5B0IA

Structure of moen5-sso7d fusion protein in complex with beta-octyl glucoside
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
266
structure length
266
Chain Sequence
VDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
molecule tags Transferase, dna binding protein
total genus 120
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b0iA00
3LGZB 4JZXA 4GAXA 4DEMF 5IN8A 4NFIF 3N3DA 4LA6A 3M0GA 3ASXA 5B02A 1WL1A 5EAUA 5B0KA 5E8HA 3NRIA 4JZBA 4KQSA 2E94A 4LFEA 1VG7A 1VG2A 2PS7A 2FTZA 4FP4A 5ERMA 4NKFA 3ACWA 3KB9A 3WJKA 2AELA 2E8VA 1WL2A 5ER8A 5CG6A 5IK9A 3ACYA 4NG6A 3LMDA 4E1EA 4KVIA 3VJEA 4Q23A 5H9DA 5IMPA 2ZEVA 1YV5A 2PS8A 2Z50A 2ZCOA 4DI5A 4JXNA 4H5EF 1HXGA 3M9UA 5ILYA 1PS1A 1YHMA 3M02A 4GP2A 3WCIA 3WCEA 2J5CA 1N21A 3WCDA 3ZOUA 3WJOA 3QQVA 2Z52A 5ILZA 3WE9A 3KRPA 3KRFA 3WCFA 1EZFA 3AE0A 1YYRA 4LLSA 5EATA 3SDQA 3PYBA 1N1ZA 3IPIA 3AQCB 4XQRF 3N46F 3N0FA 3MAVA 5HN8A 5B01A 3SAEA 3OYRA 1VG6A 1YYUA 5DGMF 2Q9ZA 2ZCQA 2Z4ZA 3AQ0A 4KQ5A 2ONGA 3EZ3A 1UBVA 3LEEA 2Z4YA 1DGPA 4EA0A 3RBMA 4NFKF 4OKMA 1VG3A 4GA3A 2FORA 3ICKA 4N9UA 5IMNA 3P41A 1N22A 3NF2A 2J1OA 3WEFA 2F7MF 3SDVA 3VJ9A 4KQUA 5EASA 2Z4XA 4LTZA 3ZL6A 4KVWA 1UBWA 1V4IA 3ICMA 2F89F 4KKMA 3WCBA 5DGNF 4XQSF 4JVJF 2E95A 2Q58A 1YHLA 4KVYA 3RMGA 5IKHA 3KRPB 3CC9A 5IM1A 4PVYF 4KPJA 1V4KA 4RXEA 4WK5A 2RAHA 2AZJA 3LVSA 4N1ZF 2Q80A 4LPHF 1YHKA 3OABB 4P0XA 5JUZF 1HM4A 3Q2QA 3DYFA 4MC3A 4H5DF 5DGSF 5A0IA 4FJQA 3WC9A 5IL8A 4KPDA 1V4JA 3SDUA 2DH4A 5HNAA 3S9VA 4E9ZA 4MC8A 4KFAA 1ZW5A 4F6XA 3WEHA 3RYWA 2Q9YA 5B0LA 2F9KF 4LFVF 5E8KA 4XQTF 4EA2A 5AELA 5IMIA 5B00A 3WEIA 5ILJA 3G4FA 1UBYA 3N0GA 4OGUA 3NPKA 3LSNA 1HX9A 2E8TA 3EFQA 4LA5A 3KROB 3P8RA 3LLWA 1HXAA 3B7LA 5DZ2A 3AQBB 2Z78A 4DXJA 1RQJA 3PKOA 2E90A 3LGKA 2E8WA 2H8OA 1YYTA 3V1VA 3KRAA 2E92A 5DJVF 4LZ0A 1RTRA 2AEKA 3VJ8A 4KK2A 5IL3A 1N24A 5AYPA 4LZCA 4RXCA 5IVGA 5JV1F 2F94F 3N5JF 5AHUB 3RYEA 1JFGA 3VJBA 1V4HA 1VG4A 4LXWA 3LK5A 4NKEA 3OACA 3LG5A 2P1CA 3KRCA 3LZ9A 4LOBA 3W7FA 2Z7IA 2I19A 4DWBA 5B0IA 3WCMA 2Z7HA 5ERNA 3DYHA 3WCGA 5AFXA 5EROA 2OA6A 3PH7A 3TFPA 3Q1OA 3APZA 4LFGA 4DHDA 5ILDA 4LZ3A 4RNQA 3SDTA 1RQIA 3VJDA 3TC1A 3ADZA 4OMHA 3N6KF 5DHKA 4F62A 3KRAB 1YYQA 3KRFB 3N45F 1FPSA 3EGTA 4L2XF 3WEKA 3N5HF 3WCCA 3LOMA 2OGDA 2PS6A 4RYPA 1DI1A 5IK0A 2VF6A 2E8UA 3P5PA 4QPFA 3NPRA 3LDWA 4LLTA 5DW7A 2Z4WA 3VJAA 4DWGA 1KIYA 5HN9A 2E4OA 1V4EA 4MC0A 3S4JA 3OACB 3WEGA 1WMWA 2Z4VA 3BNXA 3KRCB 3V1XA 1KIZA 3BNYA 5JV0F 3TS7A 5E8LA 2AZKA 4QXSF 3Q30A 3N1WF 2ZY1A 2OPMA 3WCLA 5A0KA 5KSXF 5HN7A 5B03A 2EWGA 3CP6A 4DZWA 1N20A 3WCHA 2F8CF 3WJNA 2E91A 1HXCA 5C05A 4JXYA 4LIXA 4OKZA 4OMGA 2ZEUA 4GP1A 4P0WA 1YQ7A 4LTVA 5JV2F 3P8LA 3UCAA 3WCJA 3N1VF 3ICZA 3M00A 3QKCA 3PYAA 4KVDA 4PVXF 1WKZA 4RXDA 5I1UA 4UMJA 5CG5A 3N49F 4KWDA 3WSBA 2QISA 5ILIA 3MZVA 2OPNA 3ACXA 1HM7A 4NUAA 