5AFXA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-1238
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
367
structure length
357
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FARNESYL PYROPHOSPHATE SYNTHASE
publication title Inhibition of Trypanosoma Brucei Cell Growth by Lipophilic Bisphosphonates: An in Vitro and in Vivo Investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
molecule tags Transferase
total genus 141
structure length 357
sequence length 367
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5afxA00
4XQRF 5DJPF 3WJOA 2E90A 3LMDA 3M9UA 2E8TA 3KRFA 5AFXA 3WCIA 4XQSF 4F62A 3AQCB 3RBMA 2J5CA 4RXEA 3OABB 5DHKA 2J1OA 5IKAA 3Q30A 2AETA 4DI5A 2E8WA 2F92F 2Q9YA 3V1XA 3ICZA 3ICMA 1V4IA 3LDWA 5HNAA 3RYWA 1N24A 2P1CA 5CG5A 5AHUB 3DYGA 4H5EF 5KSXF 2OA6A 2Z4WA 5E8LA 1VG3A 4E1EA 3SDVA 3N1WF 3P8RA 3ZOUA 1VG6A 5I1UA 4H5DF 4DHDA 4DWGA 5AYPA 2PS8A 1WKZA 3ACWA 5DIQF 5JV0F 2EWGA 2ZCSA 2E8VA 5DGMF 1VG2A 1WMWA 4XQTF 5DJVF 1WL1A 3LOMA 5ERMA 4F6VA 3SAEA 5ILZA 3P5RA 1V4KA 3MZVA 3ACXA 2Z7HA 5DJRF 3VJEA 2AELA 3PKOA 1VG7A 2FORA 2F7MF 1DI1A 3V66A 2E8XA 5ERNA 4NFJF 5HN8A 4MC8A 3WCMA 3NPRA 4RXCA 5B02A 3VJ9A 3WCJA 2Z4VA 4Q23A 3WEKA 5B00A 5IMPA 2ZCOA 3WE9A 3EFQA 2AZJA 1N1BA 3OABA 4LFGA 5JV2F 5B0IA 3LEEA 2F9KF 3WCHA 1WL3A 3LGZB 5IL8A 3G4FA 5ILHA 3Q2QA 3RYEA 1YHKA 3WCDA 3N0GA 5DZ2A 4GP2A 4DWBA 5JUZF 4L2XF 4PVXF 4KK2A 3ICKA 3N5HF 5B0MA 3ICNA 1N23A 4LPGF 1WL0A 1VG4A 4FJQA 4LA6A 3EZ3A 3N0FA 2PS6A 5IKHA 3ZCDA 3VJAA 3WCBA 1YYTA 3PH7A 2DH4A 4NFIF 4LA5A 3W7FA 4LZ0A 4QPFA 2OGDA 1YHMA 3AQBB 3P5PA 1HXCA 2E8UA 3Q1OA 3WCAA 1YV5A 4LPHF 4OGUA 5HN7A 4K10A 1WY0A 3N5JF 4KQUA 5CG6A 2E95A 4H5CF 3M02A 4RNQA 3B7LA 5DGSF 1RQIA 4OMHA 1V4EA 2H8OA 4NKEA 5JV1F 4NUAA 4EA0A 3QQVA 3M0GA 4KPDA 5A0JA 4JVJF 4F6XA 3WSBA 3WEIA 2Q58A 3N6KF 5DHIA 2F8ZF 2OPMA 3KROB 3SDRA 4LZ3A 1HM4A 4N9UA 4RXAA 1V4HA 5DGNF 4LTZA 4P0XA 1RTRA 4P0WA 4MC0A 5EROA 1DGPA 3UCAA 4QXSF 4KKMA 3WCGA 3WCFA 2E94A 2I19A 5IN8A 3WJNA 4LZCA 1HX9A 3VJBA 3WJKA 5ILIA 1KIZA 3TFNA 5A0IA 4EA2A 3CC9A 4OKMA 3PYAA 5IMNA 5IK6A 5C05A 5ILKA 3M00A 3N49F 1YYUA 3RMGA 3VJ8A 4ZQ8A 2F94F 4OKZA 5IVGA 4LFEA 4PVYF 2ZCQA 5E8HA 3WSAA 2Q9ZA 2Z52A 2Z4YA 3SDTA 4LXWA 4JYXA 3MAVA 2Z4XA 3QKCA 4N1ZF 3AE0A 3S4JA 2ZY1A 5IL3A 4KFAA 1RQJA 5EATA 3PDEA 1UBVA 3KRPB 4NG6A 4JZXA 3WCCA 1YJ4A 3ACYA 1YYSA 3P41A 2RAHA 4KVYA 3TFVA 1HXAA 2VF6A 1V4JA 3WC9A 3VJCA 3LVSA 1HM7A 2PS5A 3KROA 5B0JA 2O1OA 5B0KA 2E4OA 3KRCA 5ER8A 5A0KA 4JXYA 5B0LA 2E92A 4LTVA 5HN9A 5IK9A 3OACB 4GAXA 5EAUA 4KQ5A 2ZCRA 2F8CF 3PYBA 4E9ZA 1KIYA 2QISA 3ADZA 3WEJA 1N22A 1UBYA 3WEGA 5EASA 3IBAA 1UBWA 4DXJA 5ILJA 5ILDA 4JZBA 3BNYA 2Q80A 4KUXA 4FP4A 3KRAB 5E8KA 2PS4A 3V1VA 3LSNA 3TS7A 2PS7A 2Z7IA 3ZMBA 3N1VF 3KRCB 4KQSA 3OYRA 4EA1A 3N45F 2FTZA 2AZLA 3LG5A 3WCLA 3IPIA 4HD1A 1YHLA 4GA3A 3KB9A 5AELA 4KPJA 