5AFXA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-1238
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
367
structure length
357
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FARNESYL PYROPHOSPHATE SYNTHASE
publication title Inhibition of Trypanosoma Brucei Cell Growth by Lipophilic Bisphosphonates: An in Vitro and in Vivo Investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 141
structure length 357
sequence length 367
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5afxA00
1HXCA 2Z4XA 2OGDA 5IKAA 4QPFA 1VG4A 2F8ZF 5IMNA 3TC1A 4RNQA 2J1OA 3WCDA 2AEKA 5AELA 4P0XA 5IKHA 3MAVA 4NG6A 3QQVA 1HM7A 3W7FA 4WK5A 5IK6A 3ACYA 4E1EA 3WEFA 3AQCB 2Z50A 1HXAA 3WJOA 3VJDA 2VF6A 5B0IA 2EWGA 4KVWA 3CKEA 3ICNA 3VJ8A 3WCIA 5ILKA 5B0JA 1HXGA 3PDEA 1V4EA 4LA6A 4NFKF 1ZW5A 4OMGA 3N1VF 5I1UA 2FTZA 3KRAB 4GA3A 3N46F 3P41A 3VJAA 1VG6A 4JYXA 4KPJA 4RXCA 3LEEA 4RXAA 5ILIA 1YYQA 4DWGA 3SAEA 1WL1A 3WEIA 3WCMA 2E8XA 5B0LA 2PS8A 4XQSF 3KRFA 1UBVA 4LXWA 1VG7A 4RXEA 4Q23A 3AQBB 1VG2A 2E8VA 3LSNA 1WKZA 5E8HA 3LVSA 5B01A 2OA6A 2RAHA 4PVYF 5IK0A 4F6XA 3N6KF 3VJ9A 3ADZA 3WJKA 3WEKA 2ZY1A 3V66A 3NRIA 3Q30A 3WCCA 5JUZF 4NKEA 3S9VA 3TS7A 3M01A 3G4DA 3KRCB 5DHIA 3RMGA 5E8LA 2AELA 3IPIA 2ZEUA 4DEMF 3N49F 3N3LF 4LFVF 3CC9A 3RYWA 5DGNF 4LIXA 3LG5A 3AE0A 4H5EF 2PS5A 4LZ3A 5ILHA 1UBXA 4KFAA 3DYGA 4RYPA 3EGTA 5DHKA 4LLTA 3WEHA 1UBWA 1N1BA 3OACA 4OKZA 3TFPA 4EA0A 3KRAA 1YYRA 2ZCRA 3N0FA 5H9DA 4H5DF 3KB9A 5DGSF 3WCAA 4DZWA 2O1OA 5CG6A 1UBYA 3ID0A 1VG3A 4LFGA 2AZLA 5IVGA 2Q9ZA 3PH7A 4KQSA 1YHKA 1JFAA 2Z4ZA 2F8CF 4GAXA 2ZCQA 2F92F 2Z7HA 4DHDA 5KSXF 3LGKA 3OYRA 3ZL6A 2J1PA 2F94F 3WE9A 3WCBA 2E8WA 2I19A 5B03A 3ICMA 2FORA 3KROA 5JV0F 3OACB 5B0KA 3PYAA 1YHMA 5DJRF 4H5CF 4KWDA 3WCGA 2AZKA 3KRCA 1PS1A 4DI5A 3N3DA 1N24A 1RTRA 3LLWA 4E9UA 5ILDA 3Q1OA 3WEJA 5IMPA 4OGUA 1YV5A 4L2XF 3TFVA 1WL0A 1YJ4A 2F89F 4KVIA 2H8OA 1RQIA 5IN8A 4RXDA 4NKFA 2E91A 3M02A 5AFXA 1KIZA 3ZMBA 3AQ0A 4LTVA 5EROA 1YYSA 4JZXA 3APZA 3Q2ZA 4KK2A 1WL3A 3V1XA 3WC9A 4DWBA 5DW7A 3KROB 5JV1F 2P1CA 2AZJA 3CP6A 5HN8A 3S4JA 3WSBA 3IBAA 3WEGA 1YYTA 3WCJA 3NF2A 4QXSF 3KBKA 2E93A 2Z78A 4MC0A 5CG5A 4KVDA 2F9KF 3TFNA 1V4IA 2J5CA 3P8LA 2Z4YA 5AYPA 4ZQ8A 4F62A 1RQJA 2PS4A 3NPRA 3VJEA 1N23A 5EAUA 1V4KA 5IM1A 2PS6A 4MC8A 2F7MF 4UMJA 4N1ZF 2ONGA 4P0WA 4LA5A 5IL8A 1N20A 5DIQF 3WCHA 4PVXF 3WCEA 4HD1A 1DGPA 3P5PA 5ERNA 3QKCA 3ICZA 3ZCDA 3LGZB 1HM4A 3SDUA 1DI1A 1KIYA 3VJBA 1WMWA 4LPHF 4LPGF 1EZFA 4GP2A 5A0JA 4JVJF 3MZVA 5JA0F 4KKMA 3KRPA 3PYBA 4LUUA 4OMHA 5DZ2A 4NUAA 4DXJA 4OKMA 5EATA 5B0MA 3Q2QA 2OPNA 3SDVA 3WCLA 2E95A 1FPSA 5A0IA 3SDTA 3B7LA 4XQTF 2ONHA 3N0GA 4KVYA 5HN7A 1N1ZA 3VJCA 1V4HA 3WCFA 4GP1A 4LZCA 5IL3A 5JV2F 3PKOA 2Q9YA 3M00A 1HX9A 4FJQA 5HN9A 5B02A 3G4FA 5DGMF 3WJNA 3KRPB 4N9UA 5E8KA 4EA2A 3EFQA 3NPKA 3LK5A 3OABA 4E9ZA 2DH4A 