5B0IA

Structure of moen5-sso7d fusion protein in complex with beta-octyl glucoside
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
266
structure length
266
Chain Sequence
VDDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHLGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, dna binding protein
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
total genus 120
structure length 266
sequence length 266
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b0iA00
3N3DA 4GAXA 4KVDA 1DI1A 3V1XA 2FTZA 2E93A 3KRFA 4LPHF 1DGPA 1N1BA 4JXYA 1UBWA 3LOMA 1WL3A 3M0GA 5B01A 3N6KF 3VJ8A 5IK9A 3LZ9A 3EGTA 3KROA 3ACWA 5IMNA 3AQ0A 4LIXA 1YYRA 2E90A 1KIYA 3IBAA 2E95A 3PYAA 1N1ZA 4XQSF 1HX9A 3AQBB 4RXEA 5ILHA 4KPDA 4KVIA 3VJAA 5DZ2A 3PYBA 5B0LA 2E8VA 3RBMA 5IN8A 3MAVA 1EZFA 3DYFA 5ERNA 4DZWA 4LXWA 5DGSF 4DWGA 5DHKA 2H8OA 2AETA 3WCIA 2PS5A 1VG4A 4KFAA 1HXGA 4MC8A 4LFGA 5ILIA 3SDQA 1FPSA 4E9UA 3WEFA 3ICMA 5JA0F 3EZ3A 3LGKA 3P8RA 2OPNA 3DYHA 1RTRA 2E8WA 5B02A 2F9KF 4N1ZF 2OA6A 3ICNA 4DHDA 3ICZA 4OMGA 2AZKA 3N5JF 3WCJA 5ER8A 3AE0A 4LOBA 5E8KA 2Z52A 2ZCQA 3N0GA 2E4OA 2F92F 1KIZA 4NKEA 3PKOA 1VG7A 5IL3A 2E8UA 4KKMA 4KUXA 4LPGF 3P8LA 2AELA 3ZL6A 2ZCOA 3TFNA 4P0XA 3Q2ZA 3Q1OA 5JUZF 4EA1A 3N5HF 3DYGA 4KK2A 2PS7A 5HNAA 3LG5A 3WCAA 3TS7A 3OABB 1JFAA 5EAUA 2F89F 2EWGA 3N3LF 4KQUA 4OKMA 5IKAA 2DH4A 3OACA 4KQ5A 4MC3A 2Q80A 4KWDA 4LZ0A 5A0KA 3LDWA 4JZXA 4OKZA 2F7MF 3ZOUA 5B0KA 4L2XF 5DW7A 2Q9YA 3S9VA 4JVJF 5EROA 3P5PA 5KSXF 3KRCB 5DJPF 2F8ZF 3WCCA 3WSBA 3LMDA 2PS8A 3CP6A 3TFPA 1WY0A 4PVXF 2AEKA 4KQSA 4OGUA 3B7LA 3LJIA 3G4DA 3RMGA 4H5CF 3WCGA 2E94A 3KRPB 5IMIA 3WCMA 5EASA 4P0WA 5DIQF 3ACXA 1YHMA 3WCHA 2AZLA 2QISA 5DJVF 3W7FA 3WCDA 3G4FA 3TC1A 1WMWA 4DXJA 2Z7IA 1WL0A 2OGDA 3NPRA 5ERMA 5ILYA 5JV0F 2FORA 3SDVA 4P0VA 5B0JA 1YQ7A 3WJNA 3ACYA 4NFKF 5AHUB 3EFQA 2RAHA 1N21A 5B0IA 1HXCA 3WEJA 2P1CA 4DWBA 3RYWA 4LA5A 2Z78A 5AYPA 1V4KA 3ADZA 1YYSA 4FJQA 4KVWA 3KBKA 5I1UA 2Z4VA 2J5CA 4EA2A 4XQTF 4Q23A 3N1WF 4NKFA 1YJ4A 3KRAA 4JYXA 5ILZA 3WE9A 5EATA 5DJRF 3N0FA 1RQIA 3M02A 4DI5A 5H9DA 5DHIA 1YHKA 4F6VA 1UBXA 2Z7HA 3OABA 2ONGA 1N20A 3LGZB 1VG2A 1HM4A 3APZA 3PH7A 3VJBA 4RXAA 2E8TA 3N46F 4LTVA 4GA3A 1PS1A 3ZMBA 2Z4XA 5AELA 5DGNF 3MZVA 4LLTA 3WSAA 4ZQ8A 3SDRA 4QPFA 4GP1A 2E8XA 4NG6A 1V4EA 2ZEVA 5HN8A 1N23A 3LLWA 3KRCA 1N22A 1VG6A 2F8CF 2F94F 5B0MA 3NPKA 5A0JA 3WCFA 1RQJA 5IM1A 4LLSA 4JZBA 2ZY1A 3PDEA 3Q2QA 3KRPA 1UBYA 4LFEA 3QQVA 4LZCA 3OYRA 5DGMF 4GP2A 4LA6A 3ZCDA 1YYTA 5JV1F 1V4IA 5HN7A 3LEEA 3BNXA 3VJEA 5CG5A 3AQCB 3TFVA 3WCEA 3QKCA 5IK0A 4RNQA 1WL2A 4UMJA 5IVGA 3RYEA 3OACB 3N49F 3P5RA 3LSNA 3ICKA 3CC9A 3ID0A 3WEHA 3N45F 1HXAA 3KRFB 2PS4A 4QXSF 4HD1A 4WK5A 3WCLA 5JV2F 5B03A 2ZEUA 5C05A 4RXDA 2ZCRA 5A0IA 4NFIF 4NFJF 3LVSA 4F6XA 1VG3A 4DEMF 4E1EA 2Z4ZA 1JFGA 3KROB 1YYQA 5B00A 3S4JA 4E9ZA 