5B0IA

Structure of moen5-sso7d fusion protein in complex with beta-octyl glucoside
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
266
structure length
266
Chain Sequence
VDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
molecule tags Transferase, dna binding protein
total genus 120
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b0iA00
1N22A 4MC8A 3LVSA 5IM1A 3ZMBA 1WL0A 1JFAA 3WCBA 3ZOUA 3G4DA 5DZ2A 1YQ7A 1YV5A 3P5RA 5ERMA 3N0GA 3PYBA 1N23A 2E4OA 2F89F 4K10A 5A0JA 4NFJF 5JV0F 5JA0F 3WCIA 2Q80A 5EASA 5IL8A 1HXGA 3LEEA 4XQTF 3PYAA 3LOMA 3ZL6A 1V4HA 3RYWA 4WK5A 2E90A 4KKMA 4RXCA 2E94A 3M9UA 4KQUA 1FPSA 4QPFA 5B0KA 2F92F 2VF6A 5B03A 3LDWA 3OABA 2F9KF 3LJIA 5IKAA 1N1ZA 3WSBA 2AEKA 3OACA 5E8KA 4DWBA 3WEIA 2E8XA 4DI5A 5AHUB 2FTZA 3WEKA 3LK5A 4MC3A 4UMJA 3SDUA 3VJBA 3LGKA 2Q58A 3LZ9A 4NKFA 2QISA 2Z7IA 2PS5A 4LZCA 2E93A 4P0XA 1DGPA 5ER8A 4NFIF 5AYPA 3WJKA 3WCJA 2F8ZF 1RTRA 5B0IA 1ZW5A 4LTZA 3CP6A 1YHKA 2Z4YA 3AE0A 3KRAA 3WCHA 2EWGA 1V4KA 3QQVA 2AZKA 1VG7A 3WCEA 4F6VA 1YYUA 4KPDA 2F94F 3N3LF 2Z52A 3BNYA 2O1OA 4GA3A 2ZCRA 5IN8A 3IBAA 4EA1A 3ICKA 1HM7A 2I19A 4LFGA 4DZWA 3V1VA 5I1UA 3ZCDA 3KB9A 1N1BA 3M0GA 2Z7HA 1WL1A 5EAUA 2Z4XA 1KIZA 4P0WA 4RXDA 3UCAA 4NKEA 4KQSA 5A0KA 2OPNA 3Q2ZA 3WCGA 5IK9A 4XQSF 4KVIA 3N45F 3WCDA 3KRPA 4LFEA 4DHDA 1PS1A 4KFAA 3TC1A 3W7FA 3LLWA 4RXEA 2FORA 5DW7A 4PVXF 3WSAA 3KRFA 5IK6A 4JZBA 3M00A 3WCCA 4N1ZF 4DEMF 5DGMF 5IKHA 4DWGA 3PKOA 3VJDA 3SDRA 3WE9A 5IMIA 5DJRF 3G4FA 4KK2A 3M02A 4XQRF 2RAHA 4KQ5A 4JXYA 3WEJA 3LSNA 2ZCSA 5DIQF 3CC9A 3Q30A 4LXWA 4JYXA 2E95A 3QKCA 3VJ8A 4LOBA 4OGUA 4LA5A 4LIXA 3OABB 3WCFA 5B0MA 3V1XA 3OACB 5DGSF 3WCMA 2E8WA 4LPHF 3ACWA 1N21A 2PS6A 4LZ0A 5ILIA 2ONGA 2J1PA 3VJAA 3N0FA 3IPIA 3M01A 4OKMA 1JFGA 4JZXA 4H5EF 2J5CA 2Q9ZA 3RBMA 4ZQ8A 1YYQA 2Z78A 3EGTA 3KRCB 1WY0A 3ICMA 5EROA 2P1CA 3CKEA 4LFVF 2PS4A 4LTVA 4MC0A 4RYPA 3WEGA 4FJQA 5ERNA 5ILKA 4NUAA 2E8UA 5IMNA 3N1WF 1YJ4A 3NPRA 2OA6A 4PVYF 4H5CF 4NG6A 5B0JA 3ZMCA 2Z4ZA 1YHMA 3MAVA 3SDVA 3SDTA 2ZCOA 1YHLA 1UBVA 4GP2A 2AZLA 5E8HA 5IMPA 3DYGA 1VG3A 3OYRA 3N1VF 2E92A 4JXNA 2PS7A 1VG4A 1HXAA 3Q2QA 1N24A 4E9ZA 4DXJA 5AELA 5HNAA 4EA2A 5KSXF 4KUXA 5B01A 3ID0A 4LA6A 4P0VA 4KVDA 5ILDA 4OMGA 3NF2A 4QXSF 5CG5A 5JV2F 5HN7A 3KRPB 5DHIA 1WL2A 5IK0A 3APZA 3KBKA 5H9DA 2AETA 5ILZA 3P8RA 4FP4A 5AFXA 2OGDA 3AQCB 1HXCA 3KROA 5IVGA 3VJ9A 3PDEA 3KRFB 4LPGF 3EFQA 5DHKA 1EZFA 1VG6A 3ACXA 3Q1OA 4E1EA 5A0IA 3ICNA 1RQJA 1WMWA 3BNXA 3TS7A 1DI1A 2ZEUA 3N46F 3SAEA 3LG5A 3DYHA 3VJEA 1RQIA 4KVYA 5CG6A 5B00A 3P41A 1N20A 3V66A 3S9VA 3AQ0A 2OPMA 3B7LA 3NRIA 3N3DA 5ILYA 2F8CF 3P5PA 3EZ3A 2ZCQA 1KIYA 3RYEA 3ASXA 3P8LA 3WEFA 3DYFA 5DGNF 3ICZA 3ADZA 3MZVA 4KPJA 4KVWA 5HN9A 4GAXA 5HN8A 5JV1F 3S4JA 3TFNA 3NPKA 1YYTA 3WC9A 2J1OA 3LGZB 4NFKF 5ILJA 3TFVA 2AELA 1YYRA 3N6KF 1V4IA 2Z4WA 