1JFAA 1FPSA 4GP1A 3KRPA 3CP6A 2Z50A 2AZKA 2E91A 1UBXA 3ID0A 3SDQA 3M01A 5ILYA 1EZFA 3LGKA 3EGTA 2ONGA 4P0VA 3KRFB 5IM1A 3ZMCA 2E93A 3N3DA 3LLWA 5H9DA 3VJDA 4KVWA 3SDUA 3LZ9A 4KVIA 3WEFA 3BNXA 1N1ZA 5IK0A 2ZEUA 3OACA 3LK5A 5B03A 3N46F 5IMIA 3Q2ZA 3DYFA 3DYHA 3APZA 1YQ7A 1N20A 4LOBA 2J1PA 4UMJA 3S9VA 3TFPA 3NRIA 4NFKF 5B01A 4OMGA 4LLTA 3G4DA 3P8LA 5JA0F 4DEMF 2ONHA 1HXGA 1ZW5A 3NPKA 4E9UA 3KRAA 4MC3A 1JFGA 2OPNA 4LFVF 5DW7A 3N3LF 1PS1A 3ASXA 4JXNA 3CKEA 1WL2A 1N21A 2F89F 4WK5A 4RXDA 3NF2A 4LLSA 4KWDA 3KBKA 4LIXA 4RYPA 3TC1A 2Z4ZA 2Z78A 4LUUA 4NKFA 1YYQA 3WCEA 3WEHA 3AQ0A 2AEKA 3ZL6A 4DZWA 2ZEVA 1YYRA 3LJIA 4KVDA
chains in the Genus database with same CATH superfamily
4XQRF 5DJPF 3WJOA 2E90A 3LMDA 3M9UA 2E8TA 3KRFA 5AFXA 3WCIA 4XQSF 4F62A 3AQCB 3RBMA 2J5CA 4RXEA 3OABB 5DHKA 2J1OA 5IKAA 3Q30A 2AETA 4DI5A 2E8WA 2F92F 2Q9YA 3V1XA 3ICZA 3ICMA 1V4IA 3LDWA 5HNAA 3RYWA 1N24A 2P1CA 5CG5A 5AHUB 3DYGA 4H5EF 5KSXF 2OA6A 2Z4WA 5E8LA 1VG3A 4E1EA 3SDVA 3N1WF 3P8RA 3ZOUA 1VG6A 5I1UA 4H5DF 4DHDA 4DWGA 5AYPA 2PS8A 1WKZA 3ACWA 5DIQF 5JV0F 2EWGA 2ZCSA 2E8VA 5DGMF 1VG2A 1WMWA 4XQTF 5DJVF 1WL1A 3LOMA 5ERMA 4F6VA 3SAEA 5ILZA 3P5RA 1V4KA 3MZVA 3ACXA 2Z7HA 5DJRF 3VJEA 2AELA 3PKOA 1VG7A 2FORA 2F7MF 1DI1A 3V66A 2E8XA 5ERNA 4NFJF 5HN8A 4MC8A 3WCMA 3NPRA 4RXCA 5B02A 3VJ9A 3WCJA 2Z4VA 4Q23A 3WEKA 5B00A 5IMPA 2ZCOA 3WE9A 3EFQA 2AZJA 1N1BA 3OABA 4LFGA 5JV2F 5B0IA 3LEEA 2F9KF 3WCHA 1WL3A 3LGZB 5IL8A 3G4FA 5ILHA 3Q2QA 3RYEA 1YHKA 3WCDA 3N0GA 5DZ2A 4GP2A 4DWBA 5JUZF 4L2XF 4PVXF 4KK2A 3ICKA 3N5HF 5B0MA 3ICNA 1N23A 4LPGF 1WL0A 1VG4A 4FJQA 4LA6A 3EZ3A 3N0FA 2PS6A 5IKHA 3ZCDA 3VJAA 3WCBA 1YYTA 3PH7A 2DH4A 4NFIF 4LA5A 3W7FA 4LZ0A 4QPFA 2OGDA 1YHMA 3AQBB 3P5PA 1HXCA 2E8UA 3Q1OA 3WCAA 1YV5A 4LPHF 4OGUA 5HN7A 4K10A 1WY0A 3N5JF 4KQUA 5CG6A 2E95A 4H5CF 3M02A 4RNQA 3B7LA 5DGSF 1RQIA 4OMHA 1V4EA 2H8OA 4NKEA 5JV1F 4NUAA 4EA0A 3QQVA 3M0GA 4KPDA 5A0JA 4JVJF 4F6XA 3WSBA 3WEIA 2Q58A 3N6KF 5DHIA 2F8ZF 2OPMA 3KROB 3SDRA 4LZ3A 1HM4A 4N9UA 4RXAA 1V4HA 5DGNF 4LTZA 4P0XA 1RTRA 4P0WA 4MC0A 5EROA 1DGPA 3UCAA 4QXSF 4KKMA 3WCGA 3WCFA 2E94A 2I19A 5IN8A 3WJNA 4LZCA 1HX9A 3VJBA 3WJKA 5ILIA 1KIZA 3TFNA 5A0IA 4EA2A 3CC9A 4OKMA 3PYAA 5IMNA 5IK6A 5C05A 5ILKA 3M00A 3N49F 1YYUA 3RMGA 3VJ8A 4ZQ8A 2F94F 4OKZA 5IVGA 4LFEA 4PVYF 2ZCQA 5E8HA 3WSAA 2Q9ZA 2Z52A 2Z4YA 3SDTA 4LXWA 4JYXA 3MAVA 2Z4XA 3QKCA 4N1ZF 3AE0A 3S4JA 2ZY1A 5IL3A 4KFAA 1RQJA 5EATA 3PDEA 1UBVA 3KRPB 4NG6A 4JZXA 3WCCA 1YJ4A 3ACYA 1YYSA 3P41A 2RAHA 4KVYA 3TFVA 1HXAA 2VF6A 1V4JA 3WC9A 3VJCA 3LVSA 1HM7A 2PS5A 3KROA 5B0JA 2O1OA 5B0KA 2E4OA 3KRCA 5ER8A 5A0KA 4JXYA 5B0LA 2E92A 4LTVA 5HN9A 5IK9A 3OACB 4GAXA 5EAUA 4KQ5A 2ZCRA 2F8CF 3PYBA 4E9ZA 1KIYA 2QISA 3ADZA 3WEJA 1N22A 1UBYA 3WEGA 5EASA 3IBAA 1UBWA 4DXJA 5ILJA 5ILDA 4JZBA 3BNYA 2Q80A 4KUXA 4FP4A 3KRAB 5E8KA 2PS4A 3V1VA 3LSNA 3TS7A 