4EA1A

Co-crystal structure of dehydrosqualene synthase (crtm) from s. aureus with sq-109
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
280
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 114
structure length 280
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4ea1A00
2AZKA 4LLTA 5IMPA 2AELA 2Z4YA 4KVDA 4RYPA 2PS8A 2E94A 2PS5A 2Z4WA 4RXAA 4Q23A 3SAEA 3LOMA 5AFXA 1JFGA 3PDEA 2ZCOA 5E8HA 3QQVA 5EROA 1WL1A 3PKOA 4PVXF 2ZCRA 4DHDA 3N49F 5ER8A 4LA5A 5IK9A 4L2XF 4GP1A 5C05A 3TFVA 5IMNA 1VG2A 3Q30A 3LMDA 2AETA 4LZ3A 3VJDA 4DWGA 2Q58A 3KROB 2E4OA 1VG3A 5H9DA 3KRAA 4F6XA 2Q9ZA 1UBXA 4NKFA 3M00A 2E91A 3LGZB 5AYPA 4NG6A 3PYBA 2RAHA 4LFVF 4KPJA 4RNQA 1WL3A 3WCFA 4FP4A 1VG7A 3OYRA 3WCDA 1N24A 4NFJF 2FORA 3LZ9A 5JA0F 3IBAA 5E8LA 5HN8A 1N21A 3ZL6A 3WEJA 3N6KF 3Q2ZA 3OACB 2ZCQA 5B0IA 2F7MF 4LZCA 5ILJA 4EA1A 3WEKA 4F6VA 3OABA 5IM1A 2E92A 2J1OA 3EGTA 3ADZA 5DJPF 3LGKA 3APZA 5EASA 3BNXA 4LFGA 2E90A 4NKEA 3ZMBA 3KRCB 3AQ0A 4DXJA 3WSAA 4XQTF 1YYSA 5B02A 3KRCA 5IKHA 4KVWA 3ZOUA 5DHKA 2F92F 1YYTA 1PS1A 3LLWA 1YHKA 3KRFB 3N0FA 4LXWA 5IMIA 3CC9A 5JV0F 3ID0A 3WCAA 5ILKA 3ACYA 3VJ8A 3KRFA 4H5CF 5DIQF 2E95A 2E8VA 4LOBA 3M9UA 2AZJA 5B00A 4KVIA 3V1XA 2OGDA 4LTVA 5EATA 3KRPA 1WL2A 3M0GA 5E8KA 5A0KA 1V4HA 4LPGF 1YYUA 4DZWA 4KFAA 4RXDA 1FPSA 3WCCA 2I19A 3MAVA 2ZEVA 3WCGA 2Q80A 5DZ2A 3RMGA 3WEFA 2Z7HA 5B03A 4KQUA 3VJ9A 3WCLA 4KKMA 3IPIA 1YJ4A 3BNYA 4PVYF 4JXNA 5ILYA 3WCMA 2F9KF 3S9VA 3TFNA 1V4JA 4EA2A 4KVYA 3G4DA 4E9UA 1VG4A 3SDTA 1N20A 3KROA 2ONHA 4XQRF 3QKCA 5ILIA 5KSXF 4NUAA 3N5HF 5EAUA 2OPMA 1DGPA 5CG5A 2F94F 4QXSF 4LTZA 5DGNF 2DH4A 2F8ZF 3AQBB 2ZY1A 3S4JA 1KIYA 5ERNA 3LK5A 3RYWA 2Z4XA 3G4FA 4N9UA 3TFPA 5HN9A 2VF6A 1N22A 4KQSA 2ZCSA 3SDVA 5I1UA 4OMHA 3NPKA 4LFEA 2P1CA 3WCBA 5ILZA 4OGUA 2J1PA 3N3DA 3OACA 2Q9YA 2E93A 5HNAA 5B0KA 3WJOA 2OA6A 3ASXA 5B0LA 3KBKA 1KIZA 4JVJF 2ZEUA 3ACXA 3WEHA 3LJIA 1YV5A 1N1BA 3WE9A 1RTRA 1UBWA 3N1WF 4KWDA 3UCAA 5CG6A 4LZ0A 3ACWA 4H5DF 3P5PA 3DYGA 4F62A 5B01A 1WY0A 4LLSA 3B7LA 5ILDA 2F8CF 3WJNA 4KPDA 3LG5A 3VJBA 3N45F 4XQSF 4KK2A 5AELA 1RQIA 3VJAA 3Q2QA 1YYRA 4EA0A 2F89F 1HXGA 3V66A 2Z4VA 1YYQA 5DGSF 2ONGA 1HM7A 4P0WA 3ICNA 1VG6A 3AQCB 3EFQA 3NRIA 4OKZA 1EZFA 4DEMF 4H5EF 5DW7A 1HM4A 4MC0A 3SDUA 3P5RA 2PS6A 4P0VA 3N1VF 5ILHA 1V4EA 3PH7A 2E8XA 4DI5A 1WMWA 4KUXA 3N5JF 3ICMA 4N1ZF 1V4IA 5JV2F 1YQ7A 3NF2A 3CKEA 5A0JA 3WEIA 3KB9A 4FJQA 5IVGA 1RQJA 5IK6A 4HD1A 1YHMA 4JYXA 5ERMA 3NPRA 2FTZA 4JZXA 4UMJA 4WK5A 5B0JA 3WC9A 5A0IA 2O1OA 3ZCDA 4ZQ8A 1HXAA 3KRAB 1V4KA 1DI1A 2E8TA 4RXCA 3ICKA 3N0GA 3P8RA 4GP2A 4MC3A 1HXCA 3P8LA 1HX9A 4LUUA 3AE0A 1WKZA 2PS4A 4JZBA 4QPFA 4E9ZA 3WCEA 3CP6A 4E1EA 3WEGA 5JUZF 5DHIA 4KQ5A 3N46F 3DYHA 3Q1OA 4LIXA 2AEKA 3W7FA 2OPNA 3N3LF 4LPHF 3LVSA 3WCJA 3ICZA 4JXYA 4GA3A 5IL8A 3WCIA 2Z7IA 4DWBA 3OABB 3P41A 3LSNA 3VJEA 3VJCA 4LA6A 5DGMF 1ZW5A 2Z50A 4GAXA 2E8WA 4NFIF 5IL3A 4OMGA 2J5CA 4P0XA 3LDWA 3RBMA 2Z52A 1N1ZA 5AHUB 2H8OA 2QISA 4RXEA 5DJVF 3WCHA 2Z4ZA 1WL0A 3ZMCA 4MC8A 2EWGA 1UBVA 3RYEA 2AZLA 3DYFA 3TC1A 5IKAA 5IN8A 3MZVA 4K10A 4OKMA 3WSBA 5HN7A 2PS7A 3PYAA 3LEEA 2E8UA 2Z78A 3EZ3A 1N23A 3M01A 3SDQA 5B0MA 1UBYA 3TS7A 3V1VA 5DJRF 4NFKF 3SDRA 5JV1F 3M02A 1JFAA 3WJKA 1YHLA 5IK0A 3KRPB