4XQRF 3N1WF 2E8UA 3SDQA 3LJIA 1YYUA 3EZ3A 4MC3A 3M9UA 5C05A 3LZ9A 3LDWA 4LOBA 5DJPF 2QISA 1WY0A 2E94A 3LOMA 3ZMCA 4P0VA 4JXNA 5DJVF 3WSAA 4LFEA 5ILZA 3LMDA 5ILJA 3P8RA 3ASXA 4NFIF 2Q80A 4EA1A 3DYHA 3ICKA 4FP4A 3M0GA 4KQ5A 3BNYA 2Z4VA 4NFJF 5ER8A 2ZEVA 2E4OA 1YQ7A 4JZBA 3OABB 1YHLA 5IK9A 3BNXA 3RYEA 2Q58A 5HNAA 2Z4WA 4LTZA 2ZCSA 5A0KA 3V1VA 2PS7A 3ACXA 3RBMA 3UCAA 4LLSA 3N5JF 2E90A 1WL2A 4JXYA 3ACWA 3ZOUA 5ILYA 5AHUB 4KUXA 2E8TA 2ZCOA 2AETA 2Z7IA 5ERMA 4LZ0A 4K10A 3KRFB 1V4JA 3N5HF 4KPDA 3N45F 4F6VA 1JFGA 3P5RA 1N22A 3SDRA 3DYFA 5B00A 2OPMA 1N21A 4KQUA 2Z52A 5IMIA 2E92A 5EASA
chains in the Genus database with same CATH superfamily
1HXCA 2Z4XA 2OGDA 5IKAA 4QPFA 1VG4A 2F8ZF 5IMNA 3TC1A 4RNQA 2J1OA 3WCDA 2AEKA 5AELA 4P0XA 5IKHA 3MAVA 4NG6A 3QQVA 1HM7A 3W7FA 4WK5A 5IK6A 3ACYA 4E1EA 3WEFA 3AQCB 2Z50A 1HXAA 3WJOA 3VJDA 2VF6A 5B0IA 2EWGA 4KVWA 3CKEA 3ICNA 3VJ8A 3WCIA 5ILKA 5B0JA 1HXGA 3PDEA 1V4EA 4LA6A 4NFKF 1ZW5A 4OMGA 3N1VF 5I1UA 2FTZA 3KRAB 4GA3A 3N46F 3P41A 3VJAA 1VG6A 4JYXA 4KPJA 4RXCA 3LEEA 4RXAA 5ILIA 1YYQA 4DWGA 3SAEA 1WL1A 3WEIA 3WCMA 2E8XA 5B0LA 2PS8A 4XQSF 3KRFA 1UBVA 4LXWA 1VG7A 4RXEA 4Q23A 3AQBB 1VG2A 2E8VA 3LSNA 1WKZA 5E8HA 3LVSA 5B01A 2OA6A 2RAHA 4PVYF 5IK0A 4F6XA 3N6KF 3VJ9A 3ADZA 3WJKA 3WEKA 2ZY1A 3V66A 3NRIA 3Q30A 3WCCA 5JUZF 4NKEA 3S9VA 3TS7A 3M01A 3G4DA 3KRCB 5DHIA 3RMGA 5E8LA 2AELA 3IPIA 2ZEUA 4DEMF 3N49F 3N3LF 4LFVF 3CC9A 3RYWA 5DGNF 4LIXA 3LG5A 3AE0A 4H5EF 2PS5A 4LZ3A 5ILHA 1UBXA 4KFAA 3DYGA 4RYPA 3EGTA 5DHKA 4LLTA 3WEHA 1UBWA 1N1BA 3OACA 4OKZA 3TFPA 4EA0A 3KRAA 1YYRA 2ZCRA 3N0FA 5H9DA 4H5DF 3KB9A 5DGSF 3WCAA 4DZWA 2O1OA 5CG6A 1UBYA 3ID0A 1VG3A 4LFGA 2AZLA 5IVGA 2Q9ZA 3PH7A 4KQSA 1YHKA 1JFAA 2Z4ZA 2F8CF 4GAXA 2ZCQA 2F92F 2Z7HA 4DHDA 5KSXF 3LGKA 3OYRA 3ZL6A 2J1PA 2F94F 3WE9A 3WCBA 2E8WA 2I19A 5B03A 3ICMA 2FORA 3KROA 5JV0F 3OACB 5B0KA 3PYAA 1YHMA 5DJRF 4H5CF 4KWDA 3WCGA 2AZKA 3KRCA 1PS1A 4DI5A 3N3DA 1N24A 1RTRA 3LLWA 4E9UA 5ILDA 3Q1OA 3WEJA 5IMPA 4OGUA 1YV5A 4L2XF 3TFVA 1WL0A 1YJ4A 2F89F 4KVIA 2H8OA 1RQIA 5IN8A 4RXDA 4NKFA 2E91A 3M02A 5AFXA 1KIZA 3ZMBA 3AQ0A 4LTVA 5EROA 1YYSA 4JZXA 3APZA 3Q2ZA 4KK2A 1WL3A 3V1XA 3WC9A 4DWBA 5DW7A 3KROB 5JV1F 2P1CA 2AZJA 3CP6A 5HN8A 3S4JA 3WSBA 3IBAA 3WEGA 1YYTA 3WCJA 3NF2A 4QXSF 3KBKA 2E93A 2Z78A 4MC0A 5CG5A 4KVDA 2F9KF 3TFNA 1V4IA 2J5CA 3P8LA 2Z4YA 5AYPA 4ZQ8A 4F62A 1RQJA 2PS4A 3NPRA 3VJEA 1N23A 5EAUA 1V4KA 5IM1A 2PS6A 4MC8A 2F7MF 4UMJA 4N1ZF 2ONGA 4P0WA 4LA5A 5IL8A 1N20A 5DIQF 3WCHA 4PVXF 3WCEA 4HD1A 1DGPA 3P5PA 5ERNA 3QKCA 3ICZA 3ZCDA 3LGZB 1HM4A 3SDUA 1DI1A 1KIYA 3VJBA 1WMWA 4LPHF 4LPGF 1EZFA 4GP2A 5A0JA 4JVJF 3MZVA 5JA0F 4KKMA 3KRPA 3PYBA 4LUUA 4OMHA 5DZ2A 4NUAA 4DXJA 4OKMA 5EATA 5B0MA 3Q2QA 2OPNA 3SDVA 3WCLA 2E95A 1FPSA 5A0IA 3SDTA 3B7LA 4XQTF 2ONHA 3N0GA 4KVYA 5HN7A 1N1ZA 3VJCA 1V4HA 3WCFA 4GP1A 4LZCA 5IL3A 