3KB9A 3M00A 2PS6A 1V4HA 1YYUA 5IL8A 3SDUA 4LUUA 3N1VF 5IMPA 3VJ9A 4F62A 3WEIA 4H5EF 5IKHA 2Q9ZA 2I19A 1WL1A 2Z4WA 3WCBA 3BNYA 1V4JA 2OPMA 3M9UA 1N24A 1UBVA 1YHLA 3NRIA 4N9UA 3VJCA 4MC0A 4KPJA 5HN9A 5CG6A 3WEGA 3WJOA 4FP4A 3CKEA 3WC9A 5ILKA 3V66A 3WJKA 3ASXA 3P41A 3ZMCA 4RXCA 2J1OA 5E8HA 4K10A 2J1PA 2E92A 3Q30A 4H5DF 2E91A 2Z50A 3WEKA 3NF2A 3V1VA 4RYPA 4LZ3A 3VJDA 2O1OA 2Q58A 4LFVF 5AFXA 5E8LA 4XQRF 1YV5A 3KRAB 2VF6A 5ILJA 2Z4YA 1HM7A 5IK6A 1WKZA 4PVYF 4JXNA 4LTZA 4EA0A 2ONHA 3LK5A 2AZJA 4OMHA 3SDTA 3IPIA 4KVYA 5ILDA 3SAEA 2ZCSA 3M01A 4NUAA 1ZW5A 3UCAA
chains in the Genus database with same CATH superfamily
3N3DA 4GAXA 4KVDA 1DI1A 3V1XA 2FTZA 2E93A 3KRFA 4LPHF 1DGPA 1N1BA 4JXYA 1UBWA 3LOMA 1WL3A 3M0GA 5B01A 3N6KF 3VJ8A 5IK9A 3LZ9A 3EGTA 3KROA 3ACWA 5IMNA 3AQ0A 4LIXA 1YYRA 2E90A 1KIYA 3IBAA 2E95A 3PYAA 1N1ZA 4XQSF 1HX9A 3AQBB 4RXEA 5ILHA 4KPDA 4KVIA 3VJAA 5DZ2A 3PYBA 5B0LA 2E8VA 3RBMA 5IN8A 3MAVA 1EZFA 3DYFA 5ERNA 4DZWA 4LXWA 5DGSF 4DWGA 5DHKA 2H8OA 2AETA 3WCIA 2PS5A 1VG4A 4KFAA 1HXGA 4MC8A 4LFGA 5ILIA 3SDQA 1FPSA 4E9UA 3WEFA 3ICMA 5JA0F 3EZ3A 3LGKA 3P8RA 2OPNA 3DYHA 1RTRA 2E8WA 5B02A 2F9KF 4N1ZF 2OA6A 3ICNA 4DHDA 3ICZA 4OMGA 2AZKA 3N5JF 3WCJA 5ER8A 3AE0A 4LOBA 5E8KA 2Z52A 2ZCQA 3N0GA 2E4OA 2F92F 1KIZA 4NKEA 3PKOA 1VG7A 5IL3A 2E8UA 4KKMA 4KUXA 4LPGF 3P8LA 2AELA 3ZL6A 2ZCOA 3TFNA 4P0XA 3Q2ZA 3Q1OA 5JUZF 4EA1A 3N5HF 3DYGA 4KK2A 2PS7A 5HNAA 3LG5A 3WCAA 3TS7A 3OABB 1JFAA 5EAUA 2F89F 2EWGA 3N3LF 4KQUA 4OKMA 5IKAA 2DH4A 3OACA 4KQ5A 4MC3A 2Q80A 4KWDA 4LZ0A 5A0KA 3LDWA 4JZXA 4OKZA 2F7MF 3ZOUA 5B0KA 4L2XF 5DW7A 2Q9YA 3S9VA 4JVJF 5EROA 3P5PA 5KSXF 3KRCB 5DJPF 2F8ZF 3WCCA 3WSBA 3LMDA 2PS8A 3CP6A 3TFPA 1WY0A 4PVXF 2AEKA 4KQSA 4OGUA 3B7LA 3LJIA 3G4DA 3RMGA 4H5CF 3WCGA 2E94A 3KRPB 5IMIA 3WCMA 5EASA 4P0WA 5DIQF 3ACXA 1YHMA 3WCHA 2AZLA 2QISA 5DJVF 3W7FA 3WCDA 3G4FA 3TC1A 1WMWA 4DXJA 2Z7IA 1WL0A 2OGDA 3NPRA 5ERMA 5ILYA 5JV0F 2FORA 3SDVA 4P0VA 5B0JA 1YQ7A 3WJNA 3ACYA 4NFKF 5AHUB 3EFQA 2RAHA 1N21A 5B0IA 1HXCA 3WEJA 2P1CA 4DWBA 3RYWA 4LA5A 2Z78A 5AYPA 1V4KA 3ADZA 1YYSA 4FJQA 4KVWA 3KBKA 5I1UA 2Z4VA 2J5CA 4EA2A 4XQTF 4Q23A 3N1WF 4NKFA 1YJ4A 3KRAA 4JYXA 5ILZA 3WE9A 5EATA 5DJRF 3N0FA 1RQIA 3M02A 4DI5A 5H9DA 5DHIA 1YHKA 4F6VA 1UBXA 2Z7HA 3OABA 2ONGA 1N20A 3LGZB 1VG2A 1HM4A 3APZA 3PH7A 3VJBA 4RXAA 2E8TA 3N46F 4LTVA 4GA3A 1PS1A 3ZMBA 2Z4XA 5AELA 5DGNF 3MZVA 4LLTA 3WSAA 4ZQ8A 3SDRA 4QPFA 4GP1A 2E8XA 4NG6A 1V4EA 2ZEVA 5HN8A 1N23A 3LLWA 3KRCA 1N22A 1VG6A 2F8CF 2F94F 5B0MA 3NPKA 5A0JA 3WCFA 1RQJA 5IM1A 4LLSA 4JZBA 2ZY1A 3PDEA 3Q2QA 3KRPA 1UBYA 4LFEA 3QQVA 4LZCA 3OYRA 5DGMF 4GP2A 4LA6A 3ZCDA 1YYTA 5JV1F 1V4IA 5HN7A 3LEEA 3BNXA 3VJEA 5CG5A 3AQCB 3TFVA 3WCEA 3QKCA 5IK0A 4RNQA 1WL2A 4UMJA 5IVGA 3RYEA 3OACB 3N49F 3P5RA 3LSNA 3ICKA 3CC9A 3ID0A 3WEHA 3N45F 1HXAA 3KRFB 2PS4A 4QXSF 4HD1A 4WK5A 3WCLA 