chains in the Genus database with same CATH superfamily
2AZKA 4LLTA 5IMPA 2AELA 2Z4YA 4KVDA 4RYPA 2PS8A 2E94A 2PS5A 2Z4WA 4RXAA 4Q23A 3SAEA 3LOMA 5AFXA 1JFGA 3PDEA 2ZCOA 5E8HA 3QQVA 5EROA 1WL1A 3PKOA 4PVXF 2ZCRA 4DHDA 3N49F 5ER8A 4LA5A 5IK9A 4L2XF 4GP1A 5C05A 3TFVA 5IMNA 1VG2A 3Q30A 3LMDA 2AETA 4LZ3A 3VJDA 4DWGA 2Q58A 3KROB 2E4OA 1VG3A 5H9DA 3KRAA 4F6XA 2Q9ZA 1UBXA 4NKFA 3M00A 2E91A 3LGZB 5AYPA 4NG6A 3PYBA 2RAHA 4LFVF 4KPJA 4RNQA 1WL3A 3WCFA 4FP4A 1VG7A 3OYRA 3WCDA 1N24A 4NFJF 2FORA 3LZ9A 5JA0F 3IBAA 5E8LA 5HN8A 1N21A 3ZL6A 3WEJA 3N6KF 3Q2ZA 3OACB 2ZCQA 5B0IA 2F7MF 4LZCA 5ILJA 4EA1A 3WEKA 4F6VA 3OABA 5IM1A 2E92A 2J1OA 3EGTA 3ADZA 5DJPF 3LGKA 3APZA 5EASA 3BNXA 4LFGA 2E90A 4NKEA 3ZMBA 3KRCB 3AQ0A 4DXJA 3WSAA 4XQTF 1YYSA 5B02A 3KRCA 5IKHA 4KVWA 3ZOUA 5DHKA 2F92F 1YYTA 1PS1A 3LLWA 1YHKA 3KRFB 3N0FA 4LXWA 5IMIA 3CC9A 5JV0F 3ID0A 3WCAA 5ILKA 3ACYA 3VJ8A 3KRFA 4H5CF 5DIQF 2E95A 2E8VA 4LOBA 3M9UA 2AZJA 5B00A 4KVIA 3V1XA 2OGDA 4LTVA 5EATA 3KRPA 1WL2A 3M0GA 5E8KA 5A0KA 1V4HA 4LPGF 1YYUA 4DZWA 4KFAA 4RXDA 1FPSA 3WCCA 2I19A 3MAVA 2ZEVA 3WCGA 2Q80A 5DZ2A 3RMGA 3WEFA 2Z7HA 5B03A 4KQUA 3VJ9A 3WCLA 4KKMA 3IPIA 1YJ4A 3BNYA 4PVYF 4JXNA 5ILYA 3WCMA 2F9KF 3S9VA 3TFNA 1V4JA 4EA2A 4KVYA 3G4DA 4E9UA 1VG4A 3SDTA 1N20A 3KROA 2ONHA 4XQRF 3QKCA 5ILIA 5KSXF 4NUAA 3N5HF 5EAUA 2OPMA 1DGPA 5CG5A 2F94F 4QXSF 4LTZA 5DGNF 2DH4A 2F8ZF 3AQBB 2ZY1A 3S4JA 1KIYA 5ERNA 3LK5A 3RYWA 2Z4XA 3G4FA 4N9UA 3TFPA 5HN9A 2VF6A 1N22A 4KQSA 2ZCSA 3SDVA 5I1UA 4OMHA 3NPKA 4LFEA 2P1CA 3WCBA 5ILZA 4OGUA 2J1PA 3N3DA 3OACA 2Q9YA 2E93A 5HNAA 5B0KA 3WJOA 2OA6A 3ASXA 5B0LA 3KBKA 1KIZA 4JVJF 2ZEUA 3ACXA 3WEHA 3LJIA 1YV5A 1N1BA 3WE9A 1RTRA 1UBWA 3N1WF 4KWDA 3UCAA 5CG6A 4LZ0A 3ACWA 4H5DF 3P5PA 3DYGA 4F62A 5B01A 1WY0A 4LLSA 3B7LA 5ILDA 2F8CF 3WJNA 4KPDA 3LG5A 3VJBA 3N45F 4XQSF 4KK2A 5AELA 1RQIA 3VJAA 3Q2QA 1YYRA 4EA0A 2F89F 1HXGA 3V66A 2Z4VA 1YYQA 5DGSF 2ONGA 1HM7A 4P0WA 3ICNA 1VG6A 3AQCB 3EFQA 3NRIA 4OKZA 1EZFA 4DEMF 4H5EF 5DW7A 1HM4A 4MC0A 3SDUA 3P5RA 2PS6A 4P0VA 3N1VF 5ILHA 1V4EA 3PH7A 2E8XA 4DI5A 1WMWA 4KUXA 3N5JF 3ICMA 4N1ZF 1V4IA 5JV2F 1YQ7A 3NF2A 3CKEA 5A0JA 3WEIA 3KB9A 4FJQA 5IVGA 1RQJA 5IK6A 4HD1A 1YHMA 4JYXA 5ERMA 3NPRA 2FTZA 4JZXA 4UMJA 4WK5A 5B0JA 3WC9A 5A0IA 2O1OA 3ZCDA 4ZQ8A 1HXAA 3KRAB 1V4KA 1DI1A 2E8TA 4RXCA 3ICKA 3N0GA 3P8RA 4GP2A 4MC3A 1HXCA 3P8LA 1HX9A 4LUUA 3AE0A 1WKZA 2PS4A 4JZBA 4QPFA 4E9ZA 3WCEA 