1V4JA 4LLTA 3N5JF 2ONHA 4H5DF 2Q9YA 2E8VA 1UBYA 2ZEVA 3SDQA 2F7MF 2AZJA 1WKZA 1V4EA 5E8LA 5C05A 3KRAB 1UBXA 1HX9A 3KRCA 1UBWA 3PH7A 3N5HF 3RMGA 4E9UA 4F6XA 2H8OA 2E91A 2ZY1A 5B0LA 4OMHA 3WEHA 2PS8A 5IL3A 3VJCA 3WJNA 4Q23A 5ILHA 3N49F 1WL3A 5JUZF 3WJOA 1VG2A 3LMDA 1YYSA 5EATA 2Z50A 5DJVF 4GP1A 4RNQA 4EA0A 4KWDA 4LUUA 4OKZA 4LLSA 4L2XF 5DJPF 1HM4A 4LZ3A 4N9UA 4RXAA 3WCAA 2E8TA 4JVJF 4HD1A 2Z4VA 3AQBB 4F62A 3WCLA 2DH4A 3KROB 3ACYA 3TFPA 5B02A
chains in the Genus database with same CATH superfamily
1N22A 4MC8A 3LVSA 5IM1A 3ZMBA 1WL0A 1JFAA 3WCBA 3ZOUA 3G4DA 5DZ2A 1YQ7A 1YV5A 3P5RA 5ERMA 3N0GA 3PYBA 1N23A 2E4OA 2F89F 4K10A 5A0JA 4NFJF 5JV0F 5JA0F 3WCIA 2Q80A 5EASA 5IL8A 1HXGA 3LEEA 4XQTF 3PYAA 3LOMA 3ZL6A 1V4HA 3RYWA 4WK5A 2E90A 4KKMA 4RXCA 2E94A 3M9UA 4KQUA 1FPSA 4QPFA 5B0KA 2F92F 2VF6A 5B03A 3LDWA 3OABA 2F9KF 3LJIA 5IKAA 1N1ZA 3WSBA 2AEKA 3OACA 5E8KA 4DWBA 3WEIA 2E8XA 4DI5A 5AHUB 2FTZA 3WEKA 3LK5A 4MC3A 4UMJA 3SDUA 3VJBA 3LGKA 2Q58A 3LZ9A 4NKFA 2QISA 2Z7IA 2PS5A 4LZCA 2E93A 4P0XA 1DGPA 5ER8A 4NFIF 5AYPA 3WJKA 3WCJA 2F8ZF 1RTRA 5B0IA 1ZW5A 4LTZA 3CP6A 1YHKA 2Z4YA 3AE0A 3KRAA 3WCHA 2EWGA 1V4KA 3QQVA 2AZKA 1VG7A 3WCEA 4F6VA 1YYUA 4KPDA 2F94F 3N3LF 2Z52A 3BNYA 2O1OA 4GA3A 2ZCRA 5IN8A 3IBAA 4EA1A 3ICKA 1HM7A 2I19A 4LFGA 4DZWA 3V1VA 5I1UA 3ZCDA 3KB9A 1N1BA 3M0GA 2Z7HA 1WL1A 5EAUA 2Z4XA 1KIZA 4P0WA 4RXDA 3UCAA 4NKEA 4KQSA 5A0KA 2OPNA 3Q2ZA 3WCGA 5IK9A 4XQSF 4KVIA 3N45F 3WCDA 3KRPA 4LFEA 4DHDA 1PS1A 4KFAA 3TC1A 3W7FA 3LLWA 4RXEA 2FORA 5DW7A 4PVXF 3WSAA 3KRFA 5IK6A 4JZBA 3M00A 3WCCA 4N1ZF 4DEMF 5DGMF 5IKHA 4DWGA 3PKOA 3VJDA 3SDRA 3WE9A 5IMIA 5DJRF 3G4FA 4KK2A 3M02A 4XQRF 2RAHA 4KQ5A 4JXYA 3WEJA 3LSNA 2ZCSA 5DIQF 3CC9A 3Q30A 4LXWA 4JYXA 2E95A 3QKCA 3VJ8A 4LOBA 4OGUA 4LA5A 4LIXA 3OABB 3WCFA 5B0MA 3V1XA 3OACB 5DGSF 3WCMA 2E8WA 4LPHF 3ACWA 1N21A 2PS6A 4LZ0A 5ILIA 2ONGA 2J1PA 3VJAA 3N0FA 3IPIA 3M01A 4OKMA 1JFGA 4JZXA 4H5EF 2J5CA 2Q9ZA 3RBMA 4ZQ8A 1YYQA 2Z78A 3EGTA 3KRCB 1WY0A 3ICMA 5EROA 2P1CA 3CKEA 4LFVF 2PS4A 4LTVA 4MC0A 4RYPA 3WEGA 4FJQA 5ERNA 5ILKA 4NUAA 2E8UA 5IMNA 3N1WF 1YJ4A 3NPRA 2OA6A 4PVYF 4H5CF 4NG6A 5B0JA 3ZMCA 2Z4ZA 1YHMA 3MAVA 3SDVA 3SDTA 2ZCOA 1YHLA 1UBVA 4GP2A 2AZLA 5E8HA 5IMPA 3DYGA 1VG3A 3OYRA 3N1VF 2E92A 4JXNA 2PS7A 1VG4A 1HXAA 3Q2QA 1N24A 4E9ZA 4DXJA 5AELA 5HNAA 4EA2A 5KSXF 4KUXA 5B01A 3ID0A 4LA6A 4P0VA 4KVDA 5ILDA 4OMGA 3NF2A 4QXSF 5CG5A 5JV2F 5HN7A 3KRPB 5DHIA 1WL2A 5IK0A 3APZA 3KBKA 5H9DA 2AETA 5ILZA 3P8RA 4FP4A 5AFXA 2OGDA 3AQCB 1HXCA 3KROA 5IVGA 3VJ9A 3PDEA 3KRFB 4LPGF 3EFQA 5DHKA 1EZFA 1VG6A 3ACXA 3Q1OA 4E1EA 5A0IA 3ICNA 1RQJA 1WMWA 3BNXA 3TS7A 1DI1A 2ZEUA 3N46F 3SAEA 3LG5A 3DYHA 3VJEA 1RQIA 4KVYA 5CG6A 5B00A 3P41A 1N20A 3V66A 3S9VA 3AQ0A 2OPMA 3B7LA 3NRIA 3N3DA 5ILYA 2F8CF 3P5PA 3EZ3A 2ZCQA 1KIYA 3RYEA 3ASXA 3P8LA 3WEFA 3DYFA 