5JV2F 3PKOA 2Q9YA 3M00A 1HX9A 4FJQA 5HN9A 5B02A 3G4FA 5DGMF 3WJNA 3KRPB 4N9UA 5E8KA 4EA2A 3EFQA 3NPKA 3LK5A 3OABA 4E9ZA 2DH4A 4XQRF 3N1WF 2E8UA 3SDQA 3LJIA 1YYUA 3EZ3A 4MC3A 3M9UA 5C05A 3LZ9A 3LDWA 4LOBA 5DJPF 2QISA 1WY0A 2E94A 3LOMA 3ZMCA 4P0VA 4JXNA 5DJVF 3WSAA 4LFEA 5ILZA 3LMDA 5ILJA 3P8RA 3ASXA 4NFIF 2Q80A 4EA1A 3DYHA 3ICKA 4FP4A 3M0GA 4KQ5A 3BNYA 2Z4VA 4NFJF 5ER8A 2ZEVA 2E4OA 1YQ7A 4JZBA 3OABB 1YHLA 5IK9A 3BNXA 3RYEA 2Q58A 5HNAA 2Z4WA 4LTZA 2ZCSA 5A0KA 3V1VA 2PS7A 3ACXA 3RBMA 3UCAA 4LLSA 3N5JF 2E90A 1WL2A 4JXYA 3ACWA 3ZOUA 5ILYA 5AHUB 4KUXA 2E8TA 2ZCOA 2AETA 2Z7IA 5ERMA 4LZ0A 4K10A 3KRFB 1V4JA 3N5HF 4KPDA 3N45F 4F6VA 1JFGA 3P5RA 1N22A 3SDRA 3DYFA 5B00A 2OPMA 1N21A 4KQUA 2Z52A 5IMIA 2E92A 5EASA
chains in the Genus database with same CATH topology
1HXCA 2Z4XA 2OGDA 5IKAA 4QPFA 1VG4A 2F8ZF 5IMNA 3TC1A 4RNQA 2J1OA 3WCDA 2AEKA 5AELA 4P0XA 5IKHA 3MAVA 4NG6A 3QQVA 1HM7A 3W7FA 4WK5A 5IK6A 3ACYA 4E1EA 3WEFA 3AQCB 2Z50A 1HXAA 3WJOA 3VJDA 2VF6A 5B0IA 2EWGA 4KVWA 3CKEA 3ICNA 3VJ8A 3WCIA 5ILKA 5B0JA 1HXGA 3PDEA 1V4EA 4LA6A 4NFKF 1ZW5A 4OMGA 3N1VF 5I1UA 2FTZA 3KRAB 4GA3A 3N46F 3P41A 3VJAA 1VG6A 4JYXA 4KPJA 4RXCA 3LEEA 4RXAA 5ILIA 1YYQA 4DWGA 3SAEA 1WL1A 3WEIA 3WCMA 2E8XA 5B0LA 2PS8A 4XQSF 3KRFA 1UBVA 4LXWA 1VG7A 4RXEA 4Q23A 3AQBB 1VG2A 2E8VA 3LSNA 1WKZA 5E8HA 3LVSA 5B01A 2OA6A 2RAHA 4PVYF 5IK0A 4F6XA 3N6KF 3VJ9A 3ADZA 3WJKA 3WEKA 2ZY1A 3V66A 3NRIA 3Q30A 3WCCA 5JUZF 4NKEA 3S9VA 3TS7A 3M01A 3G4DA 3KRCB 5DHIA 3RMGA 5E8LA 2AELA 3IPIA 2ZEUA 4DEMF 3N49F 3N3LF 4LFVF 3CC9A 3RYWA 5DGNF 4LIXA 3LG5A 3AE0A 4H5EF 2PS5A 4LZ3A 5ILHA 1UBXA 4KFAA 3DYGA 4RYPA 3EGTA 5DHKA 4LLTA 3WEHA 1UBWA 1N1BA 3OACA 4OKZA 3TFPA 4EA0A 3KRAA 1YYRA 2ZCRA 3N0FA 5H9DA 4H5DF 3KB9A 5DGSF 3WCAA 4DZWA 2O1OA 5CG6A 1UBYA 3ID0A 1VG3A 4LFGA 2AZLA 5IVGA 2Q9ZA 3PH7A 4KQSA 1YHKA 1JFAA 2Z4ZA 2F8CF 4GAXA 2ZCQA 2F92F 2Z7HA 4DHDA 5KSXF 3LGKA 3OYRA 3ZL6A 2J1PA 2F94F 3WE9A 3WCBA 2E8WA 2I19A 5B03A 3ICMA 2FORA 3KROA 5JV0F 3OACB 5B0KA 3PYAA 1YHMA 5DJRF 4H5CF 4KWDA 3WCGA 2AZKA 3KRCA 1PS1A 4DI5A 3N3DA 1N24A 1RTRA 3LLWA 4E9UA 5ILDA 3Q1OA 3WEJA 5IMPA 4OGUA 1YV5A 4L2XF 3TFVA 1WL0A 1YJ4A 2F89F 4KVIA 2H8OA 1RQIA 5IN8A 4RXDA 4NKFA 2E91A 3M02A 5AFXA 1KIZA 3ZMBA 3AQ0A 4LTVA 5EROA 1YYSA 4JZXA 3APZA 3Q2ZA 4KK2A 1WL3A 3V1XA 3WC9A 4DWBA 5DW7A 3KROB 5JV1F 2P1CA 2AZJA 3CP6A 5HN8A 3S4JA 3WSBA 3IBAA 3WEGA 1YYTA 3WCJA 3NF2A 4QXSF 3KBKA 2E93A 2Z78A 4MC0A 5CG5A 4KVDA 2F9KF 3TFNA 1V4IA 2J5CA 3P8LA 2Z4YA 5AYPA 4ZQ8A 4F62A 1RQJA 2PS4A 3NPRA 3VJEA 1N23A 5EAUA 1V4KA 5IM1A 2PS6A 4MC8A 2F7MF 4UMJA 4N1ZF 2ONGA 4P0WA 4LA5A 5IL8A 1N20A 5DIQF 3WCHA 4PVXF 3WCEA 4HD1A 1DGPA 3P5PA 5ERNA 3QKCA 3ICZA 3ZCDA 3LGZB 1HM4A 3SDUA 1DI1A 1KIYA 3VJBA 1WMWA 4LPHF 4LPGF 1EZFA 4GP2A 5A0JA 4JVJF 3MZVA 5JA0F 4KKMA 3KRPA 3PYBA 4LUUA 4OMHA 5DZ2A 4NUAA 4DXJA 4OKMA 5EATA 5B0MA 3Q2QA 