5JV2F 5B03A 2ZEUA 5C05A 4RXDA 2ZCRA 5A0IA 4NFIF 4NFJF 3LVSA 4F6XA 1VG3A 4DEMF 4E1EA 2Z4ZA 1JFGA 3KROB 1YYQA 5B00A 3S4JA 4E9ZA 3KB9A 3M00A 2PS6A 1V4HA 1YYUA 5IL8A 3SDUA 4LUUA 3N1VF 5IMPA 3VJ9A 4F62A 3WEIA 4H5EF 5IKHA 2Q9ZA 2I19A 1WL1A 2Z4WA 3WCBA 3BNYA 1V4JA 2OPMA 3M9UA 1N24A 1UBVA 1YHLA 3NRIA 4N9UA 3VJCA 4MC0A 4KPJA 5HN9A 5CG6A 3WEGA 3WJOA 4FP4A 3CKEA 3WC9A 5ILKA 3V66A 3WJKA 3ASXA 3P41A 3ZMCA 4RXCA 2J1OA 5E8HA 4K10A 2J1PA 2E92A 3Q30A 4H5DF 2E91A 2Z50A 3WEKA 3NF2A 3V1VA 4RYPA 4LZ3A 3VJDA 2O1OA 2Q58A 4LFVF 5AFXA 5E8LA 4XQRF 1YV5A 3KRAB 2VF6A 5ILJA 2Z4YA 1HM7A 5IK6A 1WKZA 4PVYF 4JXNA 4LTZA 4EA0A 2ONHA 3LK5A 2AZJA 4OMHA 3SDTA 3IPIA 4KVYA 5ILDA 3SAEA 2ZCSA 3M01A 4NUAA 1ZW5A 3UCAA
chains in the Genus database with same CATH topology
3N3DA 4GAXA 4KVDA 1DI1A 3V1XA 2FTZA 2E93A 3KRFA 4LPHF 1DGPA 1N1BA 4JXYA 1UBWA 3LOMA 1WL3A 3M0GA 5B01A 3N6KF 3VJ8A 5IK9A 3LZ9A 3EGTA 3KROA 3ACWA 5IMNA 3AQ0A 4LIXA 1YYRA 2E90A 1KIYA 3IBAA 2E95A 3PYAA 1N1ZA 4XQSF 1HX9A 3AQBB 4RXEA 5ILHA 4KPDA 4KVIA 3VJAA 5DZ2A 3PYBA 5B0LA 2E8VA 3RBMA 5IN8A 3MAVA 1EZFA 3DYFA 5ERNA 4DZWA 4LXWA 5DGSF 4DWGA 5DHKA 2H8OA 2AETA 3WCIA 2PS5A 1VG4A 4KFAA 1HXGA 4MC8A 4LFGA 5ILIA 3SDQA 1FPSA 4E9UA 3WEFA 3ICMA 5JA0F 3EZ3A 3LGKA 3P8RA 2OPNA 3DYHA 1RTRA 2E8WA 5B02A 2F9KF 4N1ZF 2OA6A 3ICNA 4DHDA 3ICZA 4OMGA 2AZKA 3N5JF 3WCJA 5ER8A 3AE0A 4LOBA 5E8KA 2Z52A 2ZCQA 3N0GA 2E4OA 2F92F 1KIZA 4NKEA 3PKOA 1VG7A 5IL3A 2E8UA 4KKMA 4KUXA 4LPGF 3P8LA 2AELA 3ZL6A 2ZCOA 3TFNA 4P0XA 3Q2ZA 3Q1OA 5JUZF 4EA1A 3N5HF 3DYGA 4KK2A 2PS7A 5HNAA 3LG5A 3WCAA 3TS7A 3OABB 1JFAA 5EAUA 2F89F 2EWGA 3N3LF 4KQUA 4OKMA 5IKAA 2DH4A 3OACA 4KQ5A 4MC3A 2Q80A 4KWDA 4LZ0A 5A0KA 3LDWA 4JZXA 4OKZA 2F7MF 3ZOUA 5B0KA 4L2XF 5DW7A 2Q9YA 3S9VA 4JVJF 5EROA 3P5PA 5KSXF 3KRCB 5DJPF 2F8ZF 3WCCA 3WSBA 3LMDA 2PS8A 3CP6A 3TFPA 1WY0A 4PVXF 2AEKA 4KQSA 4OGUA 3B7LA 3LJIA 3G4DA 3RMGA 4H5CF 3WCGA 2E94A 3KRPB 5IMIA 3WCMA 5EASA 4P0WA 5DIQF 3ACXA 1YHMA 3WCHA 2AZLA 2QISA 5DJVF 3W7FA 3WCDA 3G4FA 3TC1A 1WMWA 4DXJA 2Z7IA 1WL0A 2OGDA 3NPRA 5ERMA 5ILYA 5JV0F 2FORA 3SDVA 4P0VA 5B0JA 1YQ7A 3WJNA 3ACYA 4NFKF 5AHUB 3EFQA 2RAHA 1N21A 5B0IA 1HXCA 3WEJA 2P1CA 4DWBA 3RYWA 4LA5A 2Z78A 5AYPA 1V4KA 3ADZA 1YYSA 4FJQA 4KVWA 3KBKA 5I1UA 2Z4VA 2J5CA 4EA2A 4XQTF 4Q23A 3N1WF 4NKFA 1YJ4A 3KRAA 4JYXA 5ILZA 3WE9A 5EATA 5DJRF 3N0FA 1RQIA 3M02A 4DI5A 5H9DA 5DHIA 1YHKA 4F6VA 1UBXA 2Z7HA 3OABA 2ONGA 1N20A 3LGZB 1VG2A 1HM4A 3APZA 3PH7A 3VJBA 4RXAA 2E8TA 3N46F 4LTVA 4GA3A 1PS1A 3ZMBA 2Z4XA 5AELA 5DGNF 3MZVA 4LLTA 3WSAA 4ZQ8A 3SDRA 4QPFA 4GP1A 2E8XA 4NG6A 1V4EA 2ZEVA 5HN8A 1N23A 3LLWA 3KRCA 1N22A 1VG6A 2F8CF 2F94F 5B0MA 3NPKA 5A0JA 3WCFA 1RQJA 5IM1A 4LLSA 4JZBA 2ZY1A 3PDEA 3Q2QA 3KRPA 1UBYA 4LFEA 3QQVA 4LZCA 3OYRA 5DGMF 4GP2A 4LA6A 3ZCDA 1YYTA 5JV1F 1V4IA 5HN7A 3LEEA 3BNXA 3VJEA 5CG5A 3AQCB 3TFVA 3WCEA 3QKCA 5IK0A 