5DGNF 3ICZA 3ADZA 3MZVA 4KPJA 4KVWA 5HN9A 4GAXA 5HN8A 5JV1F 3S4JA 3TFNA 3NPKA 1YYTA 3WC9A 2J1OA 3LGZB 4NFKF 5ILJA 3TFVA 2AELA 1YYRA 3N6KF 1V4IA 2Z4WA 1V4JA 4LLTA 3N5JF 2ONHA 4H5DF 2Q9YA 2E8VA 1UBYA 2ZEVA 3SDQA 2F7MF 2AZJA 1WKZA 1V4EA 5E8LA 5C05A 3KRAB 1UBXA 1HX9A 3KRCA 1UBWA 3PH7A 3N5HF 3RMGA 4E9UA 4F6XA 2H8OA 2E91A 2ZY1A 5B0LA 4OMHA 3WEHA 2PS8A 5IL3A 3VJCA 3WJNA 4Q23A 5ILHA 3N49F 1WL3A 5JUZF 3WJOA 1VG2A 3LMDA 1YYSA 5EATA 2Z50A 5DJVF 4GP1A 4RNQA 4EA0A 4KWDA 4LUUA 4OKZA 4LLSA 4L2XF 5DJPF 1HM4A 4LZ3A 4N9UA 4RXAA 3WCAA 2E8TA 4JVJF 4HD1A 2Z4VA 3AQBB 4F62A 3WCLA 2DH4A 3KROB 3ACYA 3TFPA 5B02A
chains in the Genus database with same CATH topology
1N22A 4MC8A 3LVSA 5IM1A 3ZMBA 1WL0A 1JFAA 3WCBA 3ZOUA 3G4DA 5DZ2A 1YQ7A 1YV5A 3P5RA 5ERMA 3N0GA 3PYBA 1N23A 2E4OA 2F89F 4K10A 5A0JA 4NFJF 5JV0F 5JA0F 3WCIA 2Q80A 5EASA 5IL8A 1HXGA 3LEEA 4XQTF 3PYAA 3LOMA 3ZL6A 1V4HA 3RYWA 4WK5A 2E90A 4KKMA 4RXCA 2E94A 3M9UA 4KQUA 1FPSA 4QPFA 5B0KA 2F92F 2VF6A 5B03A 3LDWA 3OABA 2F9KF 3LJIA 5IKAA 1N1ZA 3WSBA 2AEKA 3OACA 5E8KA 4DWBA 3WEIA 2E8XA 4DI5A 5AHUB 2FTZA 3WEKA 3LK5A 4MC3A 4UMJA 3SDUA 3VJBA 3LGKA 2Q58A 3LZ9A 4NKFA 2QISA 2Z7IA 2PS5A 4LZCA 2E93A 4P0XA 1DGPA 5ER8A 4NFIF 5AYPA 3WJKA 3WCJA 2F8ZF 1RTRA 5B0IA 1ZW5A 4LTZA 3CP6A 1YHKA 2Z4YA 3AE0A 3KRAA 3WCHA 2EWGA 1V4KA 3QQVA 2AZKA 1VG7A 3WCEA 4F6VA 1YYUA 4KPDA 2F94F 3N3LF 2Z52A 3BNYA 2O1OA 4GA3A 2ZCRA 5IN8A 3IBAA 4EA1A 3ICKA 1HM7A 2I19A 4LFGA 4DZWA 3V1VA 5I1UA 3ZCDA 3KB9A 1N1BA 3M0GA 2Z7HA 1WL1A 5EAUA 2Z4XA 1KIZA 4P0WA 4RXDA 3UCAA 4NKEA 4KQSA 5A0KA 2OPNA 3Q2ZA 3WCGA 5IK9A 4XQSF 4KVIA 3N45F 3WCDA 3KRPA 4LFEA 4DHDA 1PS1A 4KFAA 3TC1A 3W7FA 3LLWA 4RXEA 2FORA 5DW7A 4PVXF 3WSAA 3KRFA 5IK6A 4JZBA 3M00A 3WCCA 4N1ZF 4DEMF 5DGMF 5IKHA 4DWGA 3PKOA 3VJDA 3SDRA 3WE9A 5IMIA 5DJRF 3G4FA 4KK2A 3M02A 4XQRF 2RAHA 4KQ5A 4JXYA 3WEJA 3LSNA 2ZCSA 5DIQF 3CC9A 3Q30A 4LXWA 4JYXA 2E95A 3QKCA 3VJ8A 4LOBA 4OGUA 4LA5A 4LIXA 3OABB 3WCFA 5B0MA 3V1XA 3OACB 5DGSF 3WCMA 2E8WA 4LPHF 3ACWA 1N21A 2PS6A 4LZ0A 5ILIA 2ONGA 2J1PA 3VJAA 3N0FA 3IPIA 3M01A 4OKMA 1JFGA 4JZXA 4H5EF 2J5CA 2Q9ZA 3RBMA 4ZQ8A 1YYQA 2Z78A 3EGTA 3KRCB 1WY0A 3ICMA 5EROA 2P1CA 3CKEA 4LFVF 2PS4A 4LTVA 4MC0A 4RYPA 3WEGA 4FJQA 5ERNA 5ILKA 4NUAA 2E8UA 5IMNA 3N1WF 1YJ4A 3NPRA 2OA6A 4PVYF 4H5CF 4NG6A 5B0JA 3ZMCA 2Z4ZA 1YHMA 3MAVA 3SDVA 3SDTA 2ZCOA 1YHLA 1UBVA 4GP2A 2AZLA 5E8HA 5IMPA 3DYGA 1VG3A 3OYRA 3N1VF 2E92A 4JXNA 2PS7A 1VG4A 1HXAA 3Q2QA 1N24A 4E9ZA 4DXJA 5AELA 5HNAA 4EA2A 5KSXF 4KUXA 5B01A 3ID0A 4LA6A 4P0VA 4KVDA 5ILDA 4OMGA 3NF2A 4QXSF 5CG5A 5JV2F 5HN7A 3KRPB 5DHIA 1WL2A 5IK0A 3APZA 3KBKA 5H9DA 2AETA 5ILZA 3P8RA 4FP4A 5AFXA 2OGDA 3AQCB 1HXCA 3KROA 5IVGA 3VJ9A 3PDEA 3KRFB 4LPGF 3EFQA 5DHKA 1EZFA 1VG6A 3ACXA 3Q1OA 4E1EA 5A0IA 3ICNA 1RQJA 1WMWA 3BNXA 3TS7A 1DI1A 2ZEUA 3N46F 3SAEA 3LG5A 3DYHA 3VJEA 1RQIA 