OYRA 5E8KA 3TFNA 1VG7A 4N1ZF 5DGNF 2J5CA 4ZQ8A 5EATA 3MAVA 1HXAA 3KRPA 4NFKF 5AFXA 1PS1A 4OMHA 4DXJA 4LOBA 2F8CF 3BNXA 4KPJA 4RNQA 1DI1A 5E8HA 5IKHA 3Q1OA 3N5JF 4KWDA 3OABA 3RMGA 2E95A 4NFJF 2Z4ZA 3NF2A 5DJRF 4L2XF 2DH4A 4P0XA 3ACXA 1WL1A 2Q9ZA 5IM1A 5ILJA 5IVGA 4KKMA 4LTZA 3OACB 3G4DA 4QXSF 3V1XA 4DHDA 3LGZB 4RXAA 1YQ7A 3WCCA 2Z50A 3TC1A 1YYQA 3P8RA 5JUZF 4EA1A 2ZCOA 3VJ9A 2ZCSA 3EZ3A 3BNYA 5DHIA 3KRFA 3WCMA 4GP1A 5A0IA 5DW7A 4DWBA 2VF6A 4EA0A 4LIXA 5IK0A 4JYXA 5H9DA 3WJKA 3WCIA 5IMPA 4N9UA 3SDUA 3LG5A 5AYPA 2ZCRA 3M9UA 2E91A 2PS4A 4GAXA 1RTRA 1WMWA 2OPMA 4LLTA 3KRCB 1N21A 4LZ3A 2Z4XA 3UCAA 5CG5A 1EZFA 4F6VA 3ID0A 4KVYA 3ICNA 2E8TA 5EAUA 3S4JA 1VG2A 3N0GA 1YYTA 2E94A 5ILKA 5HN9A 5A0KA 3VJCA 2F9KF 3ICZA 3MZVA 3DYGA 4OKMA 5E8LA 4KVIA 2F7MF 3N6KF 3SDRA 3SDVA 1YHLA 2E8VA 4DEMF 3ZCDA 1WL3A 2F89F 4P0WA 2QISA 3CKEA 3M0GA 2J1PA 2ZY1A 5JA0F 3KRAB 1V4KA 3WEJA 5ER8A 3VJBA 3OACA 2AELA 4JZBA 3N0FA 1ZW5A 1YJ4A 5C05A 1VG4A 4EA2A 4LFVF 3TFVA 1YV5A 4E1EA 3WCDA 1UBYA 2PS7A 2E8UA 2F92F 3VJEA 3WSBA 4Q23A 5ILDA 3TFPA 3WCJA 5DHKA 2F8ZF 4JXNA 3M02A 4LZCA 5AHUB 1YYSA 2PS6A 3WJOA 1DGPA 2AETA 5DZ2A 1YHKA 5AELA 3LK5A 3ZMBA 3AQCB 5ILIA 2Q9YA 2Z4WA 2EWGA 5IMNA 2OGDA 4HD1A 4LPGF 2OPNA 2OA6A 3M00A 4UMJA 4QPFA 5B0IA 1RQIA 1YYUA 4KQUA 3KRCA 3CC9A 3PYAA 1UBWA 4KK2A 3W7FA 5HNAA 1WL2A 3IBAA 1V4EA 4XQSF 3B7LA 5B0KA 2AZJA 4XQRF 3WEFA 5IKAA 2AZLA 5IL3A 5JV2F 5DGMF 3N3DA 5B00A 3VJ8A 3WCFA 2J1OA 4JZXA 2Z52A 3WCAA 2E93A 3P41A 3WEKA 4GA3A 3AE0A 3PKOA 4LA6A 4LUUA 5DGSF 1WKZA 4NKEA 4FP4A 3AQ0A 3RYWA 3LGKA 3PDEA 3RYEA 4JVJF 3NRIA 3WJNA 2Z7HA 3KRAA 5B0MA 4F6XA 5ILZA 2PS8A 4LLSA 4KPDA 1HX9A 3EFQA
chains in the Genus database with same CATH topology
1WL0A 1N1ZA 3P8LA 2F94F 1HM4A 3AQBB 3TS7A 3SDQA 1KIYA 3LOMA 3Q30A 1V4IA 5HN8A 4WK5A 3EGTA 5EASA 3RBMA 2P1CA 1N23A 4E9ZA 2E90A 4PVYF 4KVDA 4E9UA 3WCBA 4H5EF 2ZCQA 1KIZA 3LEEA 5ILHA 5ERNA 3WEGA 3N1WF 3ZOUA 5DIQF 5A0JA 4GP2A 1JFGA 4LA5A 3N1VF 4RXDA 2E8XA 3ICMA 4RXEA 3N46F 4F62A 3LJIA 3DYHA 2ZEVA 2RAHA 3WCHA 1RQJA 5I1UA 3LZ9A 5KSXF 2E4OA 2ONGA 4H5DF 4MC8A 4DWGA 3KROB 4OMGA 3WSAA 3ZL6A 3LMDA 4NUAA 5IL8A 4OKZA 1WY0A 5B02A 1FPSA 4LXWA 3N49F 4LFGA 5IN8A 3N3LF 3N45F 2AEKA 4NFIF 4MC0A 3WE9A 5DJPF 3LSNA 3PYBA 4RXCA 