4RNQA 1WL2A 4UMJA 5IVGA 3RYEA 3OACB 3N49F 3P5RA 3LSNA 3ICKA 3CC9A 3ID0A 3WEHA 3N45F 1HXAA 3KRFB 2PS4A 4QXSF 4HD1A 4WK5A 3WCLA 5JV2F 5B03A 2ZEUA 5C05A 4RXDA 2ZCRA 5A0IA 4NFIF 4NFJF 3LVSA 4F6XA 1VG3A 4DEMF 4E1EA 2Z4ZA 1JFGA 3KROB 1YYQA 5B00A 3S4JA 4E9ZA 3KB9A 3M00A 2PS6A 1V4HA 1YYUA 5IL8A 3SDUA 4LUUA 3N1VF 5IMPA 3VJ9A 4F62A 3WEIA 4H5EF 5IKHA 2Q9ZA 2I19A 1WL1A 2Z4WA 3WCBA 3BNYA 1V4JA 2OPMA 3M9UA 1N24A 1UBVA 1YHLA 3NRIA 4N9UA 3VJCA 4MC0A 4KPJA 5HN9A 5CG6A 3WEGA 3WJOA 4FP4A 3CKEA 3WC9A 5ILKA 3V66A 3WJKA 3ASXA 3P41A 3ZMCA 4RXCA 2J1OA 5E8HA 4K10A 2J1PA 2E92A 3Q30A 4H5DF 2E91A 2Z50A 3WEKA 3NF2A 3V1VA 4RYPA 4LZ3A 3VJDA 2O1OA 2Q58A 4LFVF 5AFXA 5E8LA 4XQRF 1YV5A 3KRAB 2VF6A 5ILJA 2Z4YA 1HM7A 5IK6A 1WKZA 4PVYF 4JXNA 4LTZA 4EA0A 2ONHA 3LK5A 2AZJA 4OMHA 3SDTA 3IPIA 4KVYA 5ILDA 3SAEA 2ZCSA 3M01A 4NUAA 1ZW5A 3UCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N3D A;  4GAX A;  4KVD A;  1DI1 A;  3V1X A;  2FTZ A;  2E93 A;  3KRF A;  4LPH F;  1DGP A;  1N1B A;  4JXY A;  1UBW A;  3LOM A;  1WL3 A;  3M0G A;  5B01 A;  3N6K F;  3VJ8 A;  5IK9 A;  3LZ9 A;  3EGT A;  3KRO A;  3ACW A;  5IMN A;  3AQ0 A;  4LIX A;  1YYR A;  2E90 A;  1KIY A;  3IBA A;  2E95 A;  3PYA A;  1N1Z A;  4XQS F;  1HX9 A;  3AQB B;  4RXE A;  5ILH A;  4KPD A;  4KVI A;  3VJA A;  5DZ2 A;  3PYB A;  5B0L A;  2E8V A;  3RBM A;  5IN8 A;  3MAV A;  1EZF A;  3DYF A;  5ERN A;  4DZW A;  4LXW A;  5DGS F;  4DWG A;  5DHK A;  2H8O A;  2AET A;  3WCI A;  2PS5 A;  1VG4 A;  4KFA A;  1HXG A;  4MC8 A;  4LFG A;  5ILI A;  3SDQ A;  1FPS A;  4E9U A;  3WEF A;  3ICM A;  5JA0 F;  3EZ3 A;  3LGK A;  3P8R A;  2OPN A;  3DYH A;  1RTR A;  2E8W A;  5B02 A;  2F9K F;  4N1Z F;  2OA6 A;  3ICN A;  4DHD A;  3ICZ A;  4OMG A;  2AZK A;  3N5J F;  3WCJ A;  5ER8 A;  3AE0 A;  4LOB A;  5E8K A;  2Z52 A;  2ZCQ A;  3N0G A;  2E4O A;  2F92 F;  1KIZ A;  4NKE A;  3PKO A;  1VG7 A;  5IL3 A;  2E8U A;  4KKM A;  4KUX A;  4LPG F;  3P8L A;  2AEL A;  3ZL6 A;  2ZCO A;  3TFN A;  4P0X A;  3Q2Z A;  3Q1O A;  5JUZ F;  4EA1 A;  3N5H F;  3DYG A;  4KK2 A;  2PS7 A;  5HNA A;  3LG5 A;  3WCA A;  3TS7 A;  3OAB B;  1JFA A;  5EAU A;  2F89 F;  2EWG A;  3N3L F;  4KQU A;  4OKM A;  5IKA A;  2DH4 A;  3OAC A;  4KQ5 A;  4MC3 A;  2Q80 A;  4KWD A;  4LZ0 A;  5A0K A;  3LDW A;  4JZX A;  4OKZ A;  2F7M F;  3ZOU A;  5B0K A;  4L2X F;  5DW7 A;  2Q9Y A;  3S9V A;  4JVJ F;  5ERO A;  3P5P A;  5KSX F;  3KRC B;  5DJP F;  2F8Z F;  3WCC A;  3WSB A;  3LMD A;  2PS8 A;  3CP6 A;  3TFP A;  1WY0 A;  4PVX F;  2AEK A;  4KQS A;  4OGU A;  3B7L A;  3LJI A;  3G4D A;  3RMG A;  4H5C F;  3WCG A;  2E94 A;  3KRP B;  5IMI A;  3WCM A;  5EAS A;  4P0W A;  5DIQ F;  3ACX A;  1YHM A;  3WCH A;  2AZL A;  2QIS A;  5DJV F;  3W7F A;  3WCD A;  3G4F A;  3TC1 A;  1WMW A;  4DXJ A;  2Z7I A;  1WL0 A;  2OGD A;  3NPR A;  5ERM A;  5ILY A;  5JV0 F;  2FOR