4KVYA 5CG6A 5B00A 3P41A 1N20A 3V66A 3S9VA 3AQ0A 2OPMA 3B7LA 3NRIA 3N3DA 5ILYA 2F8CF 3P5PA 3EZ3A 2ZCQA 1KIYA 3RYEA 3ASXA 3P8LA 3WEFA 3DYFA 5DGNF 3ICZA 3ADZA 3MZVA 4KPJA 4KVWA 5HN9A 4GAXA 5HN8A 5JV1F 3S4JA 3TFNA 3NPKA 1YYTA 3WC9A 2J1OA 3LGZB 4NFKF 5ILJA 3TFVA 2AELA 1YYRA 3N6KF 1V4IA 2Z4WA 1V4JA 4LLTA 3N5JF 2ONHA 4H5DF 2Q9YA 2E8VA 1UBYA 2ZEVA 3SDQA 2F7MF 2AZJA 1WKZA 1V4EA 5E8LA 5C05A 3KRAB 1UBXA 1HX9A 3KRCA 1UBWA 3PH7A 3N5HF 3RMGA 4E9UA 4F6XA 2H8OA 2E91A 2ZY1A 5B0LA 4OMHA 3WEHA 2PS8A 5IL3A 3VJCA 3WJNA 4Q23A 5ILHA 3N49F 1WL3A 5JUZF 3WJOA 1VG2A 3LMDA 1YYSA 5EATA 2Z50A 5DJVF 4GP1A 4RNQA 4EA0A 4KWDA 4LUUA 4OKZA 4LLSA 4L2XF 5DJPF 1HM4A 4LZ3A 4N9UA 4RXAA 3WCAA 2E8TA 4JVJF 4HD1A 2Z4VA 3AQBB 4F62A 3WCLA 2DH4A 3KROB 3ACYA 3TFPA 5B02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N22 A;  4MC8 A;  3LVS A;  5IM1 A;  3ZMB A;  1WL0 A;  1JFA A;  3WCB A;  3ZOU A;  3G4D A;  5DZ2 A;  1YQ7 A;  1YV5 A;  3P5R A;  5ERM A;  3N0G A;  3PYB A;  1N23 A;  2E4O A;  2F89 F;  4K10 A;  5A0J A;  4NFJ F;  5JV0 F;  5JA0 F;  3WCI A;  2Q80 A;  5EAS A;  5IL8 A;  1HXG A;  3LEE A;  4XQT F;  3PYA A;  3LOM A;  3ZL6 A;  1V4H A;  3RYW A;  4WK5 A;  2E90 A;  4KKM A;  4RXC A;  2E94 A;  3M9U A;  4KQU A;  1FPS A;  4QPF A;  5B0K A;  2F92 F;  2VF6 A;  5B03 A;  3LDW A;  3OAB A;  2F9K F;  3LJI A;  5IKA A;  1N1Z A;  3WSB A;  2AEK A;  3OAC A;  5E8K A;  4DWB A;  3WEI A;  2E8X A;  4DI5 A;  5AHU B;  2FTZ A;  3WEK A;  3LK5 A;  4MC3 A;  4UMJ A;  3SDU A;  3VJB A;  3LGK A;  2Q58 A;  3LZ9 A;  4NKF A;  2QIS A;  2Z7I A;  2PS5 A;  4LZC A;  2E93 A;  4P0X A;  1DGP A;  5ER8 A;  4NFI F;  5AYP A;  3WJK A;  3WCJ A;  2F8Z F;  1RTR A;  5B0I A;  1ZW5 A;  4LTZ A;  3CP6 A;  1YHK A;  2Z4Y A;  3AE0 A;  3KRA A;  3WCH A;  2EWG A;  1V4K A;  3QQV A;  2AZK A;  1VG7 A;  3WCE A;  4F6V A;  1YYU A;  4KPD A;  2F94 F;  3N3L F;  2Z52 A;  3BNY A;  2O1O A;  4GA3 A;  2ZCR A;  5IN8 A;  3IBA A;  4EA1 A;  3ICK A;  1HM7 A;  2I19 A;  4LFG A;  4DZW A;  3V1V A;  5I1U A;  3ZCD A;  3KB9 A;  1N1B A;  3M0G A;  2Z7H A;  1WL1 A;  5EAU A;  2Z4X A;  1KIZ A;  4P0W A;  4RXD A;  3UCA A;  4NKE A;  4KQS A;  5A0K A;  2OPN A;  3Q2Z A;  3WCG A;  5IK9 A;  4XQS F;  4KVI A;  3N45 F;  3WCD A;  3KRP A;  4LFE A;  4DHD A;  1PS1 A;  4KFA A;  3TC1 A;  3W7F A;  3LLW A;  4RXE A;  2FOR A;  5DW7 A;  4PVX F;  3WSA A;  3KRF A;  5IK6 A;  4JZB A;  3M00 A;  3WCC A;  4N1Z F;  4DEM F;  5DGM F;  5IKH A;  4DWG A;  3PKO A;  3VJD A;  3SDR A;  3WE9 A;  5IMI A;  5DJR F;  3G4F A;  4KK2 A;  3M02 A;  4XQR F;  2RAH A;  4KQ5 A;  4JXY A;  3WEJ A;  3LSN A;  2ZCS A;  5DIQ F;  3CC9 A;  3Q30 A;  4LXW A;  4JYX A;  2E95 A;  3QKC A;  3VJ8 A;  4LOB A;  4OGU A;  4LA5 A;  4LIX A;  3OAB B;  3WCF A;  5B0M A;  3V1X A;  3OAC B;  5DGS F;  3WCM A;  2E8W A;  4LPH F;  3ACW A;  1N21 A;  2PS6 A;  4LZ0 