3CP6A 4E1EA 3WEGA 5JUZF 5DHIA 4KQ5A 3N46F 3DYHA 3Q1OA 4LIXA 2AEKA 3W7FA 2OPNA 3N3LF 4LPHF 3LVSA 3WCJA 3ICZA 4JXYA 4GA3A 5IL8A 3WCIA 2Z7IA 4DWBA 3OABB 3P41A 3LSNA 3VJEA 3VJCA 4LA6A 5DGMF 1ZW5A 2Z50A 4GAXA 2E8WA 4NFIF 5IL3A 4OMGA 2J5CA 4P0XA 3LDWA 3RBMA 2Z52A 1N1ZA 5AHUB 2H8OA 2QISA 4RXEA 5DJVF 3WCHA 2Z4ZA 1WL0A 3ZMCA 4MC8A 2EWGA 1UBVA 3RYEA 2AZLA 3DYFA 3TC1A 5IKAA 5IN8A 3MZVA 4K10A 4OKMA 3WSBA 5HN7A 2PS7A 3PYAA 3LEEA 2E8UA 2Z78A 3EZ3A 1N23A 3M01A 3SDQA 5B0MA 1UBYA 3TS7A 3V1VA 5DJRF 4NFKF 3SDRA 5JV1F 3M02A 1JFAA 3WJKA 1YHLA 5IK0A 3KRPB
chains in the Genus database with same CATH topology
2AZKA 4LLTA 5IMPA 2AELA 2Z4YA 4KVDA 4RYPA 2PS8A 2E94A 2PS5A 2Z4WA 4RXAA 4Q23A 3SAEA 3LOMA 5AFXA 1JFGA 3PDEA 2ZCOA 5E8HA 3QQVA 5EROA 1WL1A 3PKOA 4PVXF 2ZCRA 4DHDA 3N49F 5ER8A 4LA5A 5IK9A 4L2XF 4GP1A 5C05A 3TFVA 5IMNA 1VG2A 3Q30A 3LMDA 2AETA 4LZ3A 3VJDA 4DWGA 2Q58A 3KROB 2E4OA 1VG3A 5H9DA 3KRAA 4F6XA 2Q9ZA 1UBXA 4NKFA 3M00A 2E91A 3LGZB 5AYPA 4NG6A 3PYBA 2RAHA 4LFVF 4KPJA 4RNQA 1WL3A 3WCFA 4FP4A 1VG7A 3OYRA 3WCDA 1N24A 4NFJF 2FORA 3LZ9A 5JA0F 3IBAA 5E8LA 5HN8A 1N21A 3ZL6A 3WEJA 3N6KF 3Q2ZA 3OACB 2ZCQA 5B0IA 2F7MF 4LZCA 5ILJA 4EA1A 3WEKA 4F6VA 3OABA 5IM1A 2E92A 2J1OA 3EGTA 3ADZA 5DJPF 3LGKA 3APZA 5EASA 3BNXA 4LFGA 2E90A 4NKEA 3ZMBA 3KRCB 3AQ0A 4DXJA 3WSAA 4XQTF 1YYSA 5B02A 3KRCA 5IKHA 4KVWA 3ZOUA 5DHKA 2F92F 1YYTA 1PS1A 3LLWA 1YHKA 3KRFB 3N0FA 4LXWA 5IMIA 3CC9A 5JV0F 3ID0A 3WCAA 5ILKA 3ACYA 3VJ8A 3KRFA 4H5CF 5DIQF 2E95A 2E8VA 4LOBA 3M9UA 2AZJA 5B00A 4KVIA 3V1XA 2OGDA 4LTVA 5EATA 3KRPA 1WL2A 3M0GA 5E8KA 5A0KA 1V4HA 4LPGF 1YYUA 4DZWA 4KFAA 4RXDA 1FPSA 3WCCA 2I19A 3MAVA 2ZEVA 3WCGA 2Q80A 5DZ2A 3RMGA 3WEFA 2Z7HA 5B03A 4KQUA 3VJ9A 3WCLA 4KKMA 3IPIA 1YJ4A 3BNYA 4PVYF 4JXNA 5ILYA 3WCMA 2F9KF 3S9VA 3TFNA 1V4JA 4EA2A 4KVYA 3G4DA 4E9UA 1VG4A 3SDTA 1N20A 3KROA 2ONHA 4XQRF 3QKCA 5ILIA 5KSXF 4NUAA 3N5HF 5EAUA 2OPMA 1DGPA 5CG5A 2F94F 4QXSF 4LTZA 5DGNF 2DH4A 2F8ZF 3AQBB 2ZY1A 3S4JA 1KIYA 5ERNA 3LK5A 3RYWA 2Z4XA 3G4FA 4N9UA 3TFPA 5HN9A 2VF6A 1N22A 4KQSA 2ZCSA 3SDVA 5I1UA 4OMHA 3NPKA 4LFEA 2P1CA 3WCBA 5ILZA 4OGUA 2J1PA 3N3DA 3OACA 2Q9YA 2E93A 5HNAA 5B0KA 3WJOA 2OA6A 3ASXA 5B0LA 3KBKA 1KIZA 4JVJF 2ZEUA 3ACXA 3WEHA 3LJIA 1YV5A 1N1BA 3WE9A 1RTRA 1UBWA 3N1WF 4KWDA 3UCAA 5CG6A 4LZ0A 3ACWA 4H5DF 3P5PA 3DYGA 4F62A 5B01A 1WY0A 4LLSA 3B7LA 5ILDA 2F8CF 3WJNA 4KPDA 3LG5A 3VJBA 3N45F 4XQSF 4KK2A 5AELA 1RQIA 3VJAA 3Q2QA 1YYRA 4EA0A 2F89F 1HXGA 3V66A 2Z4VA 1YYQA 5DGSF 2ONGA 1HM7A 4P0WA 3ICNA 1VG6A 3AQCB 3EFQA 3NRIA 4OKZA 1EZFA 4DEMF 4H5EF 5DW7A 1HM4A 4MC0A 3SDUA 3P5RA 2PS6A 4P0VA 3N1VF 5ILHA 1V4EA 3PH7A 2E8XA 4DI5A 1WMWA 4KUXA 3N5JF 3ICMA 4N1ZF 1V4IA 5JV2F 1YQ7A 3NF2A 3CKEA 5A0JA 3WEIA 3KB9A 4FJQA 5IVGA 1RQJA 5IK6A 4HD1A 1YHMA 4JYXA 5ERMA 3NPRA 2FTZA 4JZXA 4UMJA 4WK5A 5B0JA 3WC9A 5A0IA 