3CKEA 3G4DA 5DJPF 3ZCDA 4KUXA 4P0VA 5ILKA 4LUUA 5DJRF 1YJ4A 5IKAA 2O1OA 4LPGF 2E8XA 2PS5A 3WCAA 3WSAA 3M01A 2F92F 1N1BA 3ID0A 2ZCSA 2J1PA 3Q2ZA 3OABA 4JYXA 5DIQF 3TFNA 3N3LF 1WL3A 2AZLA 5JA0F 1N23A 2F8ZF 3ICNA 2E93A 4E9UA 2ONHA 3ZMCA 4F6VA 3ZMBA 4HD1A 5DHIA 3PDEA 1WY0A 5B0JA 4K10A 3V66A 3P5RA 5IK6A 4EA1A 3LJIA 1YYSA 3TFVA 3VJCA 1WL0A 3KROA 2PS4A 2ZCRA 5ILHA 3DYGA 1UBXA 1JFAA 2AETA 3SDRA 4NFJF 3KBKA 3WEJA 4H5CF 5B0MA 5A0JA 4ZQ8A 4RXAA 3IBAA
chains in the Genus database with same CATH superfamily
3LGZB 4JZXA 4GAXA 4DEMF 5IN8A 4NFIF 3N3DA 4LA6A 3M0GA 3ASXA 5B02A 1WL1A 5EAUA 5B0KA 5E8HA 3NRIA 4JZBA 4KQSA 2E94A 4LFEA 1VG7A 1VG2A 2PS7A 2FTZA 4FP4A 5ERMA 4NKFA 3ACWA 3KB9A 3WJKA 2AELA 2E8VA 1WL2A 5ER8A 5CG6A 5IK9A 3ACYA 4NG6A 3LMDA 4E1EA 4KVIA 3VJEA 4Q23A 5H9DA 5IMPA 2ZEVA 1YV5A 2PS8A 2Z50A 2ZCOA 4DI5A 4JXNA 4H5EF 1HXGA 3M9UA 5ILYA 1PS1A 1YHMA 3M02A 4GP2A 3WCIA 3WCEA 2J5CA 1N21A 3WCDA 3ZOUA 3WJOA 3QQVA 2Z52A 5ILZA 3WE9A 3KRPA 3KRFA 3WCFA 1EZFA 3AE0A 1YYRA 4LLSA 5EATA 3SDQA 3PYBA 1N1ZA 3IPIA 3AQCB 4XQRF 3N46F 3N0FA 3MAVA 5HN8A 5B01A 3SAEA 3OYRA 1VG6A 1YYUA 5DGMF 2Q9ZA 2ZCQA 2Z4ZA 3AQ0A 4KQ5A 2ONGA 3EZ3A 1UBVA 3LEEA 2Z4YA 1DGPA 4EA0A 3RBMA 4NFKF 4OKMA 1VG3A 4GA3A 2FORA 3ICKA 4N9UA 5IMNA 3P41A 1N22A 3NF2A 2J1OA 3WEFA 2F7MF 3SDVA 3VJ9A 4KQUA 5EASA 2Z4XA 4LTZA 3ZL6A 4KVWA 1UBWA 1V4IA 3ICMA 2F89F 4KKMA 3WCBA 5DGNF 4XQSF 4JVJF 2E95A 2Q58A 1YHLA 4KVYA 3RMGA 5IKHA 3KRPB 3CC9A 5IM1A 4PVYF 4KPJA 1V4KA 4RXEA 4WK5A 2RAHA 2AZJA 3LVSA 4N1ZF 2Q80A 4LPHF 1YHKA 3OABB 4P0XA 5JUZF 1HM4A 3Q2QA 3DYFA 4MC3A 4H5DF 5DGSF 5A0IA 4FJQA 3WC9A 5IL8A 4KPDA 1V4JA 3SDUA 2DH4A 5HNAA 3S9VA 4E9ZA 4MC8A 4KFAA 1ZW5A 4F6XA 3WEHA 3RYWA 2Q9YA 5B0LA 2F9KF 4LFVF 5E8KA 4XQTF 4EA2A 5AELA 5IMIA 5B00A 3WEIA 5ILJA 3G4FA 1UBYA 3N0GA 4OGUA 3NPKA 3LSNA 1HX9A 2E8TA 3EFQA 4LA5A 3KROB 3P8RA 3LLWA 1HXAA 3B7LA 5DZ2A 3AQBB 2Z78A 4DXJA 1RQJA 3PKOA 2E90A 3LGKA 2E8WA 2H8OA 1YYTA 3V1VA 3KRAA 2E92A 5DJVF 4LZ0A 1RTRA 2AEKA 3VJ8A 4KK2A 5IL3A 1N24A 5AYPA 4LZCA 4RXCA 5IVGA 5JV1F 2F94F 3N5JF 5AHUB 3RYEA 1JFGA 3VJBA 1V4HA 1VG4A 4LXWA 3LK5A 4NKEA 3OACA 3LG5A 2P1CA 3KRCA 3LZ9A 4LOBA 3W7FA 2Z7IA 2I19A 4DWBA 5B0IA 3WCMA 2Z7HA 5ERNA 3DYHA 3WCGA 5AFXA 5EROA 2OA6A 3PH7A 3TFPA 3Q1OA 3APZA 4LFGA 4DHDA 5ILDA 4LZ3A 4RNQA 3SDTA 1RQIA 3VJDA 3TC1A 3ADZA 4OMHA 3N6KF 5DHKA 4F62A 3KRAB 1YYQA 3KRFB 3N45F 1FPSA 3EGTA 4L2XF 3WEKA 3N5HF 3WCCA 3LOMA 2OGDA 2PS6A 4RYPA 1DI1A 5IK0A 2VF6A 2E8UA 3P5PA 4QPFA 3NPRA 3LDWA 4LLTA 5DW7A 2Z4WA 3VJAA 4DWGA 1KIYA 5HN9A 2E4OA 1V4EA 4MC0A 3S4JA 3OACB 3WEGA 1WMWA 2Z4VA 3BNXA 3KRCB 3V1XA 1KIZA 3BNYA 5JV0F 3TS7A 5E8LA 2AZKA 4QXSF 3Q30A 3N1WF 2ZY1A 2OPMA 3WCLA 5A0KA 5KSXF 5HN7A 5B03A 2EWGA 3CP6A 4DZWA 1N20A 3WCHA 2F8CF 3WJNA 2E91A 1HXCA 5C05A 4JXYA 4LIXA 4OKZA 4OMGA 2ZEUA 4GP1A 4P0WA 1YQ7A 4LTVA 5JV2F 