5IN8A

Crystal structure of q151h aspergillus terreus aristolochene synthase
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
304
structure length
304
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAHTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Aristolochene synthase
publication title Probing the Role of Active Site Water in the Sesquiterpene Cyclization Reaction Catalyzed by Aristolochene Synthase.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 130
structure length 304
sequence length 304
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2016-03-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5in8A00
2QISA 4LZ0A 4H5DF 4XQTF 4GP1A 3SAEA 1WL1A 3P8RA 1HXCA 3B7LA 3KRFB 4DHDA 4LLTA 1V4KA 3Q2QA 3KRFA 4Q23A 4N1ZF 1YV5A 5IKHA 2RAHA 3P8LA 4F62A 2PS4A 4MC3A 4LLSA 4ZQ8A 1N21A 5IN8A 5EASA 3N1VF 1EZFA 4KWDA 3ICMA 2ZCOA 1YHMA 5B0JA 2ONHA 3ACXA 5B0IA 3ZMBA 3WCJA 5IM1A 1V4IA 4RXEA 3WCIA 5CG5A 2E92A 2ONGA 1UBVA 2H8OA 2Q9ZA 4N9UA 3NF2A 3QQVA 3EGTA 5IMIA 3TFVA 1HXGA 3VJ9A 5IK9A 3NPRA 5IK0A 5AHUB 3M02A 1UBWA 4LZCA 3Q2ZA 2E94A 5IVGA 3LOMA 3WEIA 2PS8A 4KPDA 1YJ4A 1YYQA 4PVYF 1V4HA 4P0WA 2ZY1A 2Z78A 5A0JA 4KQUA 4KKMA 5B0LA 3N49F 5JA0F 3N6KF 3WC9A 1YYRA 2J1OA 4DI5A 4LFEA 4LTZA 4RXAA 4GAXA 2OPNA 3WCDA 3V1VA 3IBAA 4DZWA 3M9UA 1JFAA 4LUUA 3WCBA 5ILZA 4KVIA 4NKEA 4DWBA 1ZW5A 3LGKA 3WE9A 3V1XA 1VG4A 4HD1A 5ILYA 2AZLA 2PS6A 3LZ9A 2J5CA 4JVJF 2FTZA 2O1OA 5IL3A 4KVDA 2ZEVA 3RYEA 2E90A 5IK6A 3WCEA 3LEEA 5B03A 1VG3A 3WCGA 3WEKA 5DJVF 4E1EA 4KVWA 4GA3A 4DXJA 3AQ0A 4LA6A 4E9ZA 4LTVA 4KUXA 2ZCRA 4NFIF 4PVXF 5ERNA 3WCHA 4KFAA 3BNXA 5IMNA 1YYUA 4RNQA 2Q9YA 3P5RA 1V4JA 1YHLA 2E8UA 3APZA 2J1PA 1N24A 4UMJA 2OGDA 4MC0A 4FJQA 3S9VA 3WEJA 3S4JA 3KBKA 4L2XF 2Q58A 3KB9A 3G4DA 1WKZA 2FORA 2Z50A 3QKCA 5EATA 4P0XA 3VJBA 3OYRA 4NFJF 1N1ZA 3TC1A 3KRPB 3TFNA 3WCCA 1YQ7A 3KRPA 4DWGA 1HX9A 3EFQA 4OKMA 5E8HA 5HN7A 3ADZA 4WK5A 3W7FA 2OPMA 2VF6A 1YYSA 2E4OA 5DGSF 1YHKA 5DGMF 3RYWA 5IMPA 1VG7A 1RQIA 5JUZF 3N5JF 3SDRA 4KQ5A 3VJDA 3AQCB 1RTRA 3WJNA 5DHKA 4LPGF 2ZCQA 3N3DA 5B01A 3EZ3A 3Q1OA 2AEKA 4LZ3A 3LGZB 3KRAB 5B02A 4LXWA 3WEHA 3P41A 1WY0A 3KRAA 1N1BA 3PYBA 2F8ZF 3WSAA 5DW7A 3DYFA 4JXNA 1PS1A 2E8TA 4NG6A 4MC8A 4LFGA 4KVYA 5HN8A 3LG5A 1WL3A 5H9DA 5JV1F 3ZMCA 2ZEUA 3SDQA 5A0IA 4KK2A 4RXDA 3ICZA 5CG6A 4DEMF 2F94F 2Z7HA 3MAVA 3WCAA 3ICKA 3MZVA 3ACWA 3WEFA 5ERMA 2E95A 3N0FA 