A;  5ILI A;  2ONG A;  2J1P A;  3VJA A;  3N0F A;  3IPI A;  3M01 A;  4OKM A;  1JFG A;  4JZX A;  4H5E F;  2J5C A;  2Q9Z A;  3RBM A;  4ZQ8 A;  1YYQ A;  2Z78 A;  3EGT A;  3KRC B;  1WY0 A;  3ICM A;  5ERO A;  2P1C A;  3CKE A;  4LFV F;  2PS4 A;  4LTV A;  4MC0 A;  4RYP A;  3WEG A;  4FJQ A;  5ERN A;  5ILK A;  4NUA A;  2E8U A;  5IMN A;  3N1W F;  1YJ4 A;  3NPR A;  2OA6 A;  4PVY F;  4H5C F;  4NG6 A;  5B0J A;  3ZMC A;  2Z4Z A;  1YHM A;  3MAV A;  3SDV A;  3SDT A;  2ZCO A;  1YHL A;  1UBV A;  4GP2 A;  2AZL A;  5E8H A;  5IMP A;  3DYG A;  1VG3 A;  3OYR A;  3N1V F;  2E92 A;  4JXN A;  2PS7 A;  1VG4 A;  1HXA A;  3Q2Q A;  1N24 A;  4E9Z A;  4DXJ A;  5AEL A;  5HNA A;  4EA2 A;  5KSX F;  4KUX A;  5B01 A;  3ID0 A;  4LA6 A;  4P0V A;  4KVD A;  5ILD A;  4OMG A;  3NF2 A;  4QXS F;  5CG5 A;  5JV2 F;  5HN7 A;  3KRP B;  5DHI A;  1WL2 A;  5IK0 A;  3APZ A;  3KBK A;  5H9D A;  2AET A;  5ILZ A;  3P8R A;  4FP4 A;  5AFX A;  2OGD A;  3AQC B;  1HXC A;  3KRO A;  5IVG A;  3VJ9 A;  3PDE A;  3KRF B;  4LPG F;  3EFQ A;  5DHK A;  1EZF A;  1VG6 A;  3ACX A;  3Q1O A;  4E1E A;  5A0I A;  3ICN A;  1RQJ A;  1WMW A;  3BNX A;  3TS7 A;  1DI1 A;  2ZEU A;  3N46 F;  3SAE A;  3LG5 A;  3DYH A;  3VJE A;  1RQI A;  4KVY A;  5CG6 A;  5B00 A;  3P41 A;  1N20 A;  3V66 A;  3S9V A;  3AQ0 A;  2OPM A;  3B7L A;  3NRI A;  3N3D A;  5ILY A;  2F8C F;  3P5P A;  3EZ3 A;  2ZCQ A;  1KIY A;  3RYE A;  3ASX A;  3P8L A;  3WEF A;  3DYF A;  5DGN F;  3ICZ A;  3ADZ A;  3MZV A;  4KPJ A;  4KVW A;  5HN9 A;  4GAX A;  5HN8 A;  5JV1 F;  3S4J A;  3TFN A;  3NPK A;  1YYT A;  3WC9 A;  2J1O A;  3LGZ B;  4NFK F;  5ILJ A;  3TFV A;  2AEL A;  1YYR A;  3N6K F;  1V4I A;  2Z4W A;  1V4J A;  4LLT A;  3N5J F;  2ONH A;  4H5D F;  2Q9Y A;  2E8V A;  1UBY A;  2ZEV A;  3SDQ A;  2F7M F;  2AZJ A;  1WKZ A;  1V4E A;  5E8L A;  5C05 A;  3KRA B;  1UBX A;  1HX9 A;  3KRC A;  1UBW A;  3PH7 A;  3N5H F;  3RMG A;  4E9U A;  4F6X A;  2H8O A;  2E91 A;  2ZY1 A;  5B0L A;  4OMH A;  3WEH A;  2PS8 A;  5IL3 A;  3VJC A;  3WJN A;  4Q23 A;  5ILH A;  3N49 F;  1WL3 A;  5JUZ F;  3WJO A;  1VG2 A;  3LMD A;  1YYS A;  5EAT A;  2Z50 A;  5DJV F;  4GP1 A;  4RNQ A;  4EA0 A;  4KWD A;  4LUU A;  4OKZ A;  4LLS A;  4L2X F;  5DJP F;  1HM4 A;  4LZ3 A;  4N9U A;  4RXA A;  3WCA A;  2E8T A;  4JVJ F;  4HD1 A;  2Z4V A;  3AQB B;  4F62 A;  3WCL A;  2DH4 A;  3KRO B;  3ACY A;  3TFP A;  5B02 A; 
#chains in the Genus database with same CATH topology