2PS7A 2Z7IA 3ZMBA 3N1VF 3KRCB 4KQSA 3OYRA 4EA1A 3N45F 2FTZA 2AZLA 3LG5A 3WCLA 3IPIA 4HD1A 1YHLA 4GA3A 3KB9A 5AELA 4KPJA 1JFAA 1FPSA 4GP1A 3KRPA 3CP6A 2Z50A 2AZKA 2E91A 1UBXA 3ID0A 3SDQA 3M01A 5ILYA 1EZFA 3LGKA 3EGTA 2ONGA 4P0VA 3KRFB 5IM1A 3ZMCA 2E93A 3N3DA 3LLWA 5H9DA 3VJDA 4KVWA 3SDUA 3LZ9A 4KVIA 3WEFA 3BNXA 1N1ZA 5IK0A 2ZEUA 3OACA 3LK5A 5B03A 3N46F 5IMIA 3Q2ZA 3DYFA 3DYHA 3APZA 1YQ7A 1N20A 4LOBA 2J1PA 4UMJA 3S9VA 3TFPA 3NRIA 4NFKF 5B01A 4OMGA 4LLTA 3G4DA 3P8LA 5JA0F 4DEMF 2ONHA 1HXGA 1ZW5A 3NPKA 4E9UA 3KRAA 4MC3A 1JFGA 2OPNA 4LFVF 5DW7A 3N3LF 1PS1A 3ASXA 4JXNA 3CKEA 1WL2A 1N21A 2F89F 4WK5A 4RXDA 3NF2A 4LLSA 4KWDA 3KBKA 4LIXA 4RYPA 3TC1A 2Z4ZA 2Z78A 4LUUA 4NKFA 1YYQA 3WCEA 3WEHA 3AQ0A 2AEKA 3ZL6A 4DZWA 2ZEVA 1YYRA 3LJIA 4KVDA
chains in the Genus database with same CATH topology
4XQRF 5DJPF 3WJOA 2E90A 3LMDA 3M9UA 2E8TA 3KRFA 5AFXA 3WCIA 4XQSF 4F62A 3AQCB 3RBMA 2J5CA 4RXEA 3OABB 5DHKA 2J1OA 5IKAA 3Q30A 2AETA 4DI5A 2E8WA 2F92F 2Q9YA 3V1XA 3ICZA 3ICMA 1V4IA 3LDWA 5HNAA 3RYWA 1N24A 2P1CA 5CG5A 5AHUB 3DYGA 4H5EF 5KSXF 2OA6A 2Z4WA 5E8LA 1VG3A 4E1EA 3SDVA 3N1WF 3P8RA 3ZOUA 1VG6A 5I1UA 4H5DF 4DHDA 4DWGA 5AYPA 2PS8A 1WKZA 3ACWA 5DIQF 5JV0F 2EWGA 2ZCSA 2E8VA 5DGMF 1VG2A 1WMWA 4XQTF 5DJVF 1WL1A 3LOMA 5ERMA 4F6VA 3SAEA 5ILZA 3P5RA 1V4KA 3MZVA 3ACXA 2Z7HA 5DJRF 3VJEA 2AELA 3PKOA 1VG7A 2FORA 2F7MF 1DI1A 3V66A 2E8XA 5ERNA 4NFJF 5HN8A 4MC8A 3WCMA 3NPRA 4RXCA 5B02A 3VJ9A 3WCJA 2Z4VA 4Q23A 3WEKA 5B00A 5IMPA 2ZCOA 3WE9A 3EFQA 2AZJA 1N1BA 3OABA 4LFGA 5JV2F 5B0IA 3LEEA 2F9KF 3WCHA 1WL3A 3LGZB 5IL8A 3G4FA 5ILHA 3Q2QA 3RYEA 1YHKA 3WCDA 3N0GA 5DZ2A 4GP2A 4DWBA 5JUZF 4L2XF 4PVXF 4KK2A 3ICKA 3N5HF 5B0MA 3ICNA 1N23A 4LPGF 1WL0A 1VG4A 4FJQA 4LA6A 3EZ3A 3N0FA 2PS6A 5IKHA 3ZCDA 3VJAA 3WCBA 1YYTA 3PH7A 2DH4A 4NFIF 4LA5A 3W7FA 4LZ0A 4QPFA 2OGDA 1YHMA 3AQBB 3P5PA 1HXCA 2E8UA 3Q1OA 3WCAA 1YV5A 4LPHF 4OGUA 5HN7A 4K10A 1WY0A 3N5JF 4KQUA 5CG6A 2E95A 4H5CF 3M02A 4RNQA 3B7LA 5DGSF 1RQIA 4OMHA 1V4EA 2H8OA 4NKEA 5JV1F 4NUAA 4EA0A 3QQVA 3M0GA 4KPDA 5A0JA 4JVJF 4F6XA 3WSBA 3WEIA 2Q58A 3N6KF 5DHIA 2F8ZF 2OPMA 3KROB 3SDRA 4LZ3A 1HM4A 4N9UA 4RXAA 1V4HA 5DGNF 4LTZA 4P0XA 1RTRA 4P0WA 4MC0A 5EROA 1DGPA 3UCAA 4QXSF 4KKMA 3WCGA 3WCFA 2E94A 2I19A 5IN8A 3WJNA 4LZCA 1HX9A 3VJBA 3WJKA 5ILIA 1KIZA 3TFNA 5A0IA 4EA2A 3CC9A 4OKMA 3PYAA 5IMNA 5IK6A 5C05A 5ILKA 3M00A 3N49F 1YYUA 3RMGA 3VJ8A 4ZQ8A 2F94F 4OKZA 5IVGA 4LFEA 4PVYF 2ZCQA 5E8HA 3WSAA 2Q9ZA 2Z52A 2Z4YA 3SDTA 4LXWA 4JYXA 3MAVA 2Z4XA 3QKCA 4N1ZF 3AE0A 3S4JA 2ZY1A 5IL3A 4KFAA 1RQJA 5EATA 3PDEA 1UBVA 3KRPB 4NG6A 4JZXA 3WCCA 1YJ4A 3ACYA 1YYSA 3P41A 2RAHA 4KVYA 3TFVA 1HXAA 2VF6A 1V4JA 3WC9A 3VJCA 3LVSA 1HM7A 2PS5A 3KROA 5B0JA 2O1OA 5B0KA 2E4OA 3KRCA 5ER8A 5A0KA 4JXYA 5B0LA 2E92A 4LTVA 5HN9A 5IK9A 3OACB 4GAXA 5EAUA 4KQ5A 2ZCRA 2F8CF 3PYBA 4E9ZA 1KIYA 2QISA 3ADZA 3WEJA 1N22A 