3P8LA 3UCAA 3WCJA 3N1VF 3ICZA 3M00A 3QKCA 3PYAA 4KVDA 4PVXF 1WKZA 4RXDA 5I1UA 4UMJA 5CG5A 3N49F 4KWDA 3WSBA 2QISA 5ILIA 3MZVA 2OPNA 3ACXA 1HM7A 4NUAA 3CKEA 3G4DA 5DJPF 3ZCDA 4KUXA 4P0VA 5ILKA 4LUUA 5DJRF 1YJ4A 5IKAA 2O1OA 4LPGF 2E8XA 2PS5A 3WCAA 3WSAA 3M01A 2F92F 1N1BA 3ID0A 2ZCSA 2J1PA 3Q2ZA 3OABA 4JYXA 5DIQF 3TFNA 3N3LF 1WL3A 2AZLA 5JA0F 1N23A 2F8ZF 3ICNA 2E93A 4E9UA 2ONHA 3ZMCA 4F6VA 3ZMBA 4HD1A 5DHIA 3PDEA 1WY0A 5B0JA 4K10A 3V66A 3P5RA 5IK6A 4EA1A 3LJIA 1YYSA 3TFVA 3VJCA 1WL0A 3KROA 2PS4A 2ZCRA 5ILHA 3DYGA 1UBXA 1JFAA 2AETA 3SDRA 4NFJF 3KBKA 3WEJA 4H5CF 5B0MA 5A0JA 4ZQ8A 4RXAA 3IBAA
chains in the Genus database with same CATH topology
3LGZB 4JZXA 4GAXA 4DEMF 5IN8A 4NFIF 3N3DA 4LA6A 3M0GA 3ASXA 5B02A 1WL1A 5EAUA 5B0KA 5E8HA 3NRIA 4JZBA 4KQSA 2E94A 4LFEA 1VG7A 1VG2A 2PS7A 2FTZA 4FP4A 5ERMA 4NKFA 3ACWA 3KB9A 3WJKA 2AELA 2E8VA 1WL2A 5ER8A 5CG6A 5IK9A 3ACYA 4NG6A 3LMDA 4E1EA 4KVIA 3VJEA 4Q23A 5H9DA 5IMPA 2ZEVA 1YV5A 2PS8A 2Z50A 2ZCOA 4DI5A 4JXNA 4H5EF 1HXGA 3M9UA 5ILYA 1PS1A 1YHMA 3M02A 4GP2A 3WCIA 3WCEA 2J5CA 1N21A 3WCDA 3ZOUA 3WJOA 3QQVA 2Z52A 5ILZA 3WE9A 3KRPA 3KRFA 3WCFA 1EZFA 3AE0A 1YYRA 4LLSA 5EATA 3SDQA 3PYBA 1N1ZA 3IPIA 3AQCB 4XQRF 3N46F 3N0FA 3MAVA 5HN8A 5B01A 3SAEA 3OYRA 1VG6A 1YYUA 5DGMF 2Q9ZA 2ZCQA 2Z4ZA 3AQ0A 4KQ5A 2ONGA 3EZ3A 1UBVA 3LEEA 2Z4YA 1DGPA 4EA0A 3RBMA 4NFKF 4OKMA 1VG3A 4GA3A 2FORA 3ICKA 4N9UA 5IMNA 3P41A 1N22A 3NF2A 2J1OA 3WEFA 2F7MF 3SDVA 3VJ9A 4KQUA 5EASA 2Z4XA 4LTZA 3ZL6A 4KVWA 1UBWA 1V4IA 3ICMA 2F89F 4KKMA 3WCBA 5DGNF 4XQSF 4JVJF 2E95A 2Q58A 1YHLA 4KVYA 3RMGA 5IKHA 3KRPB 3CC9A 5IM1A 4PVYF 4KPJA 1V4KA 4RXEA 4WK5A 2RAHA 2AZJA 3LVSA 4N1ZF 2Q80A 4LPHF 1YHKA 3OABB 4P0XA 5JUZF 1HM4A 3Q2QA 3DYFA 4MC3A 4H5DF 5DGSF 5A0IA 4FJQA 3WC9A 5IL8A 4KPDA 1V4JA 3SDUA 2DH4A 5HNAA 3S9VA 4E9ZA 4MC8A 4KFAA 1ZW5A 4F6XA 3WEHA 3RYWA 2Q9YA 5B0LA 2F9KF 4LFVF 5E8KA 4XQTF 4EA2A 5AELA 5IMIA 5B00A 3WEIA 5ILJA 3G4FA 1UBYA 3N0GA 4OGUA 3NPKA 3LSNA 1HX9A 2E8TA 3EFQA 4LA5A 3KROB 3P8RA 3LLWA 1HXAA 3B7LA 5DZ2A 3AQBB 2Z78A 4DXJA 1RQJA 3PKOA 2E90A 3LGKA 2E8WA 2H8OA 1YYTA 3V1VA 3KRAA 2E92A 5DJVF 4LZ0A 1RTRA 2AEKA 3VJ8A 4KK2A 5IL3A 1N24A 5AYPA 4LZCA 4RXCA 5IVGA 5JV1F 2F94F 3N5JF 5AHUB 3RYEA 1JFGA 3VJBA 1V4HA 1VG4A 4LXWA 3LK5A 4NKEA 3OACA 3LG5A 2P1CA 3KRCA 3LZ9A 4LOBA 3W7FA 2Z7IA 2I19A 4DWBA 5B0IA 3WCMA 2Z7HA 5ERNA 3DYHA 3WCGA 5AFXA 5EROA 2OA6A 3PH7A 3TFPA 3Q1OA 3APZA 4LFGA 4DHDA 5ILDA 4LZ3A 4RNQA 3SDTA 1RQIA 3VJDA 3TC1A 3ADZA 4OMHA 3N6KF 5DHKA 4F62A 3KRAB 1YYQA 3KRFB 3N45F 1FPSA 3EGTA 4L2XF 3WEKA 3N5HF 3WCCA 3LOMA 2OGDA 2PS6A 4RYPA 1DI1A 5IK0A 2VF6A 2E8UA 3P5PA 4QPFA 3NPRA 3LDWA 4LLTA 5DW7A 2Z4WA 3VJAA 4DWGA 1KIYA 5HN9A 2E4OA 1V4EA 4MC0A 3S4JA 3OACB 3WEGA 1WMWA 2Z4VA 3BNXA 3KRCB 3V1XA 1KIZA 3BNYA 5JV0F 3TS7A 5E8LA 2AZKA 4QXSF 3Q30A 3N1WF 2ZY1A 2OPMA 3WCLA 5A0KA 