3KRPB 3ZMCA 2Q58A 2E92A 3NPRA 3S9VA 1YHMA 3WCLA 1UBXA 1N20A 3KB9A 4DI5A 2FTZA 3V66A 3OABB 5B03A 2O1OA 4FJQA 3VJAA 3ACWA 2ONHA 3CP6A 1N1BA 4K10A 2E8WA 4LFEA 4NKFA 4H5CF 3QQVA 1HM7A 3ICKA 4PVXF 4XQTF 4KVWA 3Q2QA 4MC3A 3PH7A 1V4JA 3LDWA 4JXYA 3WCEA 2ZEUA 3WEIA 5DJVF 3VJDA 1N22A 2FORA 2Z78A 3APZA 4DZWA 1V4HA 2Z7IA 3ADZA 5ILYA 2I19A 2PS5A 3SDTA 5B01A 3KRFB 3M01A 3NPKA 4KFAA 3N5HF 5HN7A 4RYPA 3V1VA 3LVSA 3DYFA 1VG6A 5ERMA 4P0VA 3ASXA 4KQ5A 4KQSA 2AZKA 5EROA 2Z4VA 2Z4YA 5B0JA 3WC9A 3IPIA 1UBVA 1YYRA 5JV1F 1JFAA 4LTVA 5IK9A 4OGUA 1HXCA 2H8OA 4NG6A 5IK6A 3WCGA 1VG3A 4KUXA 1HXGA 3WEHA 3G4FA 5IMIA 3SAEA 5JV0F 3P5PA 3LLWA 1N24A 3KBKA 3ACYA 3P5RA 3KROA 3QKCA 2Q80A 4LZ0A 3Q2ZA 4LPHF 5CG6A 5B0LA 3OYRA 5E8KA 3TFNA 1VG7A 4N1ZF 5DGNF 2J5CA 4ZQ8A 5EATA 3MAVA 1HXAA 3KRPA 4NFKF 5AFXA 1PS1A 4OMHA 4DXJA 4LOBA 2F8CF 3BNXA 4KPJA 4RNQA 1DI1A 5E8HA 5IKHA 3Q1OA 3N5JF 4KWDA 3OABA 3RMGA 2E95A 4NFJF 2Z4ZA 3NF2A 5DJRF 4L2XF 2DH4A 4P0XA 3ACXA 1WL1A 2Q9ZA 5IM1A 5ILJA 5IVGA 4KKMA 4LTZA 3OACB 3G4DA 4QXSF 3V1XA 4DHDA 3LGZB 4RXAA 1YQ7A 3WCCA 2Z50A 3TC1A 1YYQA 3P8RA 5JUZF 4EA1A 2ZCOA 3VJ9A 2ZCSA 3EZ3A 3BNYA 5DHIA 3KRFA 3WCMA 4GP1A 5A0IA 5DW7A 4DWBA 2VF6A 4EA0A 4LIXA 5IK0A 4JYXA 5H9DA 3WJKA 3WCIA 5IMPA 4N9UA 3SDUA 3LG5A 5AYPA 2ZCRA 3M9UA 2E91A 2PS4A 4GAXA 1RTRA 1WMWA 2OPMA 4LLTA 3KRCB 1N21A 4LZ3A 2Z4XA 3UCAA 5CG5A 1EZFA 4F6VA 3ID0A 4KVYA 3ICNA 2E8TA 5EAUA 3S4JA 1VG2A 3N0GA 1YYTA 2E94A 5ILKA 5HN9A 5A0KA 3VJCA 2F9KF 3ICZA 3MZVA 3DYGA 4OKMA 5E8LA 4KVIA 2F7MF 3N6KF 3SDRA 3SDVA 1YHLA 2E8VA 4DEMF 3ZCDA 1WL3A 2F89F 4P0WA 2QISA 3CKEA 3M0GA 2J1PA 2ZY1A 5JA0F 3KRAB 1V4KA 3WEJA 5ER8A 3VJBA 3OACA 2AELA 4JZBA 3N0FA 1ZW5A 1YJ4A 5C05A 1VG4A 4EA2A 4LFVF 3TFVA 1YV5A 4E1EA 3WCDA 1UBYA 2PS7A 2E8UA 2F92F 3VJEA 3WSBA 4Q23A 5ILDA 3TFPA 3WCJA 5DHKA 2F8ZF 4JXNA 3M02A 4LZCA 5AHUB 1YYSA 2PS6A 3WJOA 1DGPA 2AETA 5DZ2A 1YHKA 5AELA 3LK5A 3ZMBA 3AQCB 5ILIA 2Q9YA 2Z4WA 2EWGA 5IMNA 2OGDA 4HD1A 4LPGF 2OPNA 2OA6A 3M00A 4UMJA 4QPFA 5B0IA 1RQIA 1YYUA 4KQUA 3KRCA 3CC9A 3PYAA 1UBWA 4KK2A 3W7FA 5HNAA 1WL2A 3IBAA 1V4EA 4XQSF 3B7LA 5B0KA 2AZJA 4XQRF 3WEFA 5IKAA 2AZLA 5IL3A 5JV2F 5DGMF 3N3DA 5B00A 3VJ8A 3WCFA 2J1OA 4JZXA 2Z52A 3WCAA 2E93A 3P41A 3WEKA 4GA3A 3AE0A 3PKOA 4LA6A 4LUUA 5DGSF 