1UBYA 3WEGA 5EASA 3IBAA 1UBWA 4DXJA 5ILJA 5ILDA 4JZBA 3BNYA 2Q80A 4KUXA 4FP4A 3KRAB 5E8KA 2PS4A 3V1VA 3LSNA 3TS7A 2PS7A 2Z7IA 3ZMBA 3N1VF 3KRCB 4KQSA 3OYRA 4EA1A 3N45F 2FTZA 2AZLA 3LG5A 3WCLA 3IPIA 4HD1A 1YHLA 4GA3A 3KB9A 5AELA 4KPJA 1JFAA 1FPSA 4GP1A 3KRPA 3CP6A 2Z50A 2AZKA 2E91A 1UBXA 3ID0A 3SDQA 3M01A 5ILYA 1EZFA 3LGKA 3EGTA 2ONGA 4P0VA 3KRFB 5IM1A 3ZMCA 2E93A 3N3DA 3LLWA 5H9DA 3VJDA 4KVWA 3SDUA 3LZ9A 4KVIA 3WEFA 3BNXA 1N1ZA 5IK0A 2ZEUA 3OACA 3LK5A 5B03A 3N46F 5IMIA 3Q2ZA 3DYFA 3DYHA 3APZA 1YQ7A 1N20A 4LOBA 2J1PA 4UMJA 3S9VA 3TFPA 3NRIA 4NFKF 5B01A 4OMGA 4LLTA 3G4DA 3P8LA 5JA0F 4DEMF 2ONHA 1HXGA 1ZW5A 3NPKA 4E9UA 3KRAA 4MC3A 1JFGA 2OPNA 4LFVF 5DW7A 3N3LF 1PS1A 3ASXA 4JXNA 3CKEA 1WL2A 1N21A 2F89F 4WK5A 4RXDA 3NF2A 4LLSA 4KWDA 3KBKA 4LIXA 4RYPA 3TC1A 2Z4ZA 2Z78A 4LUUA 4NKFA 1YYQA 3WCEA 3WEHA 3AQ0A 2AEKA 3ZL6A 4DZWA 2ZEVA 1YYRA 3LJIA 4KVDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQR F;  5DJP F;  3WJO A;  2E90 A;  3LMD A;  3M9U A;  2E8T A;  3KRF A;  5AFX A;  3WCI A;  4XQS F;  4F62 A;  3AQC B;  3RBM A;  2J5C A;  4RXE A;  3OAB B;  5DHK A;  2J1O A;  5IKA A;  3Q30 A;  2AET A;  4DI5 A;  2E8W A;  2F92 F;  2Q9Y A;  3V1X A;  3ICZ A;  3ICM A;  1V4I A;  3LDW A;  5HNA A;  3RYW A;  1N24 A;  2P1C A;  5CG5 A;  5AHU B;  3DYG A;  4H5E F;  5KSX F;  2OA6 A;  2Z4W A;  5E8L A;  1VG3 A;  4E1E A;  3SDV A;  3N1W F;  3P8R A;  3ZOU A;  1VG6 A;  5I1U A;  4H5D F;  4DHD A;  4DWG A;  5AYP A;  2PS8 A;  1WKZ A;  3ACW A;  5DIQ F;  5JV0 F;  2EWG A;  2ZCS A;  2E8V A;  5DGM F;  1VG2 A;  1WMW A;  4XQT F;  5DJV F;  1WL1 A;  3LOM A;  5ERM A;  4F6V A;  3SAE A;  5ILZ A;  3P5R A;  1V4K A;  3MZV A;  3ACX A;  2Z7H A;  5DJR F;  3VJE A;  2AEL A;  3PKO A;  1VG7 A;  2FOR A;  2F7M F;  1DI1 A;  3V66 A;  2E8X A;  5ERN A;  4NFJ F;  5HN8 A;  4MC8 A;  3WCM A;  3NPR A;  4RXC A;  5B02 A;  3VJ9 A;  3WCJ A;  2Z4V A;  4Q23 A;  3WEK A;  5B00 A;  5IMP A;  2ZCO A;  3WE9 A;  3EFQ A;  2AZJ A;  1N1B A;  3OAB A;  4LFG A;  5JV2 F;  5B0I A;  3LEE A;  2F9K F;  3WCH A;  1WL3 A;  3LGZ B;  5IL8 A;  3G4F A;  5ILH A;  3Q2Q A;  3RYE A;  1YHK A;  3WCD A;  3N0G A;  5DZ2 A;  4GP2 A;  4DWB A;  5JUZ F;  4L2X F;  4PVX F;  4KK2 A;  3ICK A;  3N5H F;  5B0M A;  3ICN A;  1N23 A;  4LPG F;  1WL0 A;  1VG4 A;  4FJQ A;  4LA6 A;  3EZ3 A;  3N0F A;  2PS6 A;  5IKH A;  3ZCD A;  3VJA A;  3WCB A;  1YYT A;  3PH7 A;  2DH4 A;  4NFI F;  4LA5 A;  3W7F A;  4LZ0 A;  4QPF A;  2OGD A;  1YHM A;  3AQB B;  3P5P A;  1HXC A;  2E8U A;  3Q1O A;  3WCA A;  1YV5 A;  4LPH F;  4OGU A;  5HN7 A;  4K10 A;  1WY0 A;  3N5J F;  4KQU A;  5CG6 A;  2E95 A;  4H5C F;  3M02 A;  4RNQ A;  3B7L A;  5DGS F;  1RQI A;  4OMH A;  1V4E A;  2H8O A;  4NKE A;  5JV1 F;  4NUA A;  4EA0 A;  3QQV A;  3M0G A;  4KPD A;  5A0J A;  4JVJ F;  4F6X A;  3WSB A;  3WEI A;  2Q58 A;  3N6K F;  5DHI A;  2F8Z F;  