2O1OA 3ZCDA 4ZQ8A 1HXAA 3KRAB 1V4KA 1DI1A 2E8TA 4RXCA 3ICKA 3N0GA 3P8RA 4GP2A 4MC3A 1HXCA 3P8LA 1HX9A 4LUUA 3AE0A 1WKZA 2PS4A 4JZBA 4QPFA 4E9ZA 3WCEA 3CP6A 4E1EA 3WEGA 5JUZF 5DHIA 4KQ5A 3N46F 3DYHA 3Q1OA 4LIXA 2AEKA 3W7FA 2OPNA 3N3LF 4LPHF 3LVSA 3WCJA 3ICZA 4JXYA 4GA3A 5IL8A 3WCIA 2Z7IA 4DWBA 3OABB 3P41A 3LSNA 3VJEA 3VJCA 4LA6A 5DGMF 1ZW5A 2Z50A 4GAXA 2E8WA 4NFIF 5IL3A 4OMGA 2J5CA 4P0XA 3LDWA 3RBMA 2Z52A 1N1ZA 5AHUB 2H8OA 2QISA 4RXEA 5DJVF 3WCHA 2Z4ZA 1WL0A 3ZMCA 4MC8A 2EWGA 1UBVA 3RYEA 2AZLA 3DYFA 3TC1A 5IKAA 5IN8A 3MZVA 4K10A 4OKMA 3WSBA 5HN7A 2PS7A 3PYAA 3LEEA 2E8UA 2Z78A 3EZ3A 1N23A 3M01A 3SDQA 5B0MA 1UBYA 3TS7A 3V1VA 5DJRF 4NFKF 3SDRA 5JV1F 3M02A 1JFAA 3WJKA 1YHLA 5IK0A 3KRPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZK A;  4LLT A;  5IMP A;  2AEL A;  2Z4Y A;  4KVD A;  4RYP A;  2PS8 A;  2E94 A;  2PS5 A;  2Z4W A;  4RXA A;  4Q23 A;  3SAE A;  3LOM A;  5AFX A;  1JFG A;  3PDE A;  2ZCO A;  5E8H A;  3QQV A;  5ERO A;  1WL1 A;  3PKO A;  4PVX F;  2ZCR A;  4DHD A;  3N49 F;  5ER8 A;  4LA5 A;  5IK9 A;  4L2X F;  4GP1 A;  5C05 A;  3TFV A;  5IMN A;  1VG2 A;  3Q30 A;  3LMD A;  2AET A;  4LZ3 A;  3VJD A;  4DWG A;  2Q58 A;  3KRO B;  2E4O A;  1VG3 A;  5H9D A;  3KRA A;  4F6X A;  2Q9Z A;  1UBX A;  4NKF A;  3M00 A;  2E91 A;  3LGZ B;  5AYP A;  4NG6 A;  3PYB A;  2RAH A;  4LFV F;  4KPJ A;  4RNQ A;  1WL3 A;  3WCF A;  4FP4 A;  1VG7 A;  3OYR A;  3WCD A;  1N24 A;  4NFJ F;  2FOR A;  3LZ9 A;  5JA0 F;  3IBA A;  5E8L A;  5HN8 A;  1N21 A;  3ZL6 A;  3WEJ A;  3N6K F;  3Q2Z A;  3OAC B;  2ZCQ A;  5B0I A;  2F7M F;  4LZC A;  5ILJ A;  4EA1 A;  3WEK A;  4F6V A;  3OAB A;  5IM1 A;  2E92 A;  2J1O A;  3EGT A;  3ADZ A;  5DJP F;  3LGK A;  3APZ A;  5EAS A;  3BNX A;  4LFG A;  2E90 A;  4NKE A;  3ZMB A;  3KRC B;  3AQ0 A;  4DXJ A;  3WSA A;  4XQT F;  1YYS A;  5B02 A;  3KRC A;  5IKH A;  4KVW A;  3ZOU A;  5DHK A;  2F92 F;  1YYT A;  1PS1 A;  3LLW A;  1YHK A;  3KRF B;  3N0F A;  4LXW A;  5IMI A;  3CC9 A;  5JV0 F;  3ID0 A;  3WCA A;  5ILK A;  3ACY A;  3VJ8 A;  3KRF A;  4H5C F;  5DIQ F;  2E95 A;  2E8V A;  4LOB A;  3M9U A;  2AZJ A;  5B00 A;  4KVI A;  3V1X A;  2OGD A;  4LTV A;  5EAT A;  3KRP A;  1WL2 A;  3M0G A;  5E8K A;  5A0K A;  1V4H A;  4LPG F;  1YYU A;  4DZW A;  4KFA A;  4RXD A;  1FPS A;  3WCC A;  2I19 A;  3MAV A;  2ZEV A;  3WCG A;  2Q80 A;  5DZ2 A;  3RMG A;  3WEF A;  2Z7H A;  5B03 A;  4KQU A;  3VJ9 A;  3WCL A;  4KKM A;  3IPI A;  1YJ4 A;  3BNY A;  4PVY F;  4JXN A;  5ILY A;  3WCM A;  2F9K F;  3S9V A;  3TFN A;  1V4J A;  4EA2 A;  4KVY A;  3G4D A;  4E9U A;  1VG4 A;  3SDT A;  1N20 A;  3KRO A;  2ONH A;  4XQR F;  3QKC A;  5ILI A;  5KSX F;  4NUA A;  3N5H F;  5EAU A;  2OPM A;  1DGP A;  5CG5 A;  2F94 F;  4QXS F;  4LTZ A;  5DGN F;  2DH4 A;  2F8Z F;  3AQB B;  2ZY1 A;  3S4J A;  1KIY A;  5ERN