1WKZA 4NKEA 4FP4A 3AQ0A 3RYWA 3LGKA 3PDEA 3RYEA 4JVJF 3NRIA 3WJNA 2Z7HA 3KRAA 5B0MA 4F6XA 5ILZA 2PS8A 4LLSA 4KPDA 1HX9A 3EFQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL0 A;  1N1Z A;  3P8L A;  2F94 F;  1HM4 A;  3AQB B;  3TS7 A;  3SDQ A;  1KIY A;  3LOM A;  3Q30 A;  1V4I A;  5HN8 A;  4WK5 A;  3EGT A;  5EAS A;  3RBM A;  2P1C A;  1N23 A;  4E9Z A;  2E90 A;  4PVY F;  4KVD A;  4E9U A;  3WCB A;  4H5E F;  2ZCQ A;  1KIZ A;  3LEE A;  5ILH A;  5ERN A;  3WEG A;  3N1W F;  3ZOU A;  5DIQ F;  5A0J A;  4GP2 A;  1JFG A;  4LA5 A;  3N1V F;  4RXD A;  2E8X A;  3ICM A;  4RXE A;  3N46 F;  4F62 A;  3LJI A;  3DYH A;  2ZEV A;  2RAH A;  3WCH A;  1RQJ A;  5I1U A;  3LZ9 A;  5KSX F;  2E4O A;  2ONG A;  4H5D F;  4MC8 A;  4DWG A;  3KRO B;  4OMG A;  3WSA A;  3ZL6 A;  3LMD A;  4NUA A;  5IL8 A;  4OKZ A;  1WY0 A;  5B02 A;  1FPS A;  4LXW A;  3N49 F;  4LFG A;  5IN8 A;  3N3L F;  3N45 F;  2AEK A;  4NFI F;  4MC0 A;  3WE9 A;  5DJP F;  3LSN A;  3PYB A;  4RXC A;  3KRP B;  3ZMC A;  2Q58 A;  2E92 A;  3NPR A;  3S9V A;  1YHM A;  3WCL A;  1UBX A;  1N20 A;  3KB9 A;  4DI5 A;  2FTZ A;  3V66 A;  3OAB B;  5B03 A;  2O1O A;  4FJQ A;  3VJA A;  3ACW A;  2ONH A;  3CP6 A;  1N1B A;  4K10 A;  2E8W A;  4LFE A;  4NKF A;  4H5C F;  3QQV A;  1HM7 A;  3ICK A;  4PVX F;  4XQT F;  4KVW A;  3Q2Q A;  4MC3 A;  3PH7 A;  1V4J A;  3LDW A;  4JXY A;  3WCE A;  2ZEU A;  3WEI A;  5DJV F;  3VJD A;  1N22 A;  2FOR A;  2Z78 A;  3APZ A;  4DZW A;  1V4H A;  2Z7I A;  3ADZ A;  5ILY A;  2I19 A;  2PS5 A;  3SDT A;  5B01 A;  3KRF B;  3M01 A;  3NPK A;  4KFA A;  3N5H F;  5HN7 A;  4RYP A;  3V1V A;  3LVS A;  3DYF A;  1VG6 A;  5ERM A;  4P0V A;  3ASX A;  4KQ5 A;  4KQS A;  2AZK A;  5ERO A;  2Z4V A;  2Z4Y A;  5B0J A;  3WC9 A;  3IPI A;  1UBV A;  1YYR A;  5JV1 F;  1JFA A;  4LTV A;  5IK9 A;  4OGU A;  1HXC A;  2H8O A;  4NG6 A;  5IK6 A;  3WCG A;  1VG3 A;  4KUX A;  1HXG A;  3WEH A;  3G4F A;  5IMI A;  3SAE A;  5JV0 F;  3P5P A;  3LLW A;  1N24 A;  3KBK A;  3ACY A;  3P5R A;  3KRO A;  3QKC A;  2Q80 A;  4LZ0 A;  3Q2Z A;  4LPH F;  5CG6 A;  5B0L A;  3OYR A;  5E8K A;  3TFN A;  1VG7 A;  4N1Z F;  5DGN F;  2J5C A;  4ZQ8 A;  5EAT A;  3MAV A;  1HXA A;  3KRP A;  4NFK F;  5AFX A;  1PS1 A;  4OMH A;  4DXJ A;  4LOB A;  