5KSXF 5HN7A 5B03A 2EWGA 3CP6A 4DZWA 1N20A 3WCHA 2F8CF 3WJNA 2E91A 1HXCA 5C05A 4JXYA 4LIXA 4OKZA 4OMGA 2ZEUA 4GP1A 4P0WA 1YQ7A 4LTVA 5JV2F 3P8LA 3UCAA 3WCJA 3N1VF 3ICZA 3M00A 3QKCA 3PYAA 4KVDA 4PVXF 1WKZA 4RXDA 5I1UA 4UMJA 5CG5A 3N49F 4KWDA 3WSBA 2QISA 5ILIA 3MZVA 2OPNA 3ACXA 1HM7A 4NUAA 3CKEA 3G4DA 5DJPF 3ZCDA 4KUXA 4P0VA 5ILKA 4LUUA 5DJRF 1YJ4A 5IKAA 2O1OA 4LPGF 2E8XA 2PS5A 3WCAA 3WSAA 3M01A 2F92F 1N1BA 3ID0A 2ZCSA 2J1PA 3Q2ZA 3OABA 4JYXA 5DIQF 3TFNA 3N3LF 1WL3A 2AZLA 5JA0F 1N23A 2F8ZF 3ICNA 2E93A 4E9UA 2ONHA 3ZMCA 4F6VA 3ZMBA 4HD1A 5DHIA 3PDEA 1WY0A 5B0JA 4K10A 3V66A 3P5RA 5IK6A 4EA1A 3LJIA 1YYSA 3TFVA 3VJCA 1WL0A 3KROA 2PS4A 2ZCRA 5ILHA 3DYGA 1UBXA 1JFAA 2AETA 3SDRA 4NFJF 3KBKA 3WEJA 4H5CF 5B0MA 5A0JA 4ZQ8A 4RXAA 3IBAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGZ B;  4JZX A;  4GAX A;  4DEM F;  5IN8 A;  4NFI F;  3N3D A;  4LA6 A;  3M0G A;  3ASX A;  5B02 A;  1WL1 A;  5EAU A;  5B0K A;  5E8H A;  3NRI A;  4JZB A;  4KQS A;  2E94 A;  4LFE A;  1VG7 A;  1VG2 A;  2PS7 A;  2FTZ A;  4FP4 A;  5ERM A;  4NKF A;  3ACW A;  3KB9 A;  3WJK A;  2AEL A;  2E8V A;  1WL2 A;  5ER8 A;  5CG6 A;  5IK9 A;  3ACY A;  4NG6 A;  3LMD A;  4E1E A;  4KVI A;  3VJE A;  4Q23 A;  5H9D A;  5IMP A;  2ZEV A;  1YV5 A;  2PS8 A;  2Z50 A;  2ZCO A;  4DI5 A;  4JXN A;  4H5E F;  1HXG A;  3M9U A;  5ILY A;  1PS1 A;  1YHM A;  3M02 A;  4GP2 A;  3WCI A;  3WCE A;  2J5C A;  1N21 A;  3WCD A;  3ZOU A;  3WJO A;  3QQV A;  2Z52 A;  5ILZ A;  3WE9 A;  3KRP A;  3KRF A;  3WCF A;  1EZF A;  3AE0 A;  1YYR A;  4LLS A;  5EAT A;  3SDQ A;  3PYB A;  1N1Z A;  3IPI A;  3AQC B;  4XQR F;  3N46 F;  3N0F A;  3MAV A;  5HN8 A;  5B01 A;  3SAE A;  3OYR A;  1VG6 A;  1YYU A;  5DGM F;  2Q9Z A;  2ZCQ A;  2Z4Z A;  3AQ0 A;  4KQ5 A;  2ONG A;  3EZ3 A;  1UBV A;  3LEE A;  2Z4Y A;  1DGP A;  4EA0 A;  3RBM A;  4NFK F;  4OKM A;  1VG3 A;  4GA3 A;  2FOR A;  3ICK A;  4N9U A;  5IMN A;  3P41 A;  1N22 A;  3NF2 A;  2J1O A;  3WEF A;  2F7M F;  3SDV A;  3VJ9 A;  4KQU A;  5EAS A;  2Z4X A;  4LTZ A;  3ZL6 A;  4KVW A;  1UBW A;  1V4I A;  3ICM A;  2F89 F;  4KKM A;  3WCB A;  5DGN F;  4XQS F;  4JVJ F;  2E95 A;  2Q58 A;  1YHL A;  4KVY A;  3RMG A;  5IKH A;  3KRP B;  3CC9 A;  5IM1 A;  4PVY F;  4KPJ A;  1V4K A;  4RXE A;  4WK5 A;  2RAH A;  2AZJ A;  3LVS A;  4N1Z F;  2Q80 A;  4LPH F;  1YHK A;  3OAB B;  4P0X A;  5JUZ F;  1HM4 A;  3Q2Q A;  3DYF A;  4MC3 A;  4H5D F;  5DGS F;  5A0I A;  4FJQ A;  3WC9 A;  5IL8 A;  4KPD A;  1V4J A;  3SDU A;  2DH4 A;  5HNA A;  3S9V A;  4E9Z A;  4MC8 A;  4KFA A;  1ZW5 A;  4F6X A;  3WEH A;  3RYW A;  2Q9Y A;  5B0L A;  2F9K F;  4LFV F;  5E8K A;  4XQT F;  4EA2 A;  5AEL A;  5IMI A;  5B00 A;  3WEI A;  5ILJ A;  3G4F A;  1UBY A;  3N0G A;  4OGU A;  3NPK A;  3LSN A;  1HX9 A;  2E8T A;  3EFQ A;  4LA5 A;  3KRO B;  3P8R A;  3LLW A;  1HXA A;  