A;  3LK5 A;  3RYW A;  2Z4X A;  3G4F A;  4N9U A;  3TFP A;  5HN9 A;  2VF6 A;  1N22 A;  4KQS A;  2ZCS A;  3SDV A;  5I1U A;  4OMH A;  3NPK A;  4LFE A;  2P1C A;  3WCB A;  5ILZ A;  4OGU A;  2J1P A;  3N3D A;  3OAC A;  2Q9Y A;  2E93 A;  5HNA A;  5B0K A;  3WJO A;  2OA6 A;  3ASX A;  5B0L A;  3KBK A;  1KIZ A;  4JVJ F;  2ZEU A;  3ACX A;  3WEH A;  3LJI A;  1YV5 A;  1N1B A;  3WE9 A;  1RTR A;  1UBW A;  3N1W F;  4KWD A;  3UCA A;  5CG6 A;  4LZ0 A;  3ACW A;  4H5D F;  3P5P A;  3DYG A;  4F62 A;  5B01 A;  1WY0 A;  4LLS A;  3B7L A;  5ILD A;  2F8C F;  3WJN A;  4KPD A;  3LG5 A;  3VJB A;  3N45 F;  4XQS F;  4KK2 A;  5AEL A;  1RQI A;  3VJA A;  3Q2Q A;  1YYR A;  4EA0 A;  2F89 F;  1HXG A;  3V66 A;  2Z4V A;  1YYQ A;  5DGS F;  2ONG A;  1HM7 A;  4P0W A;  3ICN A;  1VG6 A;  3AQC B;  3EFQ A;  3NRI A;  4OKZ A;  1EZF A;  4DEM F;  4H5E F;  5DW7 A;  1HM4 A;  4MC0 A;  3SDU A;  3P5R A;  2PS6 A;  4P0V A;  3N1V F;  5ILH A;  1V4E A;  3PH7 A;  2E8X A;  4DI5 A;  1WMW A;  4KUX A;  3N5J F;  3ICM A;  4N1Z F;  1V4I A;  5JV2 F;  1YQ7 A;  3NF2 A;  3CKE A;  5A0J A;  3WEI A;  3KB9 A;  4FJQ A;  5IVG A;  1RQJ A;  5IK6 A;  4HD1 A;  1YHM A;  4JYX A;  5ERM A;  3NPR A;  2FTZ A;  4JZX A;  4UMJ A;  4WK5 A;  5B0J A;  3WC9 A;  5A0I A;  2O1O A;  3ZCD A;  4ZQ8 A;  1HXA A;  3KRA B;  1V4K A;  1DI1 A;  2E8T A;  4RXC A;  3ICK A;  3N0G A;  3P8R A;  4GP2 A;  4MC3 A;  1HXC A;  3P8L A;  1HX9 A;  4LUU A;  3AE0 A;  1WKZ A;  2PS4 A;  4JZB A;  4QPF A;  4E9Z A;  3WCE A;  3CP6 A;  4E1E A;  3WEG A;  5JUZ F;  5DHI A;  4KQ5 A;  3N46 F;  3DYH A;  3Q1O A;  4LIX A;  2AEK A;  3W7F A;  2OPN A;  3N3L F;  4LPH F;  3LVS A;  3WCJ A;  3ICZ A;  4JXY A;  4GA3 A;  5IL8 A;  3WCI A;  2Z7I A;  4DWB A;  3OAB B;  3P41 A;  3LSN A;  3VJE A;  3VJC A;  4LA6 A;  5DGM F;  1ZW5 A;  2Z50 A;  4GAX A;  2E8W A;  4NFI F;  5IL3 A;  4OMG A;  2J5C A;  4P0X A;  3LDW A;  3RBM A;  2Z52 A;  1N1Z A;  5AHU B;  2H8O A;  2QIS A;  4RXE A;  5DJV F;  3WCH A;  2Z4Z A;  1WL0 A;  3ZMC A;  4MC8 A;  2EWG A;  1UBV A;  3RYE A;  2AZL A;  3DYF A;  3TC1 A;  5IKA A;  5IN8 A;  3MZV A;  4K10 A;  4OKM A;  3WSB A;  5HN7 A;  2PS7 A;  3PYA A;  3LEE A;  2E8U A;  2Z78 A;  3EZ3 A;  1N23 A;  3M01 A;  3SDQ A;  5B0M A;  1UBY A;  3TS7 A;  3V1V A;  5DJR F;  4NFK F;  3SDR A;  5JV1 F;  3M02 A;  1JFA A;  3WJK A;  1YHL A;  5IK0 A;  3KRP B; 
#chains in the Genus database with same CATH topology