2F8C F;  3BNX A;  4KPJ A;  4RNQ A;  1DI1 A;  5E8H A;  5IKH A;  3Q1O A;  3N5J F;  4KWD A;  3OAB A;  3RMG A;  2E95 A;  4NFJ F;  2Z4Z A;  3NF2 A;  5DJR F;  4L2X F;  2DH4 A;  4P0X A;  3ACX A;  1WL1 A;  2Q9Z A;  5IM1 A;  5ILJ A;  5IVG A;  4KKM A;  4LTZ A;  3OAC B;  3G4D A;  4QXS F;  3V1X A;  4DHD A;  3LGZ B;  4RXA A;  1YQ7 A;  3WCC A;  2Z50 A;  3TC1 A;  1YYQ A;  3P8R A;  5JUZ F;  4EA1 A;  2ZCO A;  3VJ9 A;  2ZCS A;  3EZ3 A;  3BNY A;  5DHI A;  3KRF A;  3WCM A;  4GP1 A;  5A0I A;  5DW7 A;  4DWB A;  2VF6 A;  4EA0 A;  4LIX A;  5IK0 A;  4JYX A;  5H9D A;  3WJK A;  3WCI A;  5IMP A;  4N9U A;  3SDU A;  3LG5 A;  5AYP A;  2ZCR A;  3M9U A;  2E91 A;  2PS4 A;  4GAX A;  1RTR A;  1WMW A;  2OPM A;  4LLT A;  3KRC B;  1N21 A;  4LZ3 A;  2Z4X A;  3UCA A;  5CG5 A;  1EZF A;  4F6V A;  3ID0 A;  4KVY A;  3ICN A;  2E8T A;  5EAU A;  3S4J A;  1VG2 A;  3N0G A;  1YYT A;  2E94 A;  5ILK A;  5HN9 A;  5A0K A;  3VJC A;  2F9K F;  3ICZ A;  3MZV A;  3DYG A;  4OKM A;  5E8L A;  4KVI A;  2F7M F;  3N6K F;  3SDR A;  3SDV A;  1YHL A;  2E8V A;  4DEM F;  3ZCD A;  1WL3 A;  2F89 F;  4P0W A;  2QIS A;  3CKE A;  3M0G A;  2J1P A;  2ZY1 A;  5JA0 F;  3KRA B;  1V4K A;  3WEJ A;  5ER8 A;  3VJB A;  3OAC A;  2AEL A;  4JZB A;  3N0F A;  1ZW5 A;  1YJ4 A;  5C05 A;  1VG4 A;  4EA2 A;  4LFV F;  3TFV A;  1YV5 A;  4E1E A;  3WCD A;  1UBY A;  2PS7 A;  2E8U A;  2F92 F;  3VJE A;  3WSB A;  4Q23 A;  5ILD A;  3TFP A;  3WCJ A;  5DHK A;  2F8Z F;  4JXN A;  3M02 A;  4LZC A;  5AHU B;  1YYS A;  2PS6 A;  3WJO A;  1DGP A;  2AET A;  5DZ2 A;  1YHK A;  5AEL A;  3LK5 A;  3ZMB A;  3AQC B;  5ILI A;  2Q9Y A;  2Z4W A;  2EWG A;  5IMN A;  2OGD A;  4HD1 A;  4LPG F;  2OPN A;  2OA6 A;  3M00 A;  4UMJ A;  4QPF A;  5B0I A;  1RQI A;  1YYU A;  4KQU A;  3KRC A;  3CC9 A;  3PYA A;  1UBW A;  4KK2 A;  3W7F A;  5HNA A;  1WL2 A;  3IBA A;  1V4E A;  4XQS F;  3B7L A;  5B0K A;  2AZJ A;  4XQR F;  3WEF A;  5IKA A;  2AZL A;  5IL3 A;  5JV2 F;  5DGM F;  3N3D A;  5B00 A;  3VJ8 A;  3WCF A;  2J1O A;  4JZX A;  2Z52 A;  3WCA A;  2E93 A;  3P41 A;  3WEK A;  4GA3 A;  3AE0 A;  3PKO A;  4LA6 A;  4LUU A;  5DGS F;  1WKZ A;  4NKE A;  4FP4 A;  3AQ0 A;  3RYW A;  3LGK A;  3PDE A;  3RYE A;  4JVJ F;  3NRI A;  3WJN A;  2Z7H A;  3KRA A;  5B0M A;  4F6X A;  5ILZ A;  2PS8 A;  4LLS A;  4KPD A;  1HX9 A;  3EFQ A; 