A;  3SDV A;  4P0V A;  5B0J A;  1YQ7 A;  3WJN A;  3ACY A;  4NFK F;  5AHU B;  3EFQ A;  2RAH A;  1N21 A;  5B0I A;  1HXC A;  3WEJ A;  2P1C A;  4DWB A;  3RYW A;  4LA5 A;  2Z78 A;  5AYP A;  1V4K A;  3ADZ A;  1YYS A;  4FJQ A;  4KVW A;  3KBK A;  5I1U A;  2Z4V A;  2J5C A;  4EA2 A;  4XQT F;  4Q23 A;  3N1W F;  4NKF A;  1YJ4 A;  3KRA A;  4JYX A;  5ILZ A;  3WE9 A;  5EAT A;  5DJR F;  3N0F A;  1RQI A;  3M02 A;  4DI5 A;  5H9D A;  5DHI A;  1YHK A;  4F6V A;  1UBX A;  2Z7H A;  3OAB A;  2ONG A;  1N20 A;  3LGZ B;  1VG2 A;  1HM4 A;  3APZ A;  3PH7 A;  3VJB A;  4RXA A;  2E8T A;  3N46 F;  4LTV A;  4GA3 A;  1PS1 A;  3ZMB A;  2Z4X A;  5AEL A;  5DGN F;  3MZV A;  4LLT A;  3WSA A;  4ZQ8 A;  3SDR A;  4QPF A;  4GP1 A;  2E8X A;  4NG6 A;  1V4E A;  2ZEV A;  5HN8 A;  1N23 A;  3LLW A;  3KRC A;  1N22 A;  1VG6 A;  2F8C F;  2F94 F;  5B0M A;  3NPK A;  5A0J A;  3WCF A;  1RQJ A;  5IM1 A;  4LLS A;  4JZB A;  2ZY1 A;  3PDE A;  3Q2Q A;  3KRP A;  1UBY A;  4LFE A;  3QQV A;  4LZC A;  3OYR A;  5DGM F;  4GP2 A;  4LA6 A;  3ZCD A;  1YYT A;  5JV1 F;  1V4I A;  5HN7 A;  3LEE A;  3BNX A;  3VJE A;  5CG5 A;  3AQC B;  3TFV A;  3WCE A;  3QKC A;  5IK0 A;  4RNQ A;  1WL2 A;  4UMJ A;  5IVG A;  3RYE A;  3OAC B;  3N49 F;  3P5R A;  3LSN A;  3ICK A;  3CC9 A;  3ID0 A;  3WEH A;  3N45 F;  1HXA A;  3KRF B;  2PS4 A;  4QXS F;  4HD1 A;  4WK5 A;  3WCL A;  5JV2 F;  5B03 A;  2ZEU A;  5C05 A;  4RXD A;  2ZCR A;  5A0I A;  4NFI F;  4NFJ F;  3LVS A;  4F6X A;  1VG3 A;  4DEM F;  4E1E A;  2Z4Z A;  1JFG A;  3KRO B;  1YYQ A;  5B00 A;  3S4J A;  4E9Z A;  3KB9 A;  3M00 A;  2PS6 A;  1V4H A;  1YYU A;  5IL8 A;  3SDU A;  4LUU A;  3N1V F;  5IMP A;  3VJ9 A;  4F62 A;  3WEI A;  4H5E F;  5IKH A;  2Q9Z A;  2I19 A;  1WL1 A;  2Z4W A;  3WCB A;  3BNY A;  1V4J A;  2OPM A;  3M9U A;  1N24 A;  1UBV A;  1YHL A;  3NRI A;  4N9U A;  3VJC A;  4MC0 A;  4KPJ A;  5HN9 A;  5CG6 A;  3WEG A;  3WJO A;  4FP4 A;  3CKE A;  3WC9 A;  5ILK A;  3V66 A;  3WJK A;  3ASX A;  3P41 A;  3ZMC A;  4RXC A;  2J1O A;  5E8H A;  4K10 A;  2J1P A;  2E92 A;  3Q30 A;  4H5D F;  2E91 A;  2Z50 A;  3WEK A;  3NF2 A;  3V1V A;  4RYP A;  4LZ3 A;  3VJD A;  2O1O A;  2Q58 A;  4LFV F;  5AFX A;  5E8L A;  4XQR F;  1YV5 A;  3KRA B;  2VF6 A;  5ILJ A;  2Z4Y A;  1HM7 A;  5IK6 A;  1WKZ A;  4PVY F;  4JXN A;  4LTZ A;  4EA0 A;  2ONH A;  3LK5 A;  2AZJ A;  4OMH A;  3SDT A;  3IPI A;  4KVY A;  5ILD A;  3SAE A;  2ZCS A;  3M01 A;  4NUA A;  1ZW5 A;  3UCA A; 
#chains in the Genus database with same CATH topology