2OPM A;  3KRO B;  3SDR A;  4LZ3 A;  1HM4 A;  4N9U A;  4RXA A;  1V4H A;  5DGN F;  4LTZ A;  4P0X A;  1RTR A;  4P0W A;  4MC0 A;  5ERO A;  1DGP A;  3UCA A;  4QXS F;  4KKM A;  3WCG A;  3WCF A;  2E94 A;  2I19 A;  5IN8 A;  3WJN A;  4LZC A;  1HX9 A;  3VJB A;  3WJK A;  5ILI A;  1KIZ A;  3TFN A;  5A0I A;  4EA2 A;  3CC9 A;  4OKM A;  3PYA A;  5IMN A;  5IK6 A;  5C05 A;  5ILK A;  3M00 A;  3N49 F;  1YYU A;  3RMG A;  3VJ8 A;  4ZQ8 A;  2F94 F;  4OKZ A;  5IVG A;  4LFE A;  4PVY F;  2ZCQ A;  5E8H A;  3WSA A;  2Q9Z A;  2Z52 A;  2Z4Y A;  3SDT A;  4LXW A;  4JYX A;  3MAV A;  2Z4X A;  3QKC A;  4N1Z F;  3AE0 A;  3S4J A;  2ZY1 A;  5IL3 A;  4KFA A;  1RQJ A;  5EAT A;  3PDE A;  1UBV A;  3KRP B;  4NG6 A;  4JZX A;  3WCC A;  1YJ4 A;  3ACY A;  1YYS A;  3P41 A;  2RAH A;  4KVY A;  3TFV A;  1HXA A;  2VF6 A;  1V4J A;  3WC9 A;  3VJC A;  3LVS A;  1HM7 A;  2PS5 A;  3KRO A;  5B0J A;  2O1O A;  5B0K A;  2E4O A;  3KRC A;  5ER8 A;  5A0K A;  4JXY A;  5B0L A;  2E92 A;  4LTV A;  5HN9 A;  5IK9 A;  3OAC B;  4GAX A;  5EAU A;  4KQ5 A;  2ZCR A;  2F8C F;  3PYB A;  4E9Z A;  1KIY A;  2QIS A;  3ADZ A;  3WEJ A;  1N22 A;  1UBY A;  3WEG A;  5EAS A;  3IBA A;  1UBW A;  4DXJ A;  5ILJ A;  5ILD A;  4JZB A;  3BNY A;  2Q80 A;  4KUX A;  4FP4 A;  3KRA B;  5E8K A;  2PS4 A;  3V1V A;  3LSN A;  3TS7 A;  2PS7 A;  2Z7I A;  3ZMB A;  3N1V F;  3KRC B;  4KQS A;  3OYR A;  4EA1 A;  3N45 F;  2FTZ A;  2AZL A;  3LG5 A;  3WCL A;  3IPI A;  4HD1 A;  1YHL A;  4GA3 A;  3KB9 A;  5AEL A;  4KPJ A;  1JFA A;  1FPS A;  4GP1 A;  3KRP A;  3CP6 A;  2Z50 A;  2AZK A;  2E91 A;  1UBX A;  3ID0 A;  3SDQ A;  3M01 A;  5ILY A;  1EZF A;  3LGK A;  3EGT A;  2ONG A;  4P0V A;  3KRF B;  5IM1 A;  3ZMC A;  2E93 A;  3N3D A;  3LLW A;  5H9D A;  3VJD A;  4KVW A;  3SDU A;  3LZ9 A;  4KVI A;  3WEF A;  3BNX A;  1N1Z A;  5IK0 A;  2ZEU A;  3OAC A;  3LK5 A;  5B03 A;  3N46 F;  5IMI A;  3Q2Z A;  3DYF A;  3DYH A;  3APZ A;  1YQ7 A;  1N20 A;  4LOB A;  2J1P A;  4UMJ A;  3S9V A;  3TFP A;  3NRI A;  4NFK F;  5B01 A;  4OMG A;  4LLT A;  3G4D A;  3P8L A;  5JA0 F;  4DEM F;  2ONH A;  1HXG A;  1ZW5 A;  3NPK A;  4E9U A;  3KRA A;  4MC3 A;  1JFG A;  2OPN A;  4LFV F;  5DW7 A;  3N3L F;  1PS1 A;  3ASX A;  4JXN A;  3CKE A;  1WL2 A;  1N21 A;  2F89 F;  4WK5 A;  4RXD A;  3NF2 A;  4LLS A;  4KWD A;  3KBK A;  4LIX A;  4RYP A;  3TC1 A;  2Z4Z A;  2Z78 A;  4LUU A;  4NKF A;  1YYQ A;  3WCE A;  3WEH A;  3AQ0 A;  2AEK A;  3ZL6 A;  4DZW A;  2ZEV A;  1YYR A;  3LJI A;  4KVD A; 
#chains in the Genus database with same CATH topology