#chains in the Genus database with same CATH topology
 1WL0 A;  1N1Z A;  3P8L A;  2F94 F;  1HM4 A;  3AQB B;  3TS7 A;  3SDQ A;  1KIY A;  3LOM A;  3Q30 A;  1V4I A;  5HN8 A;  4WK5 A;  3EGT A;  5EAS A;  3RBM A;  2P1C A;  1N23 A;  4E9Z A;  2E90 A;  4PVY F;  4KVD A;  4E9U A;  3WCB A;  4H5E F;  2ZCQ A;  1KIZ A;  3LEE A;  5ILH A;  5ERN A;  3WEG A;  3N1W F;  3ZOU A;  5DIQ F;  5A0J A;  4GP2 A;  1JFG A;  4LA5 A;  3N1V F;  4RXD A;  2E8X A;  3ICM A;  4RXE A;  3N46 F;  4F62 A;  3LJI A;  3DYH A;  2ZEV A;  2RAH A;  3WCH A;  1RQJ A;  5I1U A;  3LZ9 A;  5KSX F;  2E4O A;  2ONG A;  4H5D F;  4MC8 A;  4DWG A;  3KRO B;  4OMG A;  3WSA A;  3ZL6 A;  3LMD A;  4NUA A;  5IL8 A;  4OKZ A;  1WY0 A;  5B02 A;  1FPS A;  4LXW A;  3N49 F;  4LFG A;  5IN8 A;  3N3L F;  3N45 F;  2AEK A;  4NFI F;  4MC0 A;  3WE9 A;  5DJP F;  3LSN A;  3PYB A;  4RXC A;  3KRP B;  3ZMC A;  2Q58 A;  2E92 A;  3NPR A;  3S9V A;  1YHM A;  3WCL A;  1UBX A;  1N20 A;  3KB9 A;  4DI5 A;  2FTZ A;  3V66 A;  3OAB B;  5B03 A;  2O1O A;  4FJQ A;  3VJA A;  3ACW A;  2ONH A;  3CP6 A;  1N1B A;  4K10 A;  2E8W A;  4LFE A;  4NKF A;  4H5C F;  3QQV A;  1HM7 A;  3ICK A;  4PVX F;  4XQT F;  4KVW A;  3Q2Q A;  4MC3 A;  3PH7 A;  1V4J A;  3LDW A;  4JXY A;  3WCE A;  2ZEU A;  3WEI A;  5DJV F;  3VJD A;  1N22 A;  2FOR A;  2Z78 A;  3APZ A;  4DZW A;  1V4H A;  2Z7I A;  3ADZ A;  5ILY A;  2I19 A;  2PS5 A;  3SDT A;  5B01 A;  3KRF B;  3M01 A;  3NPK A;  4KFA A;  3N5H F;  5HN7 A;  4RYP A;  3V1V A;  3LVS A;  3DYF A;  1VG6 A;  5ERM A;  4P0V A;  3ASX A;  4KQ5 A;  4KQS A;  2AZK A;  5ERO A;  2Z4V A;  2Z4Y A;  5B0J A;  3WC9 A;  3IPI A;  1UBV A;  1YYR A;  5JV1 F;  1JFA A;  4LTV A;  5IK9 A;  4OGU A;  1HXC A;  2H8O A;  4NG6 A;  5IK6 A;  3WCG A;  1VG3 A;  4KUX A;  1HXG A;  3WEH A;  3G4F A;  5IMI A;  3SAE A;  5JV0 F;  3P5P A;  3LLW A;  1N24 A;  3KBK A;  3ACY A;  3P5R A;  3KRO A;  3QKC A;  2Q80 A;  4LZ0 A;  3Q2Z A;  4LPH F;  5CG6 A;  5B0L A;  3OYR A;  5E8K A;  3TFN A;  1VG7 A;  4N1Z F;  5DGN F;  2J5C A;  4ZQ8 A;  5EAT A;  3MAV A;  1HXA A;  3KRP A;  4NFK F;  5AFX A;  1PS1 A;  4OMH A;  4DXJ A;  4LOB A;  2F8C F;  3BNX A;  4KPJ A;  4RNQ A;  1DI1 A;  5E8H A;  5IKH