 3N3D A;  4GAX A;  4KVD A;  1DI1 A;  3V1X A;  2FTZ A;  2E93 A;  3KRF A;  4LPH F;  1DGP A;  1N1B A;  4JXY A;  1UBW A;  3LOM A;  1WL3 A;  3M0G A;  5B01 A;  3N6K F;  3VJ8 A;  5IK9 A;  3LZ9 A;  3EGT A;  3KRO A;  3ACW A;  5IMN A;  3AQ0 A;  4LIX A;  1YYR A;  2E90 A;  1KIY A;  3IBA A;  2E95 A;  3PYA A;  1N1Z A;  4XQS F;  1HX9 A;  3AQB B;  4RXE A;  5ILH A;  4KPD A;  4KVI A;  3VJA A;  5DZ2 A;  3PYB A;  5B0L A;  2E8V A;  3RBM A;  5IN8 A;  3MAV A;  1EZF A;  3DYF A;  5ERN A;  4DZW A;  4LXW A;  5DGS F;  4DWG A;  5DHK A;  2H8O A;  2AET A;  3WCI A;  2PS5 A;  1VG4 A;  4KFA A;  1HXG A;  4MC8 A;  4LFG A;  5ILI A;  3SDQ A;  1FPS A;  4E9U A;  3WEF A;  3ICM A;  5JA0 F;  3EZ3 A;  3LGK A;  3P8R A;  2OPN A;  3DYH A;  1RTR A;  2E8W A;  5B02 A;  2F9K F;  4N1Z F;  2OA6 A;  3ICN A;  4DHD A;  3ICZ A;  4OMG A;  2AZK A;  3N5J F;  3WCJ A;  5ER8 A;  3AE0 A;  4LOB A;  5E8K A;  2Z52 A;  2ZCQ A;  3N0G A;  2E4O A;  2F92 F;  1KIZ A;  4NKE A;  3PKO A;  1VG7 A;  5IL3 A;  2E8U A;  4KKM A;  4KUX A;  4LPG F;  3P8L A;  2AEL A;  3ZL6 A;  2ZCO A;  3TFN A;  4P0X A;  3Q2Z A;  3Q1O A;  5JUZ F;  4EA1 A;  3N5H F;  3DYG A;  4KK2 A;  2PS7 A;  5HNA A;  3LG5 A;  3WCA A;  3TS7 A;  3OAB B;  1JFA A;  5EAU A;  2F89 F;  2EWG A;  3N3L F;  4KQU A;  4OKM A;  5IKA A;  2DH4 A;  3OAC A;  4KQ5 A;  4MC3 A;  2Q80 A;  4KWD A;  4LZ0 A;  5A0K A;  3LDW A;  4JZX A;  4OKZ A;  2F7M F;  3ZOU A;  5B0K A;  4L2X F;  5DW7 A;  2Q9Y A;  3S9V A;  4JVJ F;  5ERO A;  3P5P A;  5KSX F;  3KRC B;  5DJP F;  2F8Z F;  3WCC A;  3WSB A;  3LMD A;  2PS8 A;  3CP6 A;  3TFP A;  1WY0 A;  4PVX F;  2AEK A;  4KQS A;  4OGU A;  3B7L A;  3LJI A;  3G4D A;  3RMG A;  4H5C F;  3WCG A;  2E94 A;  3KRP B;  5IMI A;  3WCM A;  5EAS A;  4P0W A;  5DIQ F;  3ACX A;  1YHM A;  3WCH A;  2AZL A;  2QIS A;  5DJV F;  3W7F A;  3WCD A;  3G4F A;  3TC1 A;  1WMW A;  4DXJ A;  2Z7I A;  1WL0 A;  2OGD A;  3NPR A;  5ERM A;  5ILY A;  5JV0 F;  2FOR A;  3SDV A;  4P0V A;  5B0J A;  1YQ7 A;  3WJN A;  3ACY A;  4NFK F;  5AHU B;  3EFQ A;  2RAH A;  1N21 A;  5B0I A;  1HXC A;  3WEJ A;  2P1C A;  4DWB A;  3RYW A;  4LA5 A;  2Z78 A;  5AYP A;  1V4K A;  3ADZ A;  1YYS A;  4FJQ A;  4KVW A;  3KBK A;  5I1U A;  2Z4V A;  2J5C A;  4EA2 A;  4XQT F;  4Q23 A;  3N1W F;  4NKF A;  1YJ4 A;  3KRA A;  4JYX A;  5ILZ A;  3WE9 A;  5EAT A;  5DJR F;  3N0F A;  1RQI A;  3M02 A;  4DI5 A;  5H9D A;  5DHI A;  1YHK A;  4F6V A;  1UBX A;  2Z7H A;  3OAB A;  2ONG A;  1N20 A;  3LGZ B;  1VG2 A;  1HM4 A;  3APZ A;  3PH7 A;  3VJB A;  4RXA A;  2E8T A;  3N46 F;  4LTV A;  4GA3 A;  1PS1 A;  3ZMB A;  2Z4X A;  5AEL A;  5DGN F;  3MZV A;  4LLT A;  3WSA A;  4ZQ8 A;  3SDR A;  4QPF A;  4GP1 A;  2E8X A;  4NG6 A;  1V4E A;  2ZEV A;  5HN8 A;  1N23 A;  3LLW A;  3KRC A;  1N22 A;  1VG6 A;  2F8C F;  2F94 F;  5B0M A;  3NPK A;  5A0J A;  3WCF A;  1RQJ A;  5IM1 A;  4LLS A;  4JZB A;  2ZY1 A;  3PDE A;  3Q2Q A;  3KRP A;  1UBY A;  4LFE A;  3QQV A;  4LZC A;  3OYR A;  5DGM F;  4GP2 A;  4LA6 A;  3ZCD A;  1YYT A;  5JV1 F;  1V4I A;  5HN7 A;  3LEE A;  3BNX A;  3VJE A;  5CG5 A;  3AQC B;  3TFV A;  3WCE A;  3QKC A;  5IK0 A;  4RNQ A;  1WL2 A;  4UMJ A;  5IVG A;  3RYE A;  3OAC B;  3N49 F;  3P5R A;  3LSN