 1N22 A;  4MC8 A;  3LVS A;  5IM1 A;  3ZMB A;  1WL0 A;  1JFA A;  3WCB A;  3ZOU A;  3G4D A;  5DZ2 A;  1YQ7 A;  1YV5 A;  3P5R A;  5ERM A;  3N0G A;  3PYB A;  1N23 A;  2E4O A;  2F89 F;  4K10 A;  5A0J A;  4NFJ F;  5JV0 F;  5JA0 F;  3WCI A;  2Q80 A;  5EAS A;  5IL8 A;  1HXG A;  3LEE A;  4XQT F;  3PYA A;  3LOM A;  3ZL6 A;  1V4H A;  3RYW A;  4WK5 A;  2E90 A;  4KKM A;  4RXC A;  2E94 A;  3M9U A;  4KQU A;  1FPS A;  4QPF A;  5B0K A;  2F92 F;  2VF6 A;  5B03 A;  3LDW A;  3OAB A;  2F9K F;  3LJI A;  5IKA A;  1N1Z A;  3WSB A;  2AEK A;  3OAC A;  5E8K A;  4DWB A;  3WEI A;  2E8X A;  4DI5 A;  5AHU B;  2FTZ A;  3WEK A;  3LK5 A;  4MC3 A;  4UMJ A;  3SDU A;  3VJB A;  3LGK A;  2Q58 A;  3LZ9 A;  4NKF A;  2QIS A;  2Z7I A;  2PS5 A;  4LZC A;  2E93 A;  4P0X A;  1DGP A;  5ER8 A;  4NFI F;  5AYP A;  3WJK A;  3WCJ A;  2F8Z F;  1RTR A;  5B0I A;  1ZW5 A;  4LTZ A;  3CP6 A;  1YHK A;  2Z4Y A;  3AE0 A;  3KRA A;  3WCH A;  2EWG A;  1V4K A;  3QQV A;  2AZK A;  1VG7 A;  3WCE A;  4F6V A;  1YYU A;  4KPD A;  2F94 F;  3N3L F;  2Z52 A;  3BNY A;  2O1O A;  4GA3 A;  2ZCR A;  5IN8 A;  3IBA A;  4EA1 A;  3ICK A;  1HM7 A;  2I19 A;  4LFG A;  4DZW A;  3V1V A;  5I1U A;  3ZCD A;  3KB9 A;  1N1B A;  3M0G A;  2Z7H A;  1WL1 A;  5EAU A;  2Z4X A;  1KIZ A;  4P0W A;  4RXD A;  3UCA A;  4NKE A;  4KQS A;  5A0K A;  2OPN A;  3Q2Z A;  3WCG A;  5IK9 A;  4XQS F;  4KVI A;  3N45 F;  3WCD A;  3KRP A;  4LFE A;  4DHD A;  1PS1 A;  4KFA A;  3TC1 A;  3W7F A;  3LLW A;  4RXE A;  2FOR A;  5DW7 A;  4PVX F;  3WSA A;  3KRF A;  5IK6 A;  4JZB A;  3M00 A;  3WCC A;  4N1Z F;  4DEM F;  5DGM F;  5IKH A;  4DWG A;  3PKO A;  3VJD A;  3SDR A;  3WE9 A;  5IMI A;  5DJR F;  3G4F A;  4KK2 A;  3M02 A;  4XQR F;  2RAH A;  4KQ5 A;  4JXY A;  3WEJ A;  3LSN A;  2ZCS A;  5DIQ F;  3CC9 A;  3Q30 A;  4LXW A;  4JYX A;  2E95 A;  3QKC A;  3VJ8 A;  4LOB A;  4OGU A;  4LA5 A;  4LIX A;  3OAB B;  3WCF A;  5B0M A;  3V1X A;  3OAC B;  5DGS F;  3WCM A;  2E8W A;  4LPH F;  3ACW A;  1N21 A;  2PS6 A;  4LZ0 A;  5ILI A;  2ONG A;  2J1P A;  3VJA A;  3N0F A;  3IPI A;  3M01 A;  4OKM A;  1JFG A;  4JZX A;  4H5E F;  2J5C A;  2Q9Z A;  3RBM A;  4ZQ8 A;  1YYQ A;  2Z78 A;  3EGT A;  3KRC B;  1WY0 A;  3ICM A;  5ERO A;  2P1C A;  3CKE A;  4LFV F;  2PS4 A;  4LTV A;  4MC0 A;  4RYP A;  3WEG A;  4FJQ A;  5ERN A;  5ILK A;  4NUA A;  2E8U A;  5IMN A;  3N1W F;  1YJ4 A;  3NPR A;  2OA6 A;  4PVY F;  4H5C F;  4NG6 A;  5B0J A;  3ZMC A;  2Z4Z A;  1YHM A;  3MAV A;  3SDV A;  3SDT A;  2ZCO A;  1YHL A;  1UBV A;  4GP2 A;  2AZL A;  5E8H A;  5IMP A;  3DYG A;  1VG3 A;  3OYR A;  3N1V F;  2E92 A;  4JXN A;  2PS7 A;  1VG4 A;  1HXA A;  3Q2Q A;  1N24 A;  4E9Z A;  4DXJ A;  5AEL A;  5HNA A;  4EA2 A;  5KSX F;  4KUX A;  5B01 A;  3ID0 A;  4LA6 A;  4P0V A;  4KVD A;  5ILD A;  4OMG A;  3NF2 A;  4QXS F;  5CG5 A;  5JV2 F;  5HN7 A;  3KRP B;  5DHI A;  1WL2 A;  5IK0 A;  3APZ A;  3KBK A;  5H9D A;  2AET A;  5ILZ A;  3P8R A;  4FP4 A;  5AFX A;  2OGD A;  3AQC B;  1HXC A;  3KRO A;  5IVG A;  3VJ9 A;  3PDE A;  3KRF B;  4LPG F;  3EFQ A;  5DHK A;  1EZF A;  1VG6 A;  3ACX A;  3Q1O A;  4E1E A;  5A0I A;  3ICN A;  1RQJ A;  1WMW A;  3BNX A;  3TS7 A;  1DI1 A;  2ZEU A;  3N46 F;  3SAE A;  3LG5 A;  3DYH A;  3VJE A;  