A;  3Q1O A;  3N5J F;  4KWD A;  3OAB A;  3RMG A;  2E95 A;  4NFJ F;  2Z4Z A;  3NF2 A;  5DJR F;  4L2X F;  2DH4 A;  4P0X A;  3ACX A;  1WL1 A;  2Q9Z A;  5IM1 A;  5ILJ A;  5IVG A;  4KKM A;  4LTZ A;  3OAC B;  3G4D A;  4QXS F;  3V1X A;  4DHD A;  3LGZ B;  4RXA A;  1YQ7 A;  3WCC A;  2Z50 A;  3TC1 A;  1YYQ A;  3P8R A;  5JUZ F;  4EA1 A;  2ZCO A;  3VJ9 A;  2ZCS A;  3EZ3 A;  3BNY A;  5DHI A;  3KRF A;  3WCM A;  4GP1 A;  5A0I A;  5DW7 A;  4DWB A;  2VF6 A;  4EA0 A;  4LIX A;  5IK0 A;  4JYX A;  5H9D A;  3WJK A;  3WCI A;  5IMP A;  4N9U A;  3SDU A;  3LG5 A;  5AYP A;  2ZCR A;  3M9U A;  2E91 A;  2PS4 A;  4GAX A;  1RTR A;  1WMW A;  2OPM A;  4LLT A;  3KRC B;  1N21 A;  4LZ3 A;  2Z4X A;  3UCA A;  5CG5 A;  1EZF A;  4F6V A;  3ID0 A;  4KVY A;  3ICN A;  2E8T A;  5EAU A;  3S4J A;  1VG2 A;  3N0G A;  1YYT A;  2E94 A;  5ILK A;  5HN9 A;  5A0K A;  3VJC A;  2F9K F;  3ICZ A;  3MZV A;  3DYG A;  4OKM A;  5E8L A;  4KVI A;  2F7M F;  3N6K F;  3SDR A;  3SDV A;  1YHL A;  2E8V A;  4DEM F;  3ZCD A;  1WL3 A;  2F89 F;  4P0W A;  2QIS A;  3CKE A;  3M0G A;  2J1P A;  2ZY1 A;  5JA0 F;  3KRA B;  1V4K A;  3WEJ A;  5ER8 A;  3VJB A;  3OAC A;  2AEL A;  4JZB A;  3N0F A;  1ZW5 A;  1YJ4 A;  5C05 A;  1VG4 A;  4EA2 A;  4LFV F;  3TFV A;  1YV5 A;  4E1E A;  3WCD A;  1UBY A;  2PS7 A;  2E8U A;  2F92 F;  3VJE A;  3WSB A;  4Q23 A;  5ILD A;  3TFP A;  3WCJ A;  5DHK A;  2F8Z F;  4JXN A;  3M02 A;  4LZC A;  5AHU B;  1YYS A;  2PS6 A;  3WJO A;  1DGP A;  2AET A;  5DZ2 A;  1YHK A;  5AEL A;  3LK5 A;  3ZMB A;  3AQC B;  5ILI A;  2Q9Y A;  2Z4W A;  2EWG A;  5IMN A;  2OGD A;  4HD1 A;  4LPG F;  2OPN A;  2OA6 A;  3M00 A;  4UMJ A;  4QPF A;  5B0I A;  1RQI A;  1YYU A;  4KQU A;  3KRC A;  3CC9 A;  3PYA A;  1UBW A;  4KK2 A;  3W7F A;  5HNA A;  1WL2 A;  3IBA A;  1V4E A;  4XQS F;  3B7L A;  5B0K A;  2AZJ A;  4XQR F;  3WEF A;  5IKA A;  2AZL A;  5IL3 A;  5JV2 F;  5DGM F;  3N3D A;  5B00 A;  3VJ8 A;  3WCF A;  2J1O A;  4JZX A;  2Z52 A;  3WCA A;  2E93 A;  3P41 A;  3WEK A;  4GA3 A;  3AE0 A;  3PKO A;  4LA6 A;  4LUU A;  5DGS F;  1WKZ A;  4NKE A;  4FP4 A;  3AQ0 A;  3RYW A;  3LGK A;  3PDE A;  3RYE A;  4JVJ F;  3NRI A;  3WJN A;  2Z7H A;  3KRA A;  5B0M A;  4F6X A;  5ILZ A;  2PS8 A;  4LLS A;  4KPD A;  1HX9 A;  3EFQ A; 