2OPNA 3SDVA 3WCLA 2E95A 1FPSA 5A0IA 3SDTA 3B7LA 4XQTF 2ONHA 3N0GA 4KVYA 5HN7A 1N1ZA 3VJCA 1V4HA 3WCFA 4GP1A 4LZCA 5IL3A 5JV2F 3PKOA 2Q9YA 3M00A 1HX9A 4FJQA 5HN9A 5B02A 3G4FA 5DGMF 3WJNA 3KRPB 4N9UA 5E8KA 4EA2A 3EFQA 3NPKA 3LK5A 3OABA 4E9ZA 2DH4A 4XQRF 3N1WF 2E8UA 3SDQA 3LJIA 1YYUA 3EZ3A 4MC3A 3M9UA 5C05A 3LZ9A 3LDWA 4LOBA 5DJPF 2QISA 1WY0A 2E94A 3LOMA 3ZMCA 4P0VA 4JXNA 5DJVF 3WSAA 4LFEA 5ILZA 3LMDA 5ILJA 3P8RA 3ASXA 4NFIF 2Q80A 4EA1A 3DYHA 3ICKA 4FP4A 3M0GA 4KQ5A 3BNYA 2Z4VA 4NFJF 5ER8A 2ZEVA 2E4OA 1YQ7A 4JZBA 3OABB 1YHLA 5IK9A 3BNXA 3RYEA 2Q58A 5HNAA 2Z4WA 4LTZA 2ZCSA 5A0KA 3V1VA 2PS7A 3ACXA 3RBMA 3UCAA 4LLSA 3N5JF 2E90A 1WL2A 4JXYA 3ACWA 3ZOUA 5ILYA 5AHUB 4KUXA 2E8TA 2ZCOA 2AETA 2Z7IA 5ERMA 4LZ0A 4K10A 3KRFB 1V4JA 3N5HF 4KPDA 3N45F 4F6VA 1JFGA 3P5RA 1N22A 3SDRA 3DYFA 5B00A 2OPMA 1N21A 4KQUA 2Z52A 5IMIA 2E92A 5EASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXC A;  2Z4X A;  2OGD A;  5IKA A;  4QPF A;  1VG4 A;  2F8Z F;  5IMN A;  3TC1 A;  4RNQ A;  2J1O A;  3WCD A;  2AEK A;  5AEL A;  4P0X A;  5IKH A;  3MAV A;  4NG6 A;  3QQV A;  1HM7 A;  3W7F A;  4WK5 A;  5IK6 A;  3ACY A;  4E1E A;  3WEF A;  3AQC B;  2Z50 A;  1HXA A;  3WJO A;  3VJD A;  2VF6 A;  5B0I A;  2EWG A;  4KVW A;  3CKE A;  3ICN A;  3VJ8 A;  3WCI A;  5ILK A;  5B0J A;  1HXG A;  3PDE A;  1V4E A;  4LA6 A;  4NFK F;  1ZW5 A;  4OMG A;  3N1V F;  5I1U A;  2FTZ A;  3KRA B;  4GA3 A;  3N46 F;  3P41 A;  3VJA A;  1VG6 A;  4JYX A;  4KPJ A;  4RXC A;  3LEE A;  4RXA A;  5ILI A;  1YYQ A;  4DWG A;  3SAE A;  1WL1 A;  3WEI A;  3WCM A;  2E8X A;  5B0L A;  2PS8 A;  4XQS F;  3KRF A;  1UBV A;  4LXW A;  1VG7 A;  4RXE A;  4Q23 A;  3AQB B;  1VG2 A;  2E8V A;  3LSN A;  1WKZ A;  5E8H A;  3LVS A;  5B01 A;  2OA6 A;  2RAH A;  4PVY F;  5IK0 A;  4F6X A;  3N6K F;  3VJ9 A;  3ADZ A;  3WJK A;  3WEK A;  2ZY1 A;  3V66 A;  3NRI A;  3Q30 A;  3WCC A;  5JUZ F;  4NKE A;  3S9V A;  3TS7 A;  3M01 A;  3G4D A;  3KRC B;  5DHI A;  3RMG A;  5E8L A;  2AEL A;  3IPI A;  2ZEU A;  4DEM F;  3N49 F;  3N3L F;  4LFV F;  3CC9 A;  3RYW A;  5DGN F;  4LIX A;  3LG5 A;  3AE0 A;  4H5E F;  2PS5 A;  4LZ3 A;  5ILH A;  1UBX A;  4KFA A;  3DYG A;  4RYP A;  3EGT A;  5DHK A;  4LLT A;  3WEH A;  1UBW A;  1N1B A;  3OAC A;  4OKZ A;  3TFP A;  4EA0 A;  3KRA A;  1YYR A;  2ZCR A;  3N0F A;  5H9D A;  4H5D F;  3KB9 A;  5DGS F;  3WCA A;  4DZW A;  2O1O A;  5CG6 A;  1UBY A;  3ID0 A;  1VG3 A;  4LFG A;  2AZL A;  5IVG A;  2Q9Z A;  3PH7 A;  4KQS A;  1YHK A;  1JFA A;  2Z4Z A;  2F8C F;  4GAX A;  2ZCQ A;  2F92 F;  2Z7H A;  4DHD A;  5KSX F;  3LGK A;  3OYR A;  3ZL6 A;  2J1P A;  2F94 F;  3WE9 A;  3WCB A;  2E8W A;  2I19 A;  5B03 A;  3ICM A;  2FOR A;  3KRO A;  5JV0 F;  3OAC B;  5B0K A;  3PYA A;  1YHM A;  5DJR F;  4H5C F;  4KWD A;  3WCG A;  2AZK A;  3KRC A;  1PS1 A;  4DI5 A;  3N3D A;  1N24 A;  1RTR A;  