 2AZK A;  4LLT A;  5IMP A;  2AEL A;  2Z4Y A;  4KVD A;  4RYP A;  2PS8 A;  2E94 A;  2PS5 A;  2Z4W A;  4RXA A;  4Q23 A;  3SAE A;  3LOM A;  5AFX A;  1JFG A;  3PDE A;  2ZCO A;  5E8H A;  3QQV A;  5ERO A;  1WL1 A;  3PKO A;  4PVX F;  2ZCR A;  4DHD A;  3N49 F;  5ER8 A;  4LA5 A;  5IK9 A;  4L2X F;  4GP1 A;  5C05 A;  3TFV A;  5IMN A;  1VG2 A;  3Q30 A;  3LMD A;  2AET A;  4LZ3 A;  3VJD A;  4DWG A;  2Q58 A;  3KRO B;  2E4O A;  1VG3 A;  5H9D A;  3KRA A;  4F6X A;  2Q9Z A;  1UBX A;  4NKF A;  3M00 A;  2E91 A;  3LGZ B;  5AYP A;  4NG6 A;  3PYB A;  2RAH A;  4LFV F;  4KPJ A;  4RNQ A;  1WL3 A;  3WCF A;  4FP4 A;  1VG7 A;  3OYR A;  3WCD A;  1N24 A;  4NFJ F;  2FOR A;  3LZ9 A;  5JA0 F;  3IBA A;  5E8L A;  5HN8 A;  1N21 A;  3ZL6 A;  3WEJ A;  3N6K F;  3Q2Z A;  3OAC B;  2ZCQ A;  5B0I A;  2F7M F;  4LZC A;  5ILJ A;  4EA1 A;  3WEK A;  4F6V A;  3OAB A;  5IM1 A;  2E92 A;  2J1O A;  3EGT A;  3ADZ A;  5DJP F;  3LGK A;  3APZ A;  5EAS A;  3BNX A;  4LFG A;  2E90 A;  4NKE A;  3ZMB A;  3KRC B;  3AQ0 A;  4DXJ A;  3WSA A;  4XQT F;  1YYS A;  5B02 A;  3KRC A;  5IKH A;  4KVW A;  3ZOU A;  5DHK A;  2F92 F;  1YYT A;  1PS1 A;  3LLW A;  1YHK A;  3KRF B;  3N0F A;  4LXW A;  5IMI A;  3CC9 A;  5JV0 F;  3ID0 A;  3WCA A;  5ILK A;  3ACY A;  3VJ8 A;  3KRF A;  4H5C F;  5DIQ F;  2E95 A;  2E8V A;  4LOB A;  3M9U A;  2AZJ A;  5B00 A;  4KVI A;  3V1X A;  2OGD A;  4LTV A;  5EAT A;  3KRP A;  1WL2 A;  3M0G A;  5E8K A;  5A0K A;  1V4H A;  4LPG F;  1YYU A;  4DZW A;  4KFA A;  4RXD A;  1FPS A;  3WCC A;  2I19 A;  3MAV A;  2ZEV A;  3WCG A;  2Q80 A;  5DZ2 A;  3RMG A;  3WEF A;  2Z7H A;  5B03 A;  4KQU A;  3VJ9 A;  3WCL A;  4KKM A;  3IPI A;  1YJ4 A;  3BNY A;  4PVY F;  4JXN A;  5ILY A;  3WCM A;  2F9K F;  3S9V A;  3TFN A;  1V4J A;  4EA2 A;  4KVY A;  3G4D A;  4E9U A;  1VG4 A;  3SDT A;  1N20 A;  3KRO A;  2ONH A;  4XQR F;  3QKC A;  5ILI A;  5KSX F;  4NUA A;  3N5H F;  5EAU A;  2OPM A;  1DGP A;  5CG5 A;  2F94 F;  4QXS F;  4LTZ A;  5DGN F;  2DH4 A;  2F8Z F;  3AQB B;  2ZY1 A;  3S4J A;  1KIY A;  5ERN A;  3LK5 A;  3RYW A;  2Z4X A;  3G4F A;  4N9U A;  3TFP A;  5HN9 A;  2VF6 A;  1N22 A;  4KQS A;  2ZCS A;  3SDV A;  5I1U A;  4OMH A;  3NPK A;  4LFE A;  2P1C A;  3WCB A;  5ILZ A;  4OGU A;  2J1P A;  3N3D A;  3OAC A;  2Q9Y A;  2E93 A;  5HNA A;  5B0K A;  3WJO A;  2OA6 A;  3ASX A;  5B0L A;  3KBK A;  1KIZ A;  4JVJ F;  2ZEU A;  3ACX A;  3WEH A;  3LJI A;  1YV5 A;  1N1B A;  3WE9 A;  1RTR A;  1UBW A;  3N1W F;  4KWD A;  3UCA A;  5CG6 A;  4LZ0 A;  3ACW A;  4H5D F;  3P5P A;  3DYG A;  4F62 A;  5B01 A;  1WY0 A;  4LLS A;  3B7L A;  5ILD A;  2F8C F;  3WJN A;  4KPD A;  3LG5 A;  3VJB A;  3N45 F;  4XQS F;  4KK2 A;  5AEL A;  1RQI A;  3VJA A;  3Q2Q A;  1YYR A;  4EA0 A;  2F89 F;  1HXG A;  3V66 A;  2Z4V A;  1YYQ A;  5DGS F;  2ONG A;  1HM7 A;  4P0W A;  3ICN A;  1VG6 A;  3AQC B;  3EFQ A;  3NRI A;  4OKZ A;  1EZF A;  4DEM F;  4H5E F;  5DW7 A;  1HM4 A;  4MC0 A;  3SDU A;  3P5R A;  2PS6 A;  4P0V A;  3N1V F;  5ILH A;  1V4E A;  3PH7 A;  2E8X A;  4DI5 A;  1WMW A;  4KUX A;  3N5J F;  3ICM A;  4N1Z F;  1V4I A;  5JV2 F;  1YQ7 A;  3NF2 A;  3CKE A;  5A0J A;  3WEI A;  3KB9 A;  4FJQ A;  5IVG A;  1RQJ A;  5IK6 A;  4HD1 A;  1YHM A;  4JYX A;  5ERM A;  3NPR A;  2FTZ A;  