#chains in the Genus database with same CATH homology
 1WL0 A;  1N1Z A;  3P8L A;  2F94 F;  1HM4 A;  3AQB B;  3TS7 A;  3SDQ A;  1KIY A;  3LOM A;  3Q30 A;  1V4I A;  5HN8 A;  4WK5 A;  3EGT A;  5EAS A;  3RBM A;  2P1C A;  1N23 A;  4E9Z A;  2E90 A;  4PVY F;  4KVD A;  4E9U A;  3WCB A;  4H5E F;  2ZCQ A;  1KIZ A;  3LEE A;  5ILH A;  5ERN A;  3WEG A;  3N1W F;  3ZOU A;  5DIQ F;  5A0J A;  4GP2 A;  1JFG A;  4LA5 A;  3N1V F;  4RXD A;  2E8X A;  3ICM A;  4RXE A;  3N46 F;  4F62 A;  3LJI A;  3DYH A;  2ZEV A;  2RAH A;  3WCH A;  1RQJ A;  5I1U A;  3LZ9 A;  5KSX F;  2E4O A;  2ONG A;  4H5D F;  4MC8 A;  4DWG A;  3KRO B;  4OMG A;  3WSA A;  3ZL6 A;  3LMD A;  4NUA A;  5IL8 A;  4OKZ A;  1WY0 A;  5B02 A;  1FPS A;  4LXW A;  3N49 F;  4LFG A;  5IN8 A;  3N3L F;  3N45 F;  2AEK A;  4NFI F;  4MC0 A;  3WE9 A;  5DJP F;  3LSN A;  3PYB A;  4RXC A;  3KRP B;  3ZMC A;  2Q58 A;  2E92 A;  3NPR A;  3S9V A;  1YHM A;  3WCL A;  1UBX A;  1N20 A;  3KB9 A;  4DI5 A;  2FTZ A;  3V66 A;  3OAB B;  5B03 A;  2O1O A;  4FJQ A;  3VJA A;  3ACW A;  2ONH A;  3CP6 A;  1N1B A;  4K10 A;  2E8W A;  4LFE A;  4NKF A;  4H5C F;  3QQV A;  1HM7 A;  3ICK A;  4PVX F;  4XQT F;  4KVW A;  3Q2Q A;  4MC3 A;  3PH7 A;  1V4J A;  3LDW A;  4JXY A;  3WCE A;  2ZEU A;  3WEI A;  5DJV F;  3VJD A;  1N22 A;  2FOR A;  2Z78 A;  3APZ A;  4DZW A;  1V4H A;  2Z7I A;  3ADZ A;  5ILY A;  2I19 A;  2PS5 A;  3SDT A;  5B01 A;  3KRF B;  3M01 A;  3NPK A;  4KFA A;  3N5H F;  5HN7 A;  4RYP A;  3V1V A;  3LVS A;  3DYF A;  1VG6 A;  5ERM A;  4P0V A;  3ASX A;  4KQ5 A;  4KQS A;  2AZK A;  5ERO A;  2Z4V A;  2Z4Y A;  5B0J A;  3WC9 A;  3IPI A;  1UBV A;  1YYR A;  5JV1 F;  1JFA A;  4LTV A;  5IK9 A;  4OGU A;  1HXC A;  2H8O A;  4NG6 A;  5IK6 A;  3WCG A;  1VG3 A;  4KUX A;  1HXG A;  3WEH A;  3G4F A;  5IMI A;  3SAE A;  5JV0 F;  3P5P A;  3LLW A;  1N24 A;  3KBK A;  3ACY A;  3P5R A;  3KRO A;  3QKC A;  2Q80 A;  4LZ0 A;  3Q2Z A;  4LPH F;  5CG6 A;  5B0L A;  3OYR A;  5E8K A;  3TFN A;  1VG7 A;  4N1Z F;  5DGN F;  2J5C A;  4ZQ8 A;  5EAT A;  3MAV A;  1HXA A;  3KRP A;  4NFK F;  5AFX A;  1PS1 A;  4OMH A;  4DXJ A;  4LOB A;  2F8C F;  3BNX A;  4KPJ A;  4RNQ A;  1DI1 A;  5E8H A;  5IKH A;  3Q1O A;  3N5J F;  4KWD A;  3OAB A;  3RMG A;  2E95 A;  