A;  3ICK A;  3CC9 A;  3ID0 A;  3WEH A;  3N45 F;  1HXA A;  3KRF B;  2PS4 A;  4QXS F;  4HD1 A;  4WK5 A;  3WCL A;  5JV2 F;  5B03 A;  2ZEU A;  5C05 A;  4RXD A;  2ZCR A;  5A0I A;  4NFI F;  4NFJ F;  3LVS A;  4F6X A;  1VG3 A;  4DEM F;  4E1E A;  2Z4Z A;  1JFG A;  3KRO B;  1YYQ A;  5B00 A;  3S4J A;  4E9Z A;  3KB9 A;  3M00 A;  2PS6 A;  1V4H A;  1YYU A;  5IL8 A;  3SDU A;  4LUU A;  3N1V F;  5IMP A;  3VJ9 A;  4F62 A;  3WEI A;  4H5E F;  5IKH A;  2Q9Z A;  2I19 A;  1WL1 A;  2Z4W A;  3WCB A;  3BNY A;  1V4J A;  2OPM A;  3M9U A;  1N24 A;  1UBV A;  1YHL A;  3NRI A;  4N9U A;  3VJC A;  4MC0 A;  4KPJ A;  5HN9 A;  5CG6 A;  3WEG A;  3WJO A;  4FP4 A;  3CKE A;  3WC9 A;  5ILK A;  3V66 A;  3WJK A;  3ASX A;  3P41 A;  3ZMC A;  4RXC A;  2J1O A;  5E8H A;  4K10 A;  2J1P A;  2E92 A;  3Q30 A;  4H5D F;  2E91 A;  2Z50 A;  3WEK A;  3NF2 A;  3V1V A;  4RYP A;  4LZ3 A;  3VJD A;  2O1O A;  2Q58 A;  4LFV F;  5AFX A;  5E8L A;  4XQR F;  1YV5 A;  3KRA B;  2VF6 A;  5ILJ A;  2Z4Y A;  1HM7 A;  5IK6 A;  1WKZ A;  4PVY F;  4JXN A;  4LTZ A;  4EA0 A;  2ONH A;  3LK5 A;  2AZJ A;  4OMH A;  3SDT A;  3IPI A;  4KVY A;  5ILD A;  3SAE A;  2ZCS A;  3M01 A;  4NUA A;  1ZW5 A;  3UCA A; 
#chains in the Genus database with same CATH homology
 3N3D A;  4GAX A;  4KVD A;  1DI1 A;  3V1X A;  2FTZ A;  2E93 A;  3KRF A;  4LPH F;  1DGP A;  1N1B A;  4JXY A;  1UBW A;  3LOM A;  1WL3 A;  3M0G A;  5B01 A;  3N6K F;  3VJ8 A;  5IK9 A;  3LZ9 A;  3EGT A;  3KRO A;  3ACW A;  5IMN A;  3AQ0 A;  4LIX A;  1YYR A;  2E90 A;  1KIY A;  3IBA A;  2E95 A;  3PYA A;  1N1Z A;  4XQS F;  1HX9 A;  3AQB B;  4RXE A;  5ILH A;  4KPD A;  4KVI A;  3VJA A;  5DZ2 A;  3PYB A;  5B0L A;  2E8V A;  3RBM A;  5IN8 A;  3MAV A;  1EZF A;  3DYF A;  5ERN A;  4DZW A;  4LXW A;  5DGS F;  4DWG A;  5DHK A;  2H8O A;  2AET A;  3WCI A;  2PS5 A;  1VG4 A;  4KFA A;  1HXG A;  4MC8 A;  4LFG A;  5ILI A;  3SDQ A;  1FPS A;  4E9U A;  3WEF A;  3ICM A;  5JA0 F;  3EZ3 A;  3LGK A;  3P8R A;  2OPN A;  3DYH A;  1RTR A;  2E8W A;  5B02 A;  2F9K F;  4N1Z F;  2OA6 A;  3ICN A;  4DHD A;  3ICZ A;  4OMG A;  2AZK A;  3N5J F;  3WCJ A;  5ER8 A;  3AE0 A;  4LOB A;  5E8K A;  2Z52 A;  2ZCQ A;  3N0G A;  2E4O A;  2F92 F;  1KIZ A;  4NKE A;  3PKO A;  1VG7 A;  5IL3 A;  2E8U A;  4KKM A;  4KUX A;  4LPG F;  3P8L A;  2AEL A;  3ZL6 A;  2ZCO A;  3TFN A;  4P0X A;  3Q2Z A;  3Q1O A;  5JUZ F;  4EA1 A;  3N5H F;  3DYG A;  4KK2 A;  2PS7 A;  5HNA A;  3LG5 A;  3WCA A;  3TS7 A;  3OAB B;  1JFA A;  5EAU A;  2F89 F;  2EWG A;  3N3L F;  4KQU A;  4OKM A;  5IKA A;  2DH4 A;  3OAC A;  4KQ5 A;  4MC3 A;  2Q80 A;  4KWD A;  4LZ0 A;  5A0K A;  3LDW A;  4JZX A;  4OKZ A;  2F7M F;  3ZOU A;  5B0K A;  4L2X F;  5DW7 A;  2Q9Y A;  3S9V A;  4JVJ F;  5ERO A;  3P5P A;  5KSX F;  3KRC B;  5DJP F;  2F8Z F;  3WCC A;  3WSB A;  3LMD A;  2PS8 A;  3CP6 A;  3TFP A;  1WY0 A;  