3LLW A;  4E9U A;  5ILD A;  3Q1O A;  3WEJ A;  5IMP A;  4OGU A;  1YV5 A;  4L2X F;  3TFV A;  1WL0 A;  1YJ4 A;  2F89 F;  4KVI A;  2H8O A;  1RQI A;  5IN8 A;  4RXD A;  4NKF A;  2E91 A;  3M02 A;  5AFX A;  1KIZ A;  3ZMB A;  3AQ0 A;  4LTV A;  5ERO A;  1YYS A;  4JZX A;  3APZ A;  3Q2Z A;  4KK2 A;  1WL3 A;  3V1X A;  3WC9 A;  4DWB A;  5DW7 A;  3KRO B;  5JV1 F;  2P1C A;  2AZJ A;  3CP6 A;  5HN8 A;  3S4J A;  3WSB A;  3IBA A;  3WEG A;  1YYT A;  3WCJ A;  3NF2 A;  4QXS F;  3KBK A;  2E93 A;  2Z78 A;  4MC0 A;  5CG5 A;  4KVD A;  2F9K F;  3TFN A;  1V4I A;  2J5C A;  3P8L A;  2Z4Y A;  5AYP A;  4ZQ8 A;  4F62 A;  1RQJ A;  2PS4 A;  3NPR A;  3VJE A;  1N23 A;  5EAU A;  1V4K A;  5IM1 A;  2PS6 A;  4MC8 A;  2F7M F;  4UMJ A;  4N1Z F;  2ONG A;  4P0W A;  4LA5 A;  5IL8 A;  1N20 A;  5DIQ F;  3WCH A;  4PVX F;  3WCE A;  4HD1 A;  1DGP A;  3P5P A;  5ERN A;  3QKC A;  3ICZ A;  3ZCD A;  3LGZ B;  1HM4 A;  3SDU A;  1DI1 A;  1KIY A;  3VJB A;  1WMW A;  4LPH F;  4LPG F;  1EZF A;  4GP2 A;  5A0J A;  4JVJ F;  3MZV A;  5JA0 F;  4KKM A;  3KRP A;  3PYB A;  4LUU A;  4OMH A;  5DZ2 A;  4NUA A;  4DXJ A;  4OKM A;  5EAT A;  5B0M A;  3Q2Q A;  2OPN A;  3SDV A;  3WCL A;  2E95 A;  1FPS A;  5A0I A;  3SDT A;  3B7L A;  4XQT F;  2ONH A;  3N0G A;  4KVY A;  5HN7 A;  1N1Z A;  3VJC A;  1V4H A;  3WCF A;  4GP1 A;  4LZC A;  5IL3 A;  5JV2 F;  3PKO A;  2Q9Y A;  3M00 A;  1HX9 A;  4FJQ A;  5HN9 A;  5B02 A;  3G4F A;  5DGM F;  3WJN A;  3KRP B;  4N9U A;  5E8K A;  4EA2 A;  3EFQ A;  3NPK A;  3LK5 A;  3OAB A;  4E9Z A;  2DH4 A;  4XQR F;  3N1W F;  2E8U A;  3SDQ A;  3LJI A;  1YYU A;  3EZ3 A;  4MC3 A;  3M9U A;  5C05 A;  3LZ9 A;  3LDW A;  4LOB A;  5DJP F;  2QIS A;  1WY0 A;  2E94 A;  3LOM A;  3ZMC A;  4P0V A;  4JXN A;  5DJV F;  3WSA A;  4LFE A;  5ILZ A;  3LMD A;  5ILJ A;  3P8R A;  3ASX A;  4NFI F;  2Q80 A;  4EA1 A;  3DYH A;  3ICK A;  4FP4 A;  3M0G A;  4KQ5 A;  3BNY A;  2Z4V A;  4NFJ F;  5ER8 A;  2ZEV A;  2E4O A;  1YQ7 A;  4JZB A;  3OAB B;  1YHL A;  5IK9 A;  3BNX A;  3RYE A;  2Q58 A;  5HNA A;  2Z4W A;  4LTZ A;  2ZCS A;  5A0K A;  3V1V A;  2PS7 A;  3ACX A;  3RBM A;  3UCA A;  4LLS A;  3N5J F;  2E90 A;  1WL2 A;  4JXY A;  3ACW A;  3ZOU A;  5ILY A;  5AHU B;  4KUX A;  2E8T A;  2ZCO A;  2AET A;  2Z7I A;  5ERM A;  4LZ0 A;  4K10 A;  3KRF B;  1V4J A;  3N5H F;  4KPD A;  3N45 F;  4F6V A;  1JFG A;  3P5R A;  1N22 A;  3SDR A;  3DYF A;  5B00 A;  2OPM A;  1N21 A;  4KQU A;  2Z52 A;  5IMI A;  2E92 A;  5EAS A; 
#chains in the Genus database with same CATH topology