4NFJ F;  2Z4Z A;  3NF2 A;  5DJR F;  4L2X F;  2DH4 A;  4P0X A;  3ACX A;  1WL1 A;  2Q9Z A;  5IM1 A;  5ILJ A;  5IVG A;  4KKM A;  4LTZ A;  3OAC B;  3G4D A;  4QXS F;  3V1X A;  4DHD A;  3LGZ B;  4RXA A;  1YQ7 A;  3WCC A;  2Z50 A;  3TC1 A;  1YYQ A;  3P8R A;  5JUZ F;  4EA1 A;  2ZCO A;  3VJ9 A;  2ZCS A;  3EZ3 A;  3BNY A;  5DHI A;  3KRF A;  3WCM A;  4GP1 A;  5A0I A;  5DW7 A;  4DWB A;  2VF6 A;  4EA0 A;  4LIX A;  5IK0 A;  4JYX A;  5H9D A;  3WJK A;  3WCI A;  5IMP A;  4N9U A;  3SDU A;  3LG5 A;  5AYP A;  2ZCR A;  3M9U A;  2E91 A;  2PS4 A;  4GAX A;  1RTR A;  1WMW A;  2OPM A;  4LLT A;  3KRC B;  1N21 A;  4LZ3 A;  2Z4X A;  3UCA A;  5CG5 A;  1EZF A;  4F6V A;  3ID0 A;  4KVY A;  3ICN A;  2E8T A;  5EAU A;  3S4J A;  1VG2 A;  3N0G A;  1YYT A;  2E94 A;  5ILK A;  5HN9 A;  5A0K A;  3VJC A;  2F9K F;  3ICZ A;  3MZV A;  3DYG A;  4OKM A;  5E8L A;  4KVI A;  2F7M F;  3N6K F;  3SDR A;  3SDV A;  1YHL A;  2E8V A;  4DEM F;  3ZCD A;  1WL3 A;  2F89 F;  4P0W A;  2QIS A;  3CKE A;  3M0G A;  2J1P A;  2ZY1 A;  5JA0 F;  3KRA B;  1V4K A;  3WEJ A;  5ER8 A;  3VJB A;  3OAC A;  2AEL A;  4JZB A;  3N0F A;  1ZW5 A;  1YJ4 A;  5C05 A;  1VG4 A;  4EA2 A;  4LFV F;  3TFV A;  1YV5 A;  4E1E A;  3WCD A;  1UBY A;  2PS7 A;  2E8U A;  2F92 F;  3VJE A;  3WSB A;  4Q23 A;  5ILD A;  3TFP A;  3WCJ A;  5DHK A;  2F8Z F;  4JXN A;  3M02 A;  4LZC A;  5AHU B;  1YYS A;  2PS6 A;  3WJO A;  1DGP A;  2AET A;  5DZ2 A;  1YHK A;  5AEL A;  3LK5 A;  3ZMB A;  3AQC B;  5ILI A;  2Q9Y A;  2Z4W A;  2EWG A;  5IMN A;  2OGD A;  4HD1 A;  4LPG F;  2OPN A;  2OA6 A;  3M00 A;  4UMJ A;  4QPF A;  5B0I A;  1RQI A;  1YYU A;  4KQU A;  3KRC A;  3CC9 A;  3PYA A;  1UBW A;  4KK2 A;  3W7F A;  5HNA A;  1WL2 A;  3IBA A;  1V4E A;  4XQS F;  3B7L A;  5B0K A;  2AZJ A;  4XQR F;  3WEF A;  5IKA A;  2AZL A;  5IL3 A;  5JV2 F;  5DGM F;  3N3D A;  5B00 A;  3VJ8 A;  3WCF A;  2J1O A;  4JZX A;  2Z52 A;  3WCA A;  2E93 A;  3P41 A;  3WEK A;  4GA3 A;  3AE0 A;  3PKO A;  4LA6 A;  4LUU A;  5DGS F;  1WKZ A;  4NKE A;  4FP4 A;  3AQ0 A;  3RYW A;  3LGK A;  3PDE A;  3RYE A;  4JVJ F;  3NRI A;  3WJN A;  2Z7H A;  3KRA A;  5B0M A;  4F6X A;  5ILZ A;  2PS8 A;  4LLS A;  4KPD A;  1HX9 A;  3EFQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...