4PVX F;  2AEK A;  4KQS A;  4OGU A;  3B7L A;  3LJI A;  3G4D A;  3RMG A;  4H5C F;  3WCG A;  2E94 A;  3KRP B;  5IMI A;  3WCM A;  5EAS A;  4P0W A;  5DIQ F;  3ACX A;  1YHM A;  3WCH A;  2AZL A;  2QIS A;  5DJV F;  3W7F A;  3WCD A;  3G4F A;  3TC1 A;  1WMW A;  4DXJ A;  2Z7I A;  1WL0 A;  2OGD A;  3NPR A;  5ERM A;  5ILY A;  5JV0 F;  2FOR A;  3SDV A;  4P0V A;  5B0J A;  1YQ7 A;  3WJN A;  3ACY A;  4NFK F;  5AHU B;  3EFQ A;  2RAH A;  1N21 A;  5B0I A;  1HXC A;  3WEJ A;  2P1C A;  4DWB A;  3RYW A;  4LA5 A;  2Z78 A;  5AYP A;  1V4K A;  3ADZ A;  1YYS A;  4FJQ A;  4KVW A;  3KBK A;  5I1U A;  2Z4V A;  2J5C A;  4EA2 A;  4XQT F;  4Q23 A;  3N1W F;  4NKF A;  1YJ4 A;  3KRA A;  4JYX A;  5ILZ A;  3WE9 A;  5EAT A;  5DJR F;  3N0F A;  1RQI A;  3M02 A;  4DI5 A;  5H9D A;  5DHI A;  1YHK A;  4F6V A;  1UBX A;  2Z7H A;  3OAB A;  2ONG A;  1N20 A;  3LGZ B;  1VG2 A;  1HM4 A;  3APZ A;  3PH7 A;  3VJB A;  4RXA A;  2E8T A;  3N46 F;  4LTV A;  4GA3 A;  1PS1 A;  3ZMB A;  2Z4X A;  5AEL A;  5DGN F;  3MZV A;  4LLT A;  3WSA A;  4ZQ8 A;  3SDR A;  4QPF A;  4GP1 A;  2E8X A;  4NG6 A;  1V4E A;  2ZEV A;  5HN8 A;  1N23 A;  3LLW A;  3KRC A;  1N22 A;  1VG6 A;  2F8C F;  2F94 F;  5B0M A;  3NPK A;  5A0J A;  3WCF A;  1RQJ A;  5IM1 A;  4LLS A;  4JZB A;  2ZY1 A;  3PDE A;  3Q2Q A;  3KRP A;  1UBY A;  4LFE A;  3QQV A;  4LZC A;  3OYR A;  5DGM F;  4GP2 A;  4LA6 A;  3ZCD A;  1YYT A;  5JV1 F;  1V4I A;  5HN7 A;  3LEE A;  3BNX A;  3VJE A;  5CG5 A;  3AQC B;  3TFV A;  3WCE A;  3QKC A;  5IK0 A;  4RNQ A;  1WL2 A;  4UMJ A;  5IVG A;  3RYE A;  3OAC B;  3N49 F;  3P5R A;  3LSN A;  3ICK A;  3CC9 A;  3ID0 A;  3WEH A;  3N45 F;  1HXA A;  3KRF B;  2PS4 A;  4QXS F;  4HD1 A;  4WK5 A;  3WCL A;  5JV2 F;  5B03 A;  2ZEU A;  5C05 A;  4RXD A;  2ZCR A;  5A0I A;  4NFI F;  4NFJ F;  3LVS A;  4F6X A;  1VG3 A;  4DEM F;  4E1E A;  2Z4Z A;  1JFG A;  3KRO B;  1YYQ A;  5B00 A;  3S4J A;  4E9Z A;  3KB9 A;  3M00 A;  2PS6 A;  1V4H A;  1YYU A;  5IL8 A;  3SDU A;  4LUU A;  3N1V F;  5IMP A;  3VJ9 A;  4F62 A;  3WEI A;  4H5E F;  5IKH A;  2Q9Z A;  2I19 A;  1WL1 A;  2Z4W A;  3WCB A;  3BNY A;  1V4J A;  2OPM A;  3M9U A;  1N24 A;  1UBV A;  1YHL A;  3NRI A;  4N9U A;  3VJC A;  4MC0 A;  4KPJ A;  5HN9 A;  5CG6 A;  3WEG A;  3WJO A;  4FP4 A;  3CKE A;  3WC9 A;  5ILK A;  3V66 A;  3WJK A;  3ASX A;  3P41 A;  3ZMC A;  4RXC A;  2J1O A;  5E8H A;  4K10 A;  2J1P A;  2E92 A;  3Q30 A;  4H5D F;  2E91 A;  2Z50 A;  3WEK A;  3NF2 A;  3V1V A;  4RYP A;  4LZ3 A;  3VJD A;  2O1O A;  2Q58 A;  4LFV F;  5AFX A;  5E8L A;  4XQR F;  1YV5 A;  3KRA B;  2VF6 A;  5ILJ A;  2Z4Y A;  1HM7 A;  5IK6 A;  1WKZ A;  4PVY F;  4JXN A;  4LTZ A;  4EA0 A;  2ONH A;  3LK5 A;  2AZJ A;  4OMH A;  3SDT A;  3IPI A;  4KVY A;  5ILD A;  3SAE A;  2ZCS A;  3M01 A;  4NUA A;  1ZW5 A;  3UCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...