 1HXC A;  2Z4X A;  2OGD A;  5IKA A;  4QPF A;  1VG4 A;  2F8Z F;  5IMN A;  3TC1 A;  4RNQ A;  2J1O A;  3WCD A;  2AEK A;  5AEL A;  4P0X A;  5IKH A;  3MAV A;  4NG6 A;  3QQV A;  1HM7 A;  3W7F A;  4WK5 A;  5IK6 A;  3ACY A;  4E1E A;  3WEF A;  3AQC B;  2Z50 A;  1HXA A;  3WJO A;  3VJD A;  2VF6 A;  5B0I A;  2EWG A;  4KVW A;  3CKE A;  3ICN A;  3VJ8 A;  3WCI A;  5ILK A;  5B0J A;  1HXG A;  3PDE A;  1V4E A;  4LA6 A;  4NFK F;  1ZW5 A;  4OMG A;  3N1V F;  5I1U A;  2FTZ A;  3KRA B;  4GA3 A;  3N46 F;  3P41 A;  3VJA A;  1VG6 A;  4JYX A;  4KPJ A;  4RXC A;  3LEE A;  4RXA A;  5ILI A;  1YYQ A;  4DWG A;  3SAE A;  1WL1 A;  3WEI A;  3WCM A;  2E8X A;  5B0L A;  2PS8 A;  4XQS F;  3KRF A;  1UBV A;  4LXW A;  1VG7 A;  4RXE A;  4Q23 A;  3AQB B;  1VG2 A;  2E8V A;  3LSN A;  1WKZ A;  5E8H A;  3LVS A;  5B01 A;  2OA6 A;  2RAH A;  4PVY F;  5IK0 A;  4F6X A;  3N6K F;  3VJ9 A;  3ADZ A;  3WJK A;  3WEK A;  2ZY1 A;  3V66 A;  3NRI A;  3Q30 A;  3WCC A;  5JUZ F;  4NKE A;  3S9V A;  3TS7 A;  3M01 A;  3G4D A;  3KRC B;  5DHI A;  3RMG A;  5E8L A;  2AEL A;  3IPI A;  2ZEU A;  4DEM F;  3N49 F;  3N3L F;  4LFV F;  3CC9 A;  3RYW A;  5DGN F;  4LIX A;  3LG5 A;  3AE0 A;  4H5E F;  2PS5 A;  4LZ3 A;  5ILH A;  1UBX A;  4KFA A;  3DYG A;  4RYP A;  3EGT A;  5DHK A;  4LLT A;  3WEH A;  1UBW A;  1N1B A;  3OAC A;  4OKZ A;  3TFP A;  4EA0 A;  3KRA A;  1YYR A;  2ZCR A;  3N0F A;  5H9D A;  4H5D F;  3KB9 A;  5DGS F;  3WCA A;  4DZW A;  2O1O A;  5CG6 A;  1UBY A;  3ID0 A;  1VG3 A;  4LFG A;  2AZL A;  5IVG A;  2Q9Z A;  3PH7 A;  4KQS A;  1YHK A;  1JFA A;  2Z4Z A;  2F8C F;  4GAX A;  2ZCQ A;  2F92 F;  2Z7H A;  4DHD A;  5KSX F;  3LGK A;  3OYR A;  3ZL6 A;  2J1P A;  2F94 F;  3WE9 A;  3WCB A;  2E8W A;  2I19 A;  5B03 A;  3ICM A;  2FOR A;  3KRO A;  5JV0 F;  3OAC B;  5B0K A;  3PYA A;  1YHM A;  5DJR F;  4H5C F;  4KWD A;  3WCG A;  2AZK A;  3KRC A;  1PS1 A;  4DI5 A;  3N3D A;  1N24 A;  1RTR A;  3LLW A;  4E9U A;  5ILD A;  3Q1O A;  3WEJ A;  5IMP A;  4OGU A;  1YV5 A;  4L2X F;  3TFV A;  1WL0 A;  1YJ4 A;  2F89 F;  4KVI A;  2H8O A;  1RQI A;  5IN8 A;  4RXD A;  4NKF A;  2E91 A;  3M02 A;  5AFX A;  1KIZ A;  3ZMB A;  3AQ0 A;  4LTV A;  5ERO A;  1YYS A;  4JZX A;  3APZ A;  3Q2Z A;  4KK2 A;  1WL3 A;  3V1X A;  3WC9 A;  4DWB A;  5DW7 A;  3KRO B;  5JV1 F;  2P1C A;  2AZJ A;  3CP6 A;  5HN8 A;  3S4J A;  3WSB A;  3IBA A;  3WEG A;  1YYT A;  3WCJ A;  3NF2 A;  4QXS F;  3KBK A;  2E93 A;  2Z78 A;  4MC0 A;  5CG5 A;  4KVD A;  2F9K F;  3TFN A;  1V4I A;  2J5C A;  3P8L A;  2Z4Y A;  5AYP A;  4ZQ8 A;  4F62 A;  1RQJ A;  2PS4 A;  3NPR A;  3VJE A;  1N23 A;  5EAU A;  1V4K A;  5IM1 A;  2PS6 A;  4MC8 A;  2F7M F;  4UMJ A;  4N1Z F;  2ONG A;  4P0W A;  4LA5 A;  5IL8 A;  1N20 A;  5DIQ F;  3WCH A;  4PVX F;  3WCE A;  4HD1 A;  1DGP A;  3P5P A;  5ERN A;  3QKC A;  3ICZ A;  3ZCD A;  3LGZ B;  1HM4 A;  3SDU A;  1DI1 A;  1KIY A;  3VJB A;  1WMW A;  4LPH F;  4LPG F;  1EZF A;  4GP2 A;  5A0J A;  4JVJ F;  3MZV A;  5JA0 F;  4KKM A;  3KRP A;  3PYB A;  4LUU A;  4OMH A;  5DZ2 A;  4NUA A;  4DXJ A;  4OKM A;  5EAT A;  5B0M A;  3Q2Q A;  2OPN A;  3SDV A;  3WCL A;  2E95 A;  1FPS A;  5A0I A;  3SDT A;  3B7L A;  4XQT F;  2ONH A;  3N0G A;  