3B7L A;  5DZ2 A;  3AQB B;  2Z78 A;  4DXJ A;  1RQJ A;  3PKO A;  2E90 A;  3LGK A;  2E8W A;  2H8O A;  1YYT A;  3V1V A;  3KRA A;  2E92 A;  5DJV F;  4LZ0 A;  1RTR A;  2AEK A;  3VJ8 A;  4KK2 A;  5IL3 A;  1N24 A;  5AYP A;  4LZC A;  4RXC A;  5IVG A;  5JV1 F;  2F94 F;  3N5J F;  5AHU B;  3RYE A;  1JFG A;  3VJB A;  1V4H A;  1VG4 A;  4LXW A;  3LK5 A;  4NKE A;  3OAC A;  3LG5 A;  2P1C A;  3KRC A;  3LZ9 A;  4LOB A;  3W7F A;  2Z7I A;  2I19 A;  4DWB A;  5B0I A;  3WCM A;  2Z7H A;  5ERN A;  3DYH A;  3WCG A;  5AFX A;  5ERO A;  2OA6 A;  3PH7 A;  3TFP A;  3Q1O A;  3APZ A;  4LFG A;  4DHD A;  5ILD A;  4LZ3 A;  4RNQ A;  3SDT A;  1RQI A;  3VJD A;  3TC1 A;  3ADZ A;  4OMH A;  3N6K F;  5DHK A;  4F62 A;  3KRA B;  1YYQ A;  3KRF B;  3N45 F;  1FPS A;  3EGT A;  4L2X F;  3WEK A;  3N5H F;  3WCC A;  3LOM A;  2OGD A;  2PS6 A;  4RYP A;  1DI1 A;  5IK0 A;  2VF6 A;  2E8U A;  3P5P A;  4QPF A;  3NPR A;  3LDW A;  4LLT A;  5DW7 A;  2Z4W A;  3VJA A;  4DWG A;  1KIY A;  5HN9 A;  2E4O A;  1V4E A;  4MC0 A;  3S4J A;  3OAC B;  3WEG A;  1WMW A;  2Z4V A;  3BNX A;  3KRC B;  3V1X A;  1KIZ A;  3BNY A;  5JV0 F;  3TS7 A;  5E8L A;  2AZK A;  4QXS F;  3Q30 A;  3N1W F;  2ZY1 A;  2OPM A;  3WCL A;  5A0K A;  5KSX F;  5HN7 A;  5B03 A;  2EWG A;  3CP6 A;  4DZW A;  1N20 A;  3WCH A;  2F8C F;  3WJN A;  2E91 A;  1HXC A;  5C05 A;  4JXY A;  4LIX A;  4OKZ A;  4OMG A;  2ZEU A;  4GP1 A;  4P0W A;  1YQ7 A;  4LTV A;  5JV2 F;  3P8L A;  3UCA A;  3WCJ A;  3N1V F;  3ICZ A;  3M00 A;  3QKC A;  3PYA A;  4KVD A;  4PVX F;  1WKZ A;  4RXD A;  5I1U A;  4UMJ A;  5CG5 A;  3N49 F;  4KWD A;  3WSB A;  2QIS A;  5ILI A;  3MZV A;  2OPN A;  3ACX A;  1HM7 A;  4NUA A;  3CKE A;  3G4D A;  5DJP F;  3ZCD A;  4KUX A;  4P0V A;  5ILK A;  4LUU A;  5DJR F;  1YJ4 A;  5IKA A;  2O1O A;  4LPG F;  2E8X A;  2PS5 A;  3WCA A;  3WSA A;  3M01 A;  2F92 F;  1N1B A;  3ID0 A;  2ZCS A;  2J1P A;  3Q2Z A;  3OAB A;  4JYX A;  5DIQ F;  3TFN A;  3N3L F;  1WL3 A;  2AZL A;  5JA0 F;  1N23 A;  2F8Z F;  3ICN A;  2E93 A;  4E9U A;  2ONH A;  3ZMC A;  4F6V A;  3ZMB A;  4HD1 A;  5DHI A;  3PDE A;  1WY0 A;  5B0J A;  4K10 A;  3V66 A;  3P5R A;  5IK6 A;  4EA1 A;  3LJI A;  1YYS A;  3TFV A;  3VJC A;  1WL0 A;  3KRO A;  2PS4 A;  2ZCR A;  5ILH A;  3DYG A;  1UBX A;  1JFA A;  2AET A;  3SDR A;  4NFJ F;  3KBK A;  3WEJ A;  4H5C F;  5B0M A;  5A0J A;  4ZQ8 A;  4RXA A;  3IBA A; 
#chains in the Genus database with same CATH topology