 4XQR F;  5DJP F;  3WJO A;  2E90 A;  3LMD A;  3M9U A;  2E8T A;  3KRF A;  5AFX A;  3WCI A;  4XQS F;  4F62 A;  3AQC B;  3RBM A;  2J5C A;  4RXE A;  3OAB B;  5DHK A;  2J1O A;  5IKA A;  3Q30 A;  2AET A;  4DI5 A;  2E8W A;  2F92 F;  2Q9Y A;  3V1X A;  3ICZ A;  3ICM A;  1V4I A;  3LDW A;  5HNA A;  3RYW A;  1N24 A;  2P1C A;  5CG5 A;  5AHU B;  3DYG A;  4H5E F;  5KSX F;  2OA6 A;  2Z4W A;  5E8L A;  1VG3 A;  4E1E A;  3SDV A;  3N1W F;  3P8R A;  3ZOU A;  1VG6 A;  5I1U A;  4H5D F;  4DHD A;  4DWG A;  5AYP A;  2PS8 A;  1WKZ A;  3ACW A;  5DIQ F;  5JV0 F;  2EWG A;  2ZCS A;  2E8V A;  5DGM F;  1VG2 A;  1WMW A;  4XQT F;  5DJV F;  1WL1 A;  3LOM A;  5ERM A;  4F6V A;  3SAE A;  5ILZ A;  3P5R A;  1V4K A;  3MZV A;  3ACX A;  2Z7H A;  5DJR F;  3VJE A;  2AEL A;  3PKO A;  1VG7 A;  2FOR A;  2F7M F;  1DI1 A;  3V66 A;  2E8X A;  5ERN A;  4NFJ F;  5HN8 A;  4MC8 A;  3WCM A;  3NPR A;  4RXC A;  5B02 A;  3VJ9 A;  3WCJ A;  2Z4V A;  4Q23 A;  3WEK A;  5B00 A;  5IMP A;  2ZCO A;  3WE9 A;  3EFQ A;  2AZJ A;  1N1B A;  3OAB A;  4LFG A;  5JV2 F;  5B0I A;  3LEE A;  2F9K F;  3WCH A;  1WL3 A;  3LGZ B;  5IL8 A;  3G4F A;  5ILH A;  3Q2Q A;  3RYE A;  1YHK A;  3WCD A;  3N0G A;  5DZ2 A;  4GP2 A;  4DWB A;  5JUZ F;  4L2X F;  4PVX F;  4KK2 A;  3ICK A;  3N5H F;  5B0M A;  3ICN A;  1N23 A;  4LPG F;  1WL0 A;  1VG4 A;  4FJQ A;  4LA6 A;  3EZ3 A;  3N0F A;  2PS6 A;  5IKH A;  3ZCD A;  3VJA A;  3WCB A;  1YYT A;  3PH7 A;  2DH4 A;  4NFI F;  4LA5 A;  3W7F A;  4LZ0 A;  4QPF A;  2OGD A;  1YHM A;  3AQB B;  3P5P A;  1HXC A;  2E8U A;  3Q1O A;  3WCA A;  1YV5 A;  4LPH F;  4OGU A;  5HN7 A;  4K10 A;  1WY0 A;  3N5J F;  4KQU A;  5CG6 A;  2E95 A;  4H5C F;  3M02 A;  4RNQ A;  3B7L A;  5DGS F;  1RQI A;  4OMH A;  1V4E A;  2H8O A;  4NKE A;  5JV1 F;  4NUA A;  4EA0 A;  3QQV A;  3M0G A;  4KPD A;  5A0J A;  4JVJ F;  4F6X A;  3WSB A;  3WEI A;  2Q58 A;  3N6K F;  5DHI A;  2F8Z F;  2OPM A;  3KRO B;  3SDR A;  4LZ3 A;  1HM4 A;  4N9U A;  4RXA A;  1V4H A;  5DGN F;  4LTZ A;  4P0X A;  1RTR A;  4P0W A;  4MC0 A;  5ERO A;  1DGP A;  3UCA A;  4QXS F;  4KKM A;  3WCG A;  3WCF A;  2E94 A;  2I19 A;  5IN8 A;  3WJN A;  4LZC A;  1HX9 A;  3VJB A;  3WJK A;  5ILI A;  1KIZ A;  3TFN A;  5A0I A;  4EA2 A;  3CC9 A;  4OKM A;  3PYA A;  5IMN A;  5IK6 A;  5C05 A;  5ILK A;  3M00 A;  3N49 F;  1YYU A;  3RMG A;  3VJ8 A;  4ZQ8 A;  2F94 F;  4OKZ A;  5IVG A;  4LFE A;  4PVY F;  2ZCQ A;  5E8H A;  3WSA A;  2Q9Z A;  2Z52 A;  2Z4Y A;  3SDT A;  4LXW A;  4JYX A;  3MAV A;  2Z4X A;  3QKC A;  4N1Z F;  3AE0 A;  3S4J A;  2ZY1 A;  5IL3 A;  4KFA A;  1RQJ A;  5EAT A;  3PDE A;  1UBV A;  3KRP B;  4NG6 A;  4JZX A;  3WCC A;  1YJ4 A;  3ACY A;  1YYS A;  3P41 A;  2RAH A;  4KVY A;  3TFV A;  1HXA A;  2VF6 A;  1V4J A;  3WC9 A;  3VJC A;  3LVS A;  1HM7 A;  2PS5 A;  3KRO A;  5B0J A;  2O1O A;  5B0K A;  2E4O A;  3KRC A;  5ER8 A;  5A0K A;  4JXY A;  5B0L A;  2E92 A;  4LTV A;  5HN9 A;  5IK9 A;  3OAC B;  4GAX A;  5EAU A;  4KQ5 A;  2ZCR A;  2F8C F;  3PYB A;  4E9Z A;  1KIY A;  2QIS A;  3ADZ A;  3WEJ A;  1N22 A;  1UBY A;  3WEG A;  5EAS A;  3IBA A;  1UBW A;  4DXJ A;  5ILJ A;  5ILD A;  4JZB A;  3BNY A;  2Q80 A;  4KUX A;  4FP4 A;  3KRA B;  