1RQI A;  4KVY A;  5CG6 A;  5B00 A;  3P41 A;  1N20 A;  3V66 A;  3S9V A;  3AQ0 A;  2OPM A;  3B7L A;  3NRI A;  3N3D A;  5ILY A;  2F8C F;  3P5P A;  3EZ3 A;  2ZCQ A;  1KIY A;  3RYE A;  3ASX A;  3P8L A;  3WEF A;  3DYF A;  5DGN F;  3ICZ A;  3ADZ A;  3MZV A;  4KPJ A;  4KVW A;  5HN9 A;  4GAX A;  5HN8 A;  5JV1 F;  3S4J A;  3TFN A;  3NPK A;  1YYT A;  3WC9 A;  2J1O A;  3LGZ B;  4NFK F;  5ILJ A;  3TFV A;  2AEL A;  1YYR A;  3N6K F;  1V4I A;  2Z4W A;  1V4J A;  4LLT A;  3N5J F;  2ONH A;  4H5D F;  2Q9Y A;  2E8V A;  1UBY A;  2ZEV A;  3SDQ A;  2F7M F;  2AZJ A;  1WKZ A;  1V4E A;  5E8L A;  5C05 A;  3KRA B;  1UBX A;  1HX9 A;  3KRC A;  1UBW A;  3PH7 A;  3N5H F;  3RMG A;  4E9U A;  4F6X A;  2H8O A;  2E91 A;  2ZY1 A;  5B0L A;  4OMH A;  3WEH A;  2PS8 A;  5IL3 A;  3VJC A;  3WJN A;  4Q23 A;  5ILH A;  3N49 F;  1WL3 A;  5JUZ F;  3WJO A;  1VG2 A;  3LMD A;  1YYS A;  5EAT A;  2Z50 A;  5DJV F;  4GP1 A;  4RNQ A;  4EA0 A;  4KWD A;  4LUU A;  4OKZ A;  4LLS A;  4L2X F;  5DJP F;  1HM4 A;  4LZ3 A;  4N9U A;  4RXA A;  3WCA A;  2E8T A;  4JVJ F;  4HD1 A;  2Z4V A;  3AQB B;  4F62 A;  3WCL A;  2DH4 A;  3KRO B;  3ACY A;  3TFP A;  5B02 A; 
#chains in the Genus database with same CATH homology
 1N22 A;  4MC8 A;  3LVS A;  5IM1 A;  3ZMB A;  1WL0 A;  1JFA A;  3WCB A;  3ZOU A;  3G4D A;  5DZ2 A;  1YQ7 A;  1YV5 A;  3P5R A;  5ERM A;  3N0G A;  3PYB A;  1N23 A;  2E4O A;  2F89 F;  4K10 A;  5A0J A;  4NFJ F;  5JV0 F;  5JA0 F;  3WCI A;  2Q80 A;  5EAS A;  5IL8 A;  1HXG A;  3LEE A;  4XQT F;  3PYA A;  3LOM A;  3ZL6 A;  1V4H A;  3RYW A;  4WK5 A;  2E90 A;  4KKM A;  4RXC A;  2E94 A;  3M9U A;  4KQU A;  1FPS A;  4QPF A;  5B0K A;  2F92 F;  2VF6 A;  5B03 A;  3LDW A;  3OAB A;  2F9K F;  3LJI A;  5IKA A;  1N1Z A;  3WSB A;  2AEK A;  3OAC A;  5E8K A;  4DWB A;  3WEI A;  2E8X A;  4DI5 A;  5AHU B;  2FTZ A;  3WEK A;  3LK5 A;  4MC3 A;  4UMJ A;  3SDU A;  3VJB A;  3LGK A;  2Q58 A;  3LZ9 A;  4NKF A;  2QIS A;  2Z7I A;  2PS5 A;  4LZC A;  2E93 A;  4P0X A;  1DGP A;  5ER8 A;  4NFI F;  5AYP A;  3WJK A;  3WCJ A;  2F8Z F;  1RTR A;  5B0I A;  1ZW5 A;  4LTZ A;  3CP6 A;  1YHK A;  2Z4Y A;  3AE0 A;  3KRA A;  3WCH A;  2EWG A;  1V4K A;  3QQV A;  2AZK A;  1VG7 A;  3WCE A;  4F6V A;  1YYU A;  4KPD A;  2F94 F;  3N3L F;  2Z52 A;  3BNY A;  2O1O A;  4GA3 A;  2ZCR A;  5IN8 A;  3IBA A;  4EA1 A;  3ICK A;  1HM7 A;  2I19 A;  4LFG A;  4DZW A;  3V1V A;  5I1U A;  3ZCD A;  3KB9 A;  1N1B A;  3M0G A;  2Z7H A;  1WL1 A;  5EAU A;  2Z4X A;  1KIZ A;  4P0W A;  4RXD A;  3UCA A;  4NKE A;  4KQS A;  5A0K A;  2OPN A;  3Q2Z A;  3WCG A;  5IK9 A;  4XQS F;  4KVI A;  3N45 F;  3WCD A;  3KRP A;  4LFE A;  4DHD A;  1PS1 A;  4KFA A;  3TC1 A;  3W7F A;  3LLW A;  4RXE A;  2FOR A;  5DW7 A;  4PVX F;  3WSA A;  3KRF A;  5IK6 A;  4JZB A;  3M00 A;  3WCC A;  4N1Z F;  4DEM F;  5DGM F;  5IKH A;  