4KVY A;  5HN7 A;  1N1Z A;  3VJC A;  1V4H A;  3WCF A;  4GP1 A;  4LZC A;  5IL3 A;  5JV2 F;  3PKO A;  2Q9Y A;  3M00 A;  1HX9 A;  4FJQ A;  5HN9 A;  5B02 A;  3G4F A;  5DGM F;  3WJN A;  3KRP B;  4N9U A;  5E8K A;  4EA2 A;  3EFQ A;  3NPK A;  3LK5 A;  3OAB A;  4E9Z A;  2DH4 A;  4XQR F;  3N1W F;  2E8U A;  3SDQ A;  3LJI A;  1YYU A;  3EZ3 A;  4MC3 A;  3M9U A;  5C05 A;  3LZ9 A;  3LDW A;  4LOB A;  5DJP F;  2QIS A;  1WY0 A;  2E94 A;  3LOM A;  3ZMC A;  4P0V A;  4JXN A;  5DJV F;  3WSA A;  4LFE A;  5ILZ A;  3LMD A;  5ILJ A;  3P8R A;  3ASX A;  4NFI F;  2Q80 A;  4EA1 A;  3DYH A;  3ICK A;  4FP4 A;  3M0G A;  4KQ5 A;  3BNY A;  2Z4V A;  4NFJ F;  5ER8 A;  2ZEV A;  2E4O A;  1YQ7 A;  4JZB A;  3OAB B;  1YHL A;  5IK9 A;  3BNX A;  3RYE A;  2Q58 A;  5HNA A;  2Z4W A;  4LTZ A;  2ZCS A;  5A0K A;  3V1V A;  2PS7 A;  3ACX A;  3RBM A;  3UCA A;  4LLS A;  3N5J F;  2E90 A;  1WL2 A;  4JXY A;  3ACW A;  3ZOU A;  5ILY A;  5AHU B;  4KUX A;  2E8T A;  2ZCO A;  2AET A;  2Z7I A;  5ERM A;  4LZ0 A;  4K10 A;  3KRF B;  1V4J A;  3N5H F;  4KPD A;  3N45 F;  4F6V A;  1JFG A;  3P5R A;  1N22 A;  3SDR A;  3DYF A;  5B00 A;  2OPM A;  1N21 A;  4KQU A;  2Z52 A;  5IMI A;  2E92 A;  5EAS A; 
#chains in the Genus database with same CATH homology
 1HXC A;  2Z4X A;  2OGD A;  5IKA A;  4QPF A;  1VG4 A;  2F8Z F;  5IMN A;  3TC1 A;  4RNQ A;  2J1O A;  3WCD A;  2AEK A;  5AEL A;  4P0X A;  5IKH A;  3MAV A;  4NG6 A;  3QQV A;  1HM7 A;  3W7F A;  4WK5 A;  5IK6 A;  3ACY A;  4E1E A;  3WEF A;  3AQC B;  2Z50 A;  1HXA A;  3WJO A;  3VJD A;  2VF6 A;  5B0I A;  2EWG A;  4KVW A;  3CKE A;  3ICN A;  3VJ8 A;  3WCI A;  5ILK A;  5B0J A;  1HXG A;  3PDE A;  1V4E A;  4LA6 A;  4NFK F;  1ZW5 A;  4OMG A;  3N1V F;  5I1U A;  2FTZ A;  3KRA B;  4GA3 A;  3N46 F;  3P41 A;  3VJA A;  1VG6 A;  4JYX A;  4KPJ A;  4RXC A;  3LEE A;  4RXA A;  5ILI A;  1YYQ A;  4DWG A;  3SAE A;  1WL1 A;  3WEI A;  3WCM A;  2E8X A;  5B0L A;  2PS8 A;  4XQS F;  3KRF A;  1UBV A;  4LXW A;  1VG7 A;  4RXE A;  4Q23 A;  3AQB B;  1VG2 A;  2E8V A;  3LSN A;  1WKZ A;  5E8H A;  3LVS A;  5B01 A;  2OA6 A;  2RAH A;  4PVY F;  5IK0 A;  4F6X A;  3N6K F;  3VJ9 A;  3ADZ A;  3WJK A;  3WEK A;  2ZY1 A;  3V66 A;  3NRI A;  3Q30 A;  3WCC A;  5JUZ F;  4NKE A;  3S9V A;  3TS7 A;  3M01 A;  3G4D A;  3KRC B;  5DHI A;  3RMG A;  5E8L A;  2AEL A;  3IPI A;  2ZEU A;  4DEM F;  3N49 F;  3N3L F;  4LFV F;  3CC9 A;  3RYW A;  5DGN F;  4LIX A;  3LG5 A;  3AE0 A;  4H5E F;  2PS5 A;  4LZ3 A;  5ILH A;  1UBX A;  4KFA A;  3DYG A;  4RYP A;  3EGT A;  5DHK A;  4LLT A;  3WEH A;  1UBW A;  1N1B A;  3OAC A;  4OKZ A;  3TFP A;  4EA0 A;  3KRA A;  1YYR A;  2ZCR A;  3N0F A;  5H9D A;  4H5D F;  3KB9 A;  5DGS F;  3WCA A;  4DZW A;  2O1O A;  5CG6 A;  1UBY A;  3ID0 A;  1VG3 A;  4LFG A;  2AZL A;  5IVG A;  2Q9Z A;  3PH7 A;  4KQS A;  1YHK A;  1JFA A;  2Z4Z A;  2F8C