5E8K A;  2PS4 A;  3V1V A;  3LSN A;  3TS7 A;  2PS7 A;  2Z7I A;  3ZMB A;  3N1V F;  3KRC B;  4KQS A;  3OYR A;  4EA1 A;  3N45 F;  2FTZ A;  2AZL A;  3LG5 A;  3WCL A;  3IPI A;  4HD1 A;  1YHL A;  4GA3 A;  3KB9 A;  5AEL A;  4KPJ A;  1JFA A;  1FPS A;  4GP1 A;  3KRP A;  3CP6 A;  2Z50 A;  2AZK A;  2E91 A;  1UBX A;  3ID0 A;  3SDQ A;  3M01 A;  5ILY A;  1EZF A;  3LGK A;  3EGT A;  2ONG A;  4P0V A;  3KRF B;  5IM1 A;  3ZMC A;  2E93 A;  3N3D A;  3LLW A;  5H9D A;  3VJD A;  4KVW A;  3SDU A;  3LZ9 A;  4KVI A;  3WEF A;  3BNX A;  1N1Z A;  5IK0 A;  2ZEU A;  3OAC A;  3LK5 A;  5B03 A;  3N46 F;  5IMI A;  3Q2Z A;  3DYF A;  3DYH A;  3APZ A;  1YQ7 A;  1N20 A;  4LOB A;  2J1P A;  4UMJ A;  3S9V A;  3TFP A;  3NRI A;  4NFK F;  5B01 A;  4OMG A;  4LLT A;  3G4D A;  3P8L A;  5JA0 F;  4DEM F;  2ONH A;  1HXG A;  1ZW5 A;  3NPK A;  4E9U A;  3KRA A;  4MC3 A;  1JFG A;  2OPN A;  4LFV F;  5DW7 A;  3N3L F;  1PS1 A;  3ASX A;  4JXN A;  3CKE A;  1WL2 A;  1N21 A;  2F89 F;  4WK5 A;  4RXD A;  3NF2 A;  4LLS A;  4KWD A;  3KBK A;  4LIX A;  4RYP A;  3TC1 A;  2Z4Z A;  2Z78 A;  4LUU A;  4NKF A;  1YYQ A;  3WCE A;  3WEH A;  3AQ0 A;  2AEK A;  3ZL6 A;  4DZW A;  2ZEV A;  1YYR A;  3LJI A;  4KVD A; 
#chains in the Genus database with same CATH homology
 4XQR F;  5DJP F;  3WJO A;  2E90 A;  3LMD A;  3M9U A;  2E8T A;  3KRF A;  5AFX A;  3WCI A;  4XQS F;  4F62 A;  3AQC B;  3RBM A;  2J5C A;  4RXE A;  3OAB B;  5DHK A;  2J1O A;  5IKA A;  3Q30 A;  2AET A;  4DI5 A;  2E8W A;  2F92 F;  2Q9Y A;  3V1X A;  3ICZ A;  3ICM A;  1V4I A;  3LDW A;  5HNA A;  3RYW A;  1N24 A;  2P1C A;  5CG5 A;  5AHU B;  3DYG A;  4H5E F;  5KSX F;  2OA6 A;  2Z4W A;  5E8L A;  1VG3 A;  4E1E A;  3SDV A;  3N1W F;  3P8R A;  3ZOU A;  1VG6 A;  5I1U A;  4H5D F;  4DHD A;  4DWG A;  5AYP A;  2PS8 A;  1WKZ A;  3ACW A;  5DIQ F;  5JV0 F;  2EWG A;  2ZCS A;  2E8V A;  5DGM F;  1VG2 A;  1WMW A;  4XQT F;  5DJV F;  1WL1 A;  3LOM A;  5ERM A;  4F6V A;  3SAE A;  5ILZ A;  3P5R A;  1V4K A;  3MZV A;  3ACX A;  2Z7H A;  5DJR F;  3VJE A;  2AEL A;  3PKO A;  1VG7 A;  2FOR A;  2F7M F;  1DI1 A;  3V66 A;  2E8X A;  5ERN A;  4NFJ F;  5HN8 A;  4MC8 A;  3WCM A;  3NPR A;  4RXC A;  5B02 A;  3VJ9 A;  3WCJ A;  2Z4V A;  4Q23 A;  3WEK A;  5B00 A;  5IMP A;  2ZCO A;  3WE9 A;  3EFQ A;  2AZJ A;  1N1B A;  3OAB A;  4LFG A;  5JV2 F;  5B0I A;  3LEE A;  2F9K F;  3WCH A;  1WL3 A;  3LGZ B;  5IL8 A;  3G4F A;  5ILH A;  3Q2Q A;  3RYE A;  1YHK A;  3WCD A;  3N0G A;  5DZ2 A;  4GP2 A;  4DWB A;  5JUZ F;  4L2X F;  4PVX F;  4KK2 A;  3ICK A;  3N5H F;  5B0M A;  3ICN A;  1N23 A;  4LPG F;  1WL0 A;  1VG4 A;  4FJQ A;  4LA6 A;  3EZ3 A;  3N0F A;  2PS6 A;  5IKH A;  3ZCD A;  3VJA A;  3WCB A;  1YYT A;  3PH7 A;  2DH4 A;  4NFI F;  4LA5 A;  3W7F A;  4LZ0 A;  4QPF A;  2OGD A;  1YHM A;  3AQB B;  3P5P A;  1HXC A;  2E8U A;  3Q1O A;  3WCA A;  1YV5 A;  