 3LGZ B;  4JZX A;  4GAX A;  4DEM F;  5IN8 A;  4NFI F;  3N3D A;  4LA6 A;  3M0G A;  3ASX A;  5B02 A;  1WL1 A;  5EAU A;  5B0K A;  5E8H A;  3NRI A;  4JZB A;  4KQS A;  2E94 A;  4LFE A;  1VG7 A;  1VG2 A;  2PS7 A;  2FTZ A;  4FP4 A;  5ERM A;  4NKF A;  3ACW A;  3KB9 A;  3WJK A;  2AEL A;  2E8V A;  1WL2 A;  5ER8 A;  5CG6 A;  5IK9 A;  3ACY A;  4NG6 A;  3LMD A;  4E1E A;  4KVI A;  3VJE A;  4Q23 A;  5H9D A;  5IMP A;  2ZEV A;  1YV5 A;  2PS8 A;  2Z50 A;  2ZCO A;  4DI5 A;  4JXN A;  4H5E F;  1HXG A;  3M9U A;  5ILY A;  1PS1 A;  1YHM A;  3M02 A;  4GP2 A;  3WCI A;  3WCE A;  2J5C A;  1N21 A;  3WCD A;  3ZOU A;  3WJO A;  3QQV A;  2Z52 A;  5ILZ A;  3WE9 A;  3KRP A;  3KRF A;  3WCF A;  1EZF A;  3AE0 A;  1YYR A;  4LLS A;  5EAT A;  3SDQ A;  3PYB A;  1N1Z A;  3IPI A;  3AQC B;  4XQR F;  3N46 F;  3N0F A;  3MAV A;  5HN8 A;  5B01 A;  3SAE A;  3OYR A;  1VG6 A;  1YYU A;  5DGM F;  2Q9Z A;  2ZCQ A;  2Z4Z A;  3AQ0 A;  4KQ5 A;  2ONG A;  3EZ3 A;  1UBV A;  3LEE A;  2Z4Y A;  1DGP A;  4EA0 A;  3RBM A;  4NFK F;  4OKM A;  1VG3 A;  4GA3 A;  2FOR A;  3ICK A;  4N9U A;  5IMN A;  3P41 A;  1N22 A;  3NF2 A;  2J1O A;  3WEF A;  2F7M F;  3SDV A;  3VJ9 A;  4KQU A;  5EAS A;  2Z4X A;  4LTZ A;  3ZL6 A;  4KVW A;  1UBW A;  1V4I A;  3ICM A;  2F89 F;  4KKM A;  3WCB A;  5DGN F;  4XQS F;  4JVJ F;  2E95 A;  2Q58 A;  1YHL A;  4KVY A;  3RMG A;  5IKH A;  3KRP B;  3CC9 A;  5IM1 A;  4PVY F;  4KPJ A;  1V4K A;  4RXE A;  4WK5 A;  2RAH A;  2AZJ A;  3LVS A;  4N1Z F;  2Q80 A;  4LPH F;  1YHK A;  3OAB B;  4P0X A;  5JUZ F;  1HM4 A;  3Q2Q A;  3DYF A;  4MC3 A;  4H5D F;  5DGS F;  5A0I A;  4FJQ A;  3WC9 A;  5IL8 A;  4KPD A;  1V4J A;  3SDU A;  2DH4 A;  5HNA A;  3S9V A;  4E9Z A;  4MC8 A;  4KFA A;  1ZW5 A;  4F6X A;  3WEH A;  3RYW A;  2Q9Y A;  5B0L A;  2F9K F;  4LFV F;  5E8K A;  4XQT F;  4EA2 A;  5AEL A;  5IMI A;  5B00 A;  3WEI A;  5ILJ A;  3G4F A;  1UBY A;  3N0G A;  4OGU A;  3NPK A;  3LSN A;  1HX9 A;  2E8T A;  3EFQ A;  4LA5 A;  3KRO B;  3P8R A;  3LLW A;  1HXA A;  3B7L A;  5DZ2 A;  3AQB B;  2Z78 A;  4DXJ A;  1RQJ A;  3PKO A;  2E90 A;  3LGK A;  2E8W A;  2H8O A;  1YYT A;  3V1V A;  3KRA A;  2E92 A;  5DJV F;  4LZ0 A;  1RTR A;  2AEK A;  3VJ8 A;  4KK2 A;  5IL3 A;  1N24 A;  5AYP A;  4LZC A;  4RXC A;  5IVG A;  5JV1 F;  2F94 F;  3N5J F;  5AHU B;  3RYE A;  1JFG A;  3VJB A;  1V4H A;  1VG4 A;  4LXW A;  3LK5 A;  4NKE A;  3OAC A;  3LG5 A;  2P1C A;  3KRC A;  3LZ9 A;  4LOB A;  3W7F A;  2Z7I A;  2I19 A;  4DWB A;  5B0I A;  3WCM A;  2Z7H A;  5ERN A;  3DYH A;  3WCG A;  5AFX A;  5ERO A;  2OA6 A;  3PH7 A;  3TFP A;  3Q1O A;  3APZ A;  4LFG A;  4DHD A;  5ILD A;  4LZ3 A;  4RNQ A;  3SDT A;  1RQI A;  3VJD A;  3TC1 A;  3ADZ A;  4OMH A;  3N6K F;  5DHK A;  4F62 A;  3KRA B;  1YYQ A;  3KRF B;  3N45 F;  1FPS A;  3EGT A;  4L2X F;  3WEK A;  3N5H F;  3WCC A;  3LOM A;  2OGD A;  2PS6 A;  4RYP A;  1DI1 A;  5IK0 A;  2VF6 A;  2E8U A;  3P5P A;  4QPF A;  3NPR A;  3LDW A;  4LLT A;  5DW7 A;  2Z4W A;  3VJA A;  4DWG A;  1KIY A;  5HN9 A;  2E4O A;  1V4E A;  4MC0 A;  3S4J A;  3OAC B;  3WEG A;  1WMW A;  2Z4V A;  3BNX A;  3KRC B;  3V1X A;  1KIZ A;  3BNY A;  5JV0 F;  3TS7 A;  5E8L A;  2AZK A;  4QXS F;  3Q30 A;  3N1W F;  2ZY1 A;  2OPM A;  3WCL A;  