4JZX A;  4UMJ A;  4WK5 A;  5B0J A;  3WC9 A;  5A0I A;  2O1O A;  3ZCD A;  4ZQ8 A;  1HXA A;  3KRA B;  1V4K A;  1DI1 A;  2E8T A;  4RXC A;  3ICK A;  3N0G A;  3P8R A;  4GP2 A;  4MC3 A;  1HXC A;  3P8L A;  1HX9 A;  4LUU A;  3AE0 A;  1WKZ A;  2PS4 A;  4JZB A;  4QPF A;  4E9Z A;  3WCE A;  3CP6 A;  4E1E A;  3WEG A;  5JUZ F;  5DHI A;  4KQ5 A;  3N46 F;  3DYH A;  3Q1O A;  4LIX A;  2AEK A;  3W7F A;  2OPN A;  3N3L F;  4LPH F;  3LVS A;  3WCJ A;  3ICZ A;  4JXY A;  4GA3 A;  5IL8 A;  3WCI A;  2Z7I A;  4DWB A;  3OAB B;  3P41 A;  3LSN A;  3VJE A;  3VJC A;  4LA6 A;  5DGM F;  1ZW5 A;  2Z50 A;  4GAX A;  2E8W A;  4NFI F;  5IL3 A;  4OMG A;  2J5C A;  4P0X A;  3LDW A;  3RBM A;  2Z52 A;  1N1Z A;  5AHU B;  2H8O A;  2QIS A;  4RXE A;  5DJV F;  3WCH A;  2Z4Z A;  1WL0 A;  3ZMC A;  4MC8 A;  2EWG A;  1UBV A;  3RYE A;  2AZL A;  3DYF A;  3TC1 A;  5IKA A;  5IN8 A;  3MZV A;  4K10 A;  4OKM A;  3WSB A;  5HN7 A;  2PS7 A;  3PYA A;  3LEE A;  2E8U A;  2Z78 A;  3EZ3 A;  1N23 A;  3M01 A;  3SDQ A;  5B0M A;  1UBY A;  3TS7 A;  3V1V A;  5DJR F;  4NFK F;  3SDR A;  5JV1 F;  3M02 A;  1JFA A;  3WJK A;  1YHL A;  5IK0 A;  3KRP B; 
#chains in the Genus database with same CATH homology
 2AZK A;  4LLT A;  5IMP A;  2AEL A;  2Z4Y A;  4KVD A;  4RYP A;  2PS8 A;  2E94 A;  2PS5 A;  2Z4W A;  4RXA A;  4Q23 A;  3SAE A;  3LOM A;  5AFX A;  1JFG A;  3PDE A;  2ZCO A;  5E8H A;  3QQV A;  5ERO A;  1WL1 A;  3PKO A;  4PVX F;  2ZCR A;  4DHD A;  3N49 F;  5ER8 A;  4LA5 A;  5IK9 A;  4L2X F;  4GP1 A;  5C05 A;  3TFV A;  5IMN A;  1VG2 A;  3Q30 A;  3LMD A;  2AET A;  4LZ3 A;  3VJD A;  4DWG A;  2Q58 A;  3KRO B;  2E4O A;  1VG3 A;  5H9D A;  3KRA A;  4F6X A;  2Q9Z A;  1UBX A;  4NKF A;  3M00 A;  2E91 A;  3LGZ B;  5AYP A;  4NG6 A;  3PYB A;  2RAH A;  4LFV F;  4KPJ A;  4RNQ A;  1WL3 A;  3WCF A;  4FP4 A;  1VG7 A;  3OYR A;  3WCD A;  1N24 A;  4NFJ F;  2FOR A;  3LZ9 A;  5JA0 F;  3IBA A;  5E8L A;  5HN8 A;  1N21 A;  3ZL6 A;  3WEJ A;  3N6K F;  3Q2Z A;  3OAC B;  2ZCQ A;  5B0I A;  2F7M F;  4LZC A;  5ILJ A;  4EA1 A;  3WEK A;  4F6V A;  3OAB A;  5IM1 A;  2E92 A;  2J1O A;  3EGT A;  3ADZ A;  5DJP F;  3LGK A;  3APZ A;  5EAS A;  3BNX A;  4LFG A;  2E90 A;  4NKE A;  3ZMB A;  3KRC B;  3AQ0 A;  4DXJ A;  3WSA A;  4XQT F;  1YYS A;  5B02 A;  3KRC A;  5IKH A;  4KVW A;  3ZOU A;  5DHK A;  2F92 F;  1YYT A;  1PS1 A;  3LLW A;  1YHK A;  3KRF B;  3N0F A;  4LXW A;  5IMI A;  3CC9 A;  5JV0 F;  3ID0 A;  3WCA A;  5ILK A;  3ACY A;  3VJ8 A;  3KRF A;  4H5C F;  5DIQ F;  2E95 A;  2E8V A;  4LOB A;  3M9U A;  2AZJ A;  5B00 A;  4KVI A;  3V1X A;  2OGD A;  4LTV A;  5EAT A;  3KRP A;  1WL2 A;  3M0G A;  5E8K A;  5A0K A;  1V4H A;  4LPG F;  1YYU A;  4DZW A;  4KFA A;  4RXD A;  1FPS A;  3WCC A;  2I19 A;  3MAV A;  2ZEV A;  3WCG A;  2Q80 A;  5DZ2 A;  3RMG A;  3WEF A;  2Z7H A;  5B03 A;  