4LPH F;  4OGU A;  5HN7 A;  4K10 A;  1WY0 A;  3N5J F;  4KQU A;  5CG6 A;  2E95 A;  4H5C F;  3M02 A;  4RNQ A;  3B7L A;  5DGS F;  1RQI A;  4OMH A;  1V4E A;  2H8O A;  4NKE A;  5JV1 F;  4NUA A;  4EA0 A;  3QQV A;  3M0G A;  4KPD A;  5A0J A;  4JVJ F;  4F6X A;  3WSB A;  3WEI A;  2Q58 A;  3N6K F;  5DHI A;  2F8Z F;  2OPM A;  3KRO B;  3SDR A;  4LZ3 A;  1HM4 A;  4N9U A;  4RXA A;  1V4H A;  5DGN F;  4LTZ A;  4P0X A;  1RTR A;  4P0W A;  4MC0 A;  5ERO A;  1DGP A;  3UCA A;  4QXS F;  4KKM A;  3WCG A;  3WCF A;  2E94 A;  2I19 A;  5IN8 A;  3WJN A;  4LZC A;  1HX9 A;  3VJB A;  3WJK A;  5ILI A;  1KIZ A;  3TFN A;  5A0I A;  4EA2 A;  3CC9 A;  4OKM A;  3PYA A;  5IMN A;  5IK6 A;  5C05 A;  5ILK A;  3M00 A;  3N49 F;  1YYU A;  3RMG A;  3VJ8 A;  4ZQ8 A;  2F94 F;  4OKZ A;  5IVG A;  4LFE A;  4PVY F;  2ZCQ A;  5E8H A;  3WSA A;  2Q9Z A;  2Z52 A;  2Z4Y A;  3SDT A;  4LXW A;  4JYX A;  3MAV A;  2Z4X A;  3QKC A;  4N1Z F;  3AE0 A;  3S4J A;  2ZY1 A;  5IL3 A;  4KFA A;  1RQJ A;  5EAT A;  3PDE A;  1UBV A;  3KRP B;  4NG6 A;  4JZX A;  3WCC A;  1YJ4 A;  3ACY A;  1YYS A;  3P41 A;  2RAH A;  4KVY A;  3TFV A;  1HXA A;  2VF6 A;  1V4J A;  3WC9 A;  3VJC A;  3LVS A;  1HM7 A;  2PS5 A;  3KRO A;  5B0J A;  2O1O A;  5B0K A;  2E4O A;  3KRC A;  5ER8 A;  5A0K A;  4JXY A;  5B0L A;  2E92 A;  4LTV A;  5HN9 A;  5IK9 A;  3OAC B;  4GAX A;  5EAU A;  4KQ5 A;  2ZCR A;  2F8C F;  3PYB A;  4E9Z A;  1KIY A;  2QIS A;  3ADZ A;  3WEJ A;  1N22 A;  1UBY A;  3WEG A;  5EAS A;  3IBA A;  1UBW A;  4DXJ A;  5ILJ A;  5ILD A;  4JZB A;  3BNY A;  2Q80 A;  4KUX A;  4FP4 A;  3KRA B;  5E8K A;  2PS4 A;  3V1V A;  3LSN A;  3TS7 A;  2PS7 A;  2Z7I A;  3ZMB A;  3N1V F;  3KRC B;  4KQS A;  3OYR A;  4EA1 A;  3N45 F;  2FTZ A;  2AZL A;  3LG5 A;  3WCL A;  3IPI A;  4HD1 A;  1YHL A;  4GA3 A;  3KB9 A;  5AEL A;  4KPJ A;  1JFA A;  1FPS A;  4GP1 A;  3KRP A;  3CP6 A;  2Z50 A;  2AZK A;  2E91 A;  1UBX A;  3ID0 A;  3SDQ A;  3M01 A;  5ILY A;  1EZF A;  3LGK A;  3EGT A;  2ONG A;  4P0V A;  3KRF B;  5IM1 A;  3ZMC A;  2E93 A;  3N3D A;  3LLW A;  5H9D A;  3VJD A;  4KVW A;  3SDU A;  3LZ9 A;  4KVI A;  3WEF A;  3BNX A;  1N1Z A;  5IK0 A;  2ZEU A;  3OAC A;  3LK5 A;  5B03 A;  3N46 F;  5IMI A;  3Q2Z A;  3DYF A;  3DYH A;  3APZ A;  1YQ7 A;  1N20 A;  4LOB A;  2J1P A;  4UMJ A;  3S9V A;  3TFP A;  3NRI A;  4NFK F;  5B01 A;  4OMG A;  4LLT A;  3G4D A;  3P8L A;  5JA0 F;  4DEM F;  2ONH A;  1HXG A;  1ZW5 A;  3NPK A;  4E9U A;  3KRA A;  4MC3 A;  1JFG A;  2OPN A;  4LFV F;  5DW7 A;  3N3L F;  1PS1 A;  3ASX A;  4JXN A;  3CKE A;  1WL2 A;  1N21 A;  2F89 F;  4WK5 A;  4RXD A;  3NF2 A;  4LLS A;  4KWD A;  3KBK A;  4LIX A;  4RYP A;  3TC1 A;  2Z4Z A;  2Z78 A;  4LUU A;  4NKF A;  1YYQ A;  3WCE A;  3WEH A;  3AQ0 A;  2AEK A;  3ZL6 A;  4DZW A;  2ZEV A;  1YYR A;  3LJI A;  4KVD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...