5A0K A;  5KSX F;  5HN7 A;  5B03 A;  2EWG A;  3CP6 A;  4DZW A;  1N20 A;  3WCH A;  2F8C F;  3WJN A;  2E91 A;  1HXC A;  5C05 A;  4JXY A;  4LIX A;  4OKZ A;  4OMG A;  2ZEU A;  4GP1 A;  4P0W A;  1YQ7 A;  4LTV A;  5JV2 F;  3P8L A;  3UCA A;  3WCJ A;  3N1V F;  3ICZ A;  3M00 A;  3QKC A;  3PYA A;  4KVD A;  4PVX F;  1WKZ A;  4RXD A;  5I1U A;  4UMJ A;  5CG5 A;  3N49 F;  4KWD A;  3WSB A;  2QIS A;  5ILI A;  3MZV A;  2OPN A;  3ACX A;  1HM7 A;  4NUA A;  3CKE A;  3G4D A;  5DJP F;  3ZCD A;  4KUX A;  4P0V A;  5ILK A;  4LUU A;  5DJR F;  1YJ4 A;  5IKA A;  2O1O A;  4LPG F;  2E8X A;  2PS5 A;  3WCA A;  3WSA A;  3M01 A;  2F92 F;  1N1B A;  3ID0 A;  2ZCS A;  2J1P A;  3Q2Z A;  3OAB A;  4JYX A;  5DIQ F;  3TFN A;  3N3L F;  1WL3 A;  2AZL A;  5JA0 F;  1N23 A;  2F8Z F;  3ICN A;  2E93 A;  4E9U A;  2ONH A;  3ZMC A;  4F6V A;  3ZMB A;  4HD1 A;  5DHI A;  3PDE A;  1WY0 A;  5B0J A;  4K10 A;  3V66 A;  3P5R A;  5IK6 A;  4EA1 A;  3LJI A;  1YYS A;  3TFV A;  3VJC A;  1WL0 A;  3KRO A;  2PS4 A;  2ZCR A;  5ILH A;  3DYG A;  1UBX A;  1JFA A;  2AET A;  3SDR A;  4NFJ F;  3KBK A;  3WEJ A;  4H5C F;  5B0M A;  5A0J A;  4ZQ8 A;  4RXA A;  3IBA A; 
#chains in the Genus database with same CATH homology
 3LGZ B;  4JZX A;  4GAX A;  4DEM F;  5IN8 A;  4NFI F;  3N3D A;  4LA6 A;  3M0G A;  3ASX A;  5B02 A;  1WL1 A;  5EAU A;  5B0K A;  5E8H A;  3NRI A;  4JZB A;  4KQS A;  2E94 A;  4LFE A;  1VG7 A;  1VG2 A;  2PS7 A;  2FTZ A;  4FP4 A;  5ERM A;  4NKF A;  3ACW A;  3KB9 A;  3WJK A;  2AEL A;  2E8V A;  1WL2 A;  5ER8 A;  5CG6 A;  5IK9 A;  3ACY A;  4NG6 A;  3LMD A;  4E1E A;  4KVI A;  3VJE A;  4Q23 A;  5H9D A;  5IMP A;  2ZEV A;  1YV5 A;  2PS8 A;  2Z50 A;  2ZCO A;  4DI5 A;  4JXN A;  4H5E F;  1HXG A;  3M9U A;  5ILY A;  1PS1 A;  1YHM A;  3M02 A;  4GP2 A;  3WCI A;  3WCE A;  2J5C A;  1N21 A;  3WCD A;  3ZOU A;  3WJO A;  3QQV A;  2Z52 A;  5ILZ A;  3WE9 A;  3KRP A;  3KRF A;  3WCF A;  1EZF A;  3AE0 A;  1YYR A;  4LLS A;  5EAT A;  3SDQ A;  3PYB A;  1N1Z A;  3IPI A;  3AQC B;  4XQR F;  3N46 F;  3N0F A;  3MAV A;  5HN8 A;  5B01 A;  3SAE A;  3OYR A;  1VG6 A;  1YYU A;  5DGM F;  2Q9Z A;  2ZCQ A;  2Z4Z A;  3AQ0 A;  4KQ5 A;  2ONG A;  3EZ3 A;  1UBV A;  3LEE A;  2Z4Y A;  1DGP A;  4EA0 A;  3RBM A;  4NFK F;  4OKM A;  1VG3 A;  4GA3 A;  2FOR A;  3ICK A;  4N9U A;  5IMN A;  3P41 A;  1N22 A;  3NF2 A;  2J1O A;  3WEF A;  2F7M F;  3SDV A;  3VJ9 A;  4KQU A;  5EAS A;  2Z4X A;  4LTZ A;  3ZL6 A;  4KVW A;  1UBW A;  1V4I A;  3ICM A;  2F89 F;  4KKM A;  3WCB A;  5DGN F;  4XQS F;  4JVJ F;  2E95 A;  2Q58 A;  1YHL A;  4KVY A;  3RMG A;  5IKH A;  3KRP B;  3CC9 A;  5IM1 A;  4PVY F;  4KPJ A;  1V4K A;  4RXE A;  4WK5 A;  2RAH A;  2AZJ A;  3LVS A;  4N1Z F;  2Q80 A;  4LPH F;  1YHK A;  3OAB B;  4P0X A;  5JUZ F;  1HM4 A;  3Q2Q A;  3DYF A;  4MC3 A;  4H5D F;  5DGS F;  5A0I A;  