4DWG A;  3PKO A;  3VJD A;  3SDR A;  3WE9 A;  5IMI A;  5DJR F;  3G4F A;  4KK2 A;  3M02 A;  4XQR F;  2RAH A;  4KQ5 A;  4JXY A;  3WEJ A;  3LSN A;  2ZCS A;  5DIQ F;  3CC9 A;  3Q30 A;  4LXW A;  4JYX A;  2E95 A;  3QKC A;  3VJ8 A;  4LOB A;  4OGU A;  4LA5 A;  4LIX A;  3OAB B;  3WCF A;  5B0M A;  3V1X A;  3OAC B;  5DGS F;  3WCM A;  2E8W A;  4LPH F;  3ACW A;  1N21 A;  2PS6 A;  4LZ0 A;  5ILI A;  2ONG A;  2J1P A;  3VJA A;  3N0F A;  3IPI A;  3M01 A;  4OKM A;  1JFG A;  4JZX A;  4H5E F;  2J5C A;  2Q9Z A;  3RBM A;  4ZQ8 A;  1YYQ A;  2Z78 A;  3EGT A;  3KRC B;  1WY0 A;  3ICM A;  5ERO A;  2P1C A;  3CKE A;  4LFV F;  2PS4 A;  4LTV A;  4MC0 A;  4RYP A;  3WEG A;  4FJQ A;  5ERN A;  5ILK A;  4NUA A;  2E8U A;  5IMN A;  3N1W F;  1YJ4 A;  3NPR A;  2OA6 A;  4PVY F;  4H5C F;  4NG6 A;  5B0J A;  3ZMC A;  2Z4Z A;  1YHM A;  3MAV A;  3SDV A;  3SDT A;  2ZCO A;  1YHL A;  1UBV A;  4GP2 A;  2AZL A;  5E8H A;  5IMP A;  3DYG A;  1VG3 A;  3OYR A;  3N1V F;  2E92 A;  4JXN A;  2PS7 A;  1VG4 A;  1HXA A;  3Q2Q A;  1N24 A;  4E9Z A;  4DXJ A;  5AEL A;  5HNA A;  4EA2 A;  5KSX F;  4KUX A;  5B01 A;  3ID0 A;  4LA6 A;  4P0V A;  4KVD A;  5ILD A;  4OMG A;  3NF2 A;  4QXS F;  5CG5 A;  5JV2 F;  5HN7 A;  3KRP B;  5DHI A;  1WL2 A;  5IK0 A;  3APZ A;  3KBK A;  5H9D A;  2AET A;  5ILZ A;  3P8R A;  4FP4 A;  5AFX A;  2OGD A;  3AQC B;  1HXC A;  3KRO A;  5IVG A;  3VJ9 A;  3PDE A;  3KRF B;  4LPG F;  3EFQ A;  5DHK A;  1EZF A;  1VG6 A;  3ACX A;  3Q1O A;  4E1E A;  5A0I A;  3ICN A;  1RQJ A;  1WMW A;  3BNX A;  3TS7 A;  1DI1 A;  2ZEU A;  3N46 F;  3SAE A;  3LG5 A;  3DYH A;  3VJE A;  1RQI A;  4KVY A;  5CG6 A;  5B00 A;  3P41 A;  1N20 A;  3V66 A;  3S9V A;  3AQ0 A;  2OPM A;  3B7L A;  3NRI A;  3N3D A;  5ILY A;  2F8C F;  3P5P A;  3EZ3 A;  2ZCQ A;  1KIY A;  3RYE A;  3ASX A;  3P8L A;  3WEF A;  3DYF A;  5DGN F;  3ICZ A;  3ADZ A;  3MZV A;  4KPJ A;  4KVW A;  5HN9 A;  4GAX A;  5HN8 A;  5JV1 F;  3S4J A;  3TFN A;  3NPK A;  1YYT A;  3WC9 A;  2J1O A;  3LGZ B;  4NFK F;  5ILJ A;  3TFV A;  2AEL A;  1YYR A;  3N6K F;  1V4I A;  2Z4W A;  1V4J A;  4LLT A;  3N5J F;  2ONH A;  4H5D F;  2Q9Y A;  2E8V A;  1UBY A;  2ZEV A;  3SDQ A;  2F7M F;  2AZJ A;  1WKZ A;  1V4E A;  5E8L A;  5C05 A;  3KRA B;  1UBX A;  1HX9 A;  3KRC A;  1UBW A;  3PH7 A;  3N5H F;  3RMG A;  4E9U A;  4F6X A;  2H8O A;  2E91 A;  2ZY1 A;  5B0L A;  4OMH A;  3WEH A;  2PS8 A;  5IL3 A;  3VJC A;  3WJN A;  4Q23 A;  5ILH A;  3N49 F;  1WL3 A;  5JUZ F;  3WJO A;  1VG2 A;  3LMD A;  1YYS A;  5EAT A;  2Z50 A;  5DJV F;  4GP1 A;  4RNQ A;  4EA0 A;  4KWD A;  4LUU A;  4OKZ A;  4LLS A;  4L2X F;  5DJP F;  1HM4 A;  4LZ3 A;  4N9U A;  4RXA A;  3WCA A;  2E8T A;  4JVJ F;  4HD1 A;  2Z4V A;  3AQB B;  4F62 A;  3WCL A;  2DH4 A;  3KRO B;  3ACY A;  3TFP A;  5B02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...