4KQU A;  3VJ9 A;  3WCL A;  4KKM A;  3IPI A;  1YJ4 A;  3BNY A;  4PVY F;  4JXN A;  5ILY A;  3WCM A;  2F9K F;  3S9V A;  3TFN A;  1V4J A;  4EA2 A;  4KVY A;  3G4D A;  4E9U A;  1VG4 A;  3SDT A;  1N20 A;  3KRO A;  2ONH A;  4XQR F;  3QKC A;  5ILI A;  5KSX F;  4NUA A;  3N5H F;  5EAU A;  2OPM A;  1DGP A;  5CG5 A;  2F94 F;  4QXS F;  4LTZ A;  5DGN F;  2DH4 A;  2F8Z F;  3AQB B;  2ZY1 A;  3S4J A;  1KIY A;  5ERN A;  3LK5 A;  3RYW A;  2Z4X A;  3G4F A;  4N9U A;  3TFP A;  5HN9 A;  2VF6 A;  1N22 A;  4KQS A;  2ZCS A;  3SDV A;  5I1U A;  4OMH A;  3NPK A;  4LFE A;  2P1C A;  3WCB A;  5ILZ A;  4OGU A;  2J1P A;  3N3D A;  3OAC A;  2Q9Y A;  2E93 A;  5HNA A;  5B0K A;  3WJO A;  2OA6 A;  3ASX A;  5B0L A;  3KBK A;  1KIZ A;  4JVJ F;  2ZEU A;  3ACX A;  3WEH A;  3LJI A;  1YV5 A;  1N1B A;  3WE9 A;  1RTR A;  1UBW A;  3N1W F;  4KWD A;  3UCA A;  5CG6 A;  4LZ0 A;  3ACW A;  4H5D F;  3P5P A;  3DYG A;  4F62 A;  5B01 A;  1WY0 A;  4LLS A;  3B7L A;  5ILD A;  2F8C F;  3WJN A;  4KPD A;  3LG5 A;  3VJB A;  3N45 F;  4XQS F;  4KK2 A;  5AEL A;  1RQI A;  3VJA A;  3Q2Q A;  1YYR A;  4EA0 A;  2F89 F;  1HXG A;  3V66 A;  2Z4V A;  1YYQ A;  5DGS F;  2ONG A;  1HM7 A;  4P0W A;  3ICN A;  1VG6 A;  3AQC B;  3EFQ A;  3NRI A;  4OKZ A;  1EZF A;  4DEM F;  4H5E F;  5DW7 A;  1HM4 A;  4MC0 A;  3SDU A;  3P5R A;  2PS6 A;  4P0V A;  3N1V F;  5ILH A;  1V4E A;  3PH7 A;  2E8X A;  4DI5 A;  1WMW A;  4KUX A;  3N5J F;  3ICM A;  4N1Z F;  1V4I A;  5JV2 F;  1YQ7 A;  3NF2 A;  3CKE A;  5A0J A;  3WEI A;  3KB9 A;  4FJQ A;  5IVG A;  1RQJ A;  5IK6 A;  4HD1 A;  1YHM A;  4JYX A;  5ERM A;  3NPR A;  2FTZ A;  4JZX A;  4UMJ A;  4WK5 A;  5B0J A;  3WC9 A;  5A0I A;  2O1O A;  3ZCD A;  4ZQ8 A;  1HXA A;  3KRA B;  1V4K A;  1DI1 A;  2E8T A;  4RXC A;  3ICK A;  3N0G A;  3P8R A;  4GP2 A;  4MC3 A;  1HXC A;  3P8L A;  1HX9 A;  4LUU A;  3AE0 A;  1WKZ A;  2PS4 A;  4JZB A;  4QPF A;  4E9Z A;  3WCE A;  3CP6 A;  4E1E A;  3WEG A;  5JUZ F;  5DHI A;  4KQ5 A;  3N46 F;  3DYH A;  3Q1O A;  4LIX A;  2AEK A;  3W7F A;  2OPN A;  3N3L F;  4LPH F;  3LVS A;  3WCJ A;  3ICZ A;  4JXY A;  4GA3 A;  5IL8 A;  3WCI A;  2Z7I A;  4DWB A;  3OAB B;  3P41 A;  3LSN A;  3VJE A;  3VJC A;  4LA6 A;  5DGM F;  1ZW5 A;  2Z50 A;  4GAX A;  2E8W A;  4NFI F;  5IL3 A;  4OMG A;  2J5C A;  4P0X A;  3LDW A;  3RBM A;  2Z52 A;  1N1Z A;  5AHU B;  2H8O A;  2QIS A;  4RXE A;  5DJV F;  3WCH A;  2Z4Z A;  1WL0 A;  3ZMC A;  4MC8 A;  2EWG A;  1UBV A;  3RYE A;  2AZL A;  3DYF A;  3TC1 A;  5IKA A;  5IN8 A;  3MZV A;  4K10 A;  4OKM A;  3WSB A;  5HN7 A;  2PS7 A;  3PYA A;  3LEE A;  2E8U A;  2Z78 A;  3EZ3 A;  1N23 A;  3M01 A;  3SDQ A;  5B0M A;  1UBY A;  3TS7 A;  3V1V A;  5DJR F;  4NFK F;  3SDR A;  5JV1 F;  3M02 A;  1JFA A;  3WJK A;  1YHL A;  5IK0 A;  3KRP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...