F;  4GAX A;  2ZCQ A;  2F92 F;  2Z7H A;  4DHD A;  5KSX F;  3LGK A;  3OYR A;  3ZL6 A;  2J1P A;  2F94 F;  3WE9 A;  3WCB A;  2E8W A;  2I19 A;  5B03 A;  3ICM A;  2FOR A;  3KRO A;  5JV0 F;  3OAC B;  5B0K A;  3PYA A;  1YHM A;  5DJR F;  4H5C F;  4KWD A;  3WCG A;  2AZK A;  3KRC A;  1PS1 A;  4DI5 A;  3N3D A;  1N24 A;  1RTR A;  3LLW A;  4E9U A;  5ILD A;  3Q1O A;  3WEJ A;  5IMP A;  4OGU A;  1YV5 A;  4L2X F;  3TFV A;  1WL0 A;  1YJ4 A;  2F89 F;  4KVI A;  2H8O A;  1RQI A;  5IN8 A;  4RXD A;  4NKF A;  2E91 A;  3M02 A;  5AFX A;  1KIZ A;  3ZMB A;  3AQ0 A;  4LTV A;  5ERO A;  1YYS A;  4JZX A;  3APZ A;  3Q2Z A;  4KK2 A;  1WL3 A;  3V1X A;  3WC9 A;  4DWB A;  5DW7 A;  3KRO B;  5JV1 F;  2P1C A;  2AZJ A;  3CP6 A;  5HN8 A;  3S4J A;  3WSB A;  3IBA A;  3WEG A;  1YYT A;  3WCJ A;  3NF2 A;  4QXS F;  3KBK A;  2E93 A;  2Z78 A;  4MC0 A;  5CG5 A;  4KVD A;  2F9K F;  3TFN A;  1V4I A;  2J5C A;  3P8L A;  2Z4Y A;  5AYP A;  4ZQ8 A;  4F62 A;  1RQJ A;  2PS4 A;  3NPR A;  3VJE A;  1N23 A;  5EAU A;  1V4K A;  5IM1 A;  2PS6 A;  4MC8 A;  2F7M F;  4UMJ A;  4N1Z F;  2ONG A;  4P0W A;  4LA5 A;  5IL8 A;  1N20 A;  5DIQ F;  3WCH A;  4PVX F;  3WCE A;  4HD1 A;  1DGP A;  3P5P A;  5ERN A;  3QKC A;  3ICZ A;  3ZCD A;  3LGZ B;  1HM4 A;  3SDU A;  1DI1 A;  1KIY A;  3VJB A;  1WMW A;  4LPH F;  4LPG F;  1EZF A;  4GP2 A;  5A0J A;  4JVJ F;  3MZV A;  5JA0 F;  4KKM A;  3KRP A;  3PYB A;  4LUU A;  4OMH A;  5DZ2 A;  4NUA A;  4DXJ A;  4OKM A;  5EAT A;  5B0M A;  3Q2Q A;  2OPN A;  3SDV A;  3WCL A;  2E95 A;  1FPS A;  5A0I A;  3SDT A;  3B7L A;  4XQT F;  2ONH A;  3N0G A;  4KVY A;  5HN7 A;  1N1Z A;  3VJC A;  1V4H A;  3WCF A;  4GP1 A;  4LZC A;  5IL3 A;  5JV2 F;  3PKO A;  2Q9Y A;  3M00 A;  1HX9 A;  4FJQ A;  5HN9 A;  5B02 A;  3G4F A;  5DGM F;  3WJN A;  3KRP B;  4N9U A;  5E8K A;  4EA2 A;  3EFQ A;  3NPK A;  3LK5 A;  3OAB A;  4E9Z A;  2DH4 A;  4XQR F;  3N1W F;  2E8U A;  3SDQ A;  3LJI A;  1YYU A;  3EZ3 A;  4MC3 A;  3M9U A;  5C05 A;  3LZ9 A;  3LDW A;  4LOB A;  5DJP F;  2QIS A;  1WY0 A;  2E94 A;  3LOM A;  3ZMC A;  4P0V A;  4JXN A;  5DJV F;  3WSA A;  4LFE A;  5ILZ A;  3LMD A;  5ILJ A;  3P8R A;  3ASX A;  4NFI F;  2Q80 A;  4EA1 A;  3DYH A;  3ICK A;  4FP4 A;  3M0G A;  4KQ5 A;  3BNY A;  2Z4V A;  4NFJ F;  5ER8 A;  2ZEV A;  2E4O A;  1YQ7 A;  4JZB A;  3OAB B;  1YHL A;  5IK9 A;  3BNX A;  3RYE A;  2Q58 A;  5HNA A;  2Z4W A;  4LTZ A;  2ZCS A;  5A0K A;  3V1V A;  2PS7 A;  3ACX A;  3RBM A;  3UCA A;  4LLS A;  3N5J F;  2E90 A;  1WL2 A;  4JXY A;  3ACW A;  3ZOU A;  5ILY A;  5AHU B;  4KUX A;  2E8T A;  2ZCO A;  2AET A;  2Z7I A;  5ERM A;  4LZ0 A;  4K10 A;  3KRF B;  1V4J A;  3N5H F;  4KPD A;  3N45 F;  4F6V A;  1JFG A;  3P5R A;  1N22 A;  3SDR A;  3DYF A;  5B00 A;  2OPM A;  1N21 A;  4KQU A;  2Z52 A;  5IMI A;  2E92 A;  5EAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...