4FJQ A;  3WC9 A;  5IL8 A;  4KPD A;  1V4J A;  3SDU A;  2DH4 A;  5HNA A;  3S9V A;  4E9Z A;  4MC8 A;  4KFA A;  1ZW5 A;  4F6X A;  3WEH A;  3RYW A;  2Q9Y A;  5B0L A;  2F9K F;  4LFV F;  5E8K A;  4XQT F;  4EA2 A;  5AEL A;  5IMI A;  5B00 A;  3WEI A;  5ILJ A;  3G4F A;  1UBY A;  3N0G A;  4OGU A;  3NPK A;  3LSN A;  1HX9 A;  2E8T A;  3EFQ A;  4LA5 A;  3KRO B;  3P8R A;  3LLW A;  1HXA A;  3B7L A;  5DZ2 A;  3AQB B;  2Z78 A;  4DXJ A;  1RQJ A;  3PKO A;  2E90 A;  3LGK A;  2E8W A;  2H8O A;  1YYT A;  3V1V A;  3KRA A;  2E92 A;  5DJV F;  4LZ0 A;  1RTR A;  2AEK A;  3VJ8 A;  4KK2 A;  5IL3 A;  1N24 A;  5AYP A;  4LZC A;  4RXC A;  5IVG A;  5JV1 F;  2F94 F;  3N5J F;  5AHU B;  3RYE A;  1JFG A;  3VJB A;  1V4H A;  1VG4 A;  4LXW A;  3LK5 A;  4NKE A;  3OAC A;  3LG5 A;  2P1C A;  3KRC A;  3LZ9 A;  4LOB A;  3W7F A;  2Z7I A;  2I19 A;  4DWB A;  5B0I A;  3WCM A;  2Z7H A;  5ERN A;  3DYH A;  3WCG A;  5AFX A;  5ERO A;  2OA6 A;  3PH7 A;  3TFP A;  3Q1O A;  3APZ A;  4LFG A;  4DHD A;  5ILD A;  4LZ3 A;  4RNQ A;  3SDT A;  1RQI A;  3VJD A;  3TC1 A;  3ADZ A;  4OMH A;  3N6K F;  5DHK A;  4F62 A;  3KRA B;  1YYQ A;  3KRF B;  3N45 F;  1FPS A;  3EGT A;  4L2X F;  3WEK A;  3N5H F;  3WCC A;  3LOM A;  2OGD A;  2PS6 A;  4RYP A;  1DI1 A;  5IK0 A;  2VF6 A;  2E8U A;  3P5P A;  4QPF A;  3NPR A;  3LDW A;  4LLT A;  5DW7 A;  2Z4W A;  3VJA A;  4DWG A;  1KIY A;  5HN9 A;  2E4O A;  1V4E A;  4MC0 A;  3S4J A;  3OAC B;  3WEG A;  1WMW A;  2Z4V A;  3BNX A;  3KRC B;  3V1X A;  1KIZ A;  3BNY A;  5JV0 F;  3TS7 A;  5E8L A;  2AZK A;  4QXS F;  3Q30 A;  3N1W F;  2ZY1 A;  2OPM A;  3WCL A;  5A0K A;  5KSX F;  5HN7 A;  5B03 A;  2EWG A;  3CP6 A;  4DZW A;  1N20 A;  3WCH A;  2F8C F;  3WJN A;  2E91 A;  1HXC A;  5C05 A;  4JXY A;  4LIX A;  4OKZ A;  4OMG A;  2ZEU A;  4GP1 A;  4P0W A;  1YQ7 A;  4LTV A;  5JV2 F;  3P8L A;  3UCA A;  3WCJ A;  3N1V F;  3ICZ A;  3M00 A;  3QKC A;  3PYA A;  4KVD A;  4PVX F;  1WKZ A;  4RXD A;  5I1U A;  4UMJ A;  5CG5 A;  3N49 F;  4KWD A;  3WSB A;  2QIS A;  5ILI A;  3MZV A;  2OPN A;  3ACX A;  1HM7 A;  4NUA A;  3CKE A;  3G4D A;  5DJP F;  3ZCD A;  4KUX A;  4P0V A;  5ILK A;  4LUU A;  5DJR F;  1YJ4 A;  5IKA A;  2O1O A;  4LPG F;  2E8X A;  2PS5 A;  3WCA A;  3WSA A;  3M01 A;  2F92 F;  1N1B A;  3ID0 A;  2ZCS A;  2J1P A;  3Q2Z A;  3OAB A;  4JYX A;  5DIQ F;  3TFN A;  3N3L F;  1WL3 A;  2AZL A;  5JA0 F;  1N23 A;  2F8Z F;  3ICN A;  2E93 A;  4E9U A;  2ONH A;  3ZMC A;  4F6V A;  3ZMB A;  4HD1 A;  5DHI A;  3PDE A;  1WY0 A;  5B0J A;  4K10 A;  3V66 A;  3P5R A;  5IK6 A;  4EA1 A;  3LJI A;  1YYS A;  3TFV A;  3VJC A;  1WL0 A;  3KRO A;  2PS4 A;  2ZCR A;  5ILH A;  3DYG A;  1UBX A;  1JFA A;  2AET A;  3SDR A;  4NFJ F;  3KBK A;  3WEJ A;  4H5C F;  5B0M A;  5A0J A;  4ZQ8 A;  4RXA A;  3IBA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...