3ZCDA 3M01A 2AETA 4GP2A 2OA6A 1N20A 4JZXA 4LIXA 2P1CA 3NPKA 4JYXA 2Z4ZA 3SDVA 3TS7A 1RQJA 5DZ2A 1YYTA 3OABB 3SDTA 4LPHF 5ILKA 1UBXA 3OABA 3WSBA 5IKAA 4NUAA 3ZL6A 4OGUA 4E9UA 4XQSF 4JXYA 3WCMA 2Q80A 3N1WF 2PS5A 3KRCB 5DJPF 5ER8A 2Z4YA 1HM4A 2F7MF 3ID0A 5EROA 3KRCA 3KROB 4H5CF 4OMGA 3IPIA 4QXSF 3KROA 3CC9A 3WCFA 1HM7A 1VG6A 4H5EF 4QPFA 4EA1A 3PKOA 3N0GA 3ZOUA 3WJKA 4NFKF 2AZKA 4LFVF 2Z4VA 3N46F 2Z4XA 3M00A 5DGNF 4LOBA 5B0KA 2F8CF 3OACB 3WEGA 3Q30A 5IL8A 3N3LF 3LSNA 3VJCA 2I19A 3OACA 3VJ8A 3BNYA 4EA0A 3AE0A 3ASXA 5HN9A 3ACYA 3LMDA 4OMHA 5E8KA 3M0GA 5EAUA 3NRIA 2E8XA 4F6XA 3CKEA 5HNAA 3LK5A 1UBYA 4LA5A 3G4FA 4JZBA 5B00A 1V4EA 1N23A 3WCLA 4F6VA 1DI1A 2E91A 3PH7A 2F92F 1N22A 4OKZA 3LDWA 5ILJA 2E93A 3RBMA 3VJEA 2F89F 5KSXF 1VG2A 2EWGA 5ILDA 4NKFA 4K10A 3LVSA 3DYHA 4P0VA 3SDUA 3TFPA 4FP4A 2E8VA 2AZJA 2Z4WA 5A0KA 2Z7IA 3RMGA 5JV0F 3V66A 1WL0A 5DIQF 1WL2A 4RYPA 1JFGA 2Z52A 5C05A 5AFXA 1FPSA 3P5PA 1WMWA 4RXCA 5ILHA 5DHIA 3AQBB 1KIYA 3PYAA 2PS7A 3LLWA 4EA2A 3CP6A 2F9KF 5AELA 3LJIA 5B0MA 2ZCSA 2E8WA 5I1UA 1HXAA 5DJRF 4KQSA 4KPJA 2DH4A 3UCAA 3ICNA 3N45F 5E8LA 3DYGA 5AYPA 3VJAA 4XQRF 1KIZA 2AELA 5ILIA 3N5HF 1DGPA 3PDEA 3WJOA 5JV2F
chains in the Genus database with same CATH superfamily
2QISA 4LZ0A 4H5DF 4XQTF 4GP1A 3SAEA 1WL1A 3P8RA 1HXCA 3B7LA 3KRFB 4DHDA 4LLTA 1V4KA 3Q2QA 3KRFA 4Q23A 4N1ZF 1YV5A 5IKHA 2RAHA 3P8LA 4F62A 2PS4A 4MC3A 4LLSA 4ZQ8A 1N21A 5IN8A 5EASA 3N1VF 1EZFA 4KWDA 3ICMA 2ZCOA 1YHMA 5B0JA 2ONHA 3ACXA 5B0IA 3ZMBA 3WCJA 5IM1A 1V4IA 4RXEA 3WCIA 5CG5A 2E92A 2ONGA 1UBVA 2H8OA 2Q9ZA 4N9UA 3NF2A 3QQVA 3EGTA 5IMIA 3TFVA 1HXGA 3VJ9A 5IK9A 3NPRA 5IK0A 5AHUB 3M02A 1UBWA 4LZCA 3Q2ZA 2E94A 5IVGA 3LOMA 3WEIA 2PS8A 4KPDA 1YJ4A 1YYQA 4PVYF 1V4HA 4P0WA 2ZY1A 2Z78A 5A0JA 4KQUA 4KKMA 5B0LA 3N49F 5JA0F 3N6KF 3WC9A 1YYRA 2J1OA 4DI5A 4LFEA 4LTZA 4RXAA 4GAXA 2OPNA 3WCDA 3V1VA 3IBAA 4DZWA 3M9UA 1JFAA 4LUUA 3WCBA 5ILZA 4KVIA 4NKEA 4DWBA 1ZW5A 3LGKA 3WE9A 3V1XA 1VG4A 4HD1A 5ILYA 2AZLA 2PS6A 3LZ9A 2J5CA 4JVJF 2FTZA 2O1OA 5IL3A 4KVDA 2ZEVA 3RYEA 2E90A 5IK6A 3WCEA 3LEEA 5B03A 1VG3A 3WCGA 3WEKA 5DJVF 4E1EA 4KVWA 4GA3A 4DXJA 3AQ0A 4LA6A 4E9ZA 4LTVA 4KUXA 2ZCRA 4NFIF 4PVXF 5ERNA 3WCHA 4KFAA 3BNXA 5IMNA 1YYUA 4RNQA 2Q9YA 3P5RA 1V4JA 1YHLA 2E8UA 3APZA 2J1PA 1N24A 4UMJA 2OGDA 4MC0A 4FJQA 3S9VA 3WEJA 3S4JA 3KBKA 4L2XF 2Q58A 3KB9A 3G4DA 1WKZA 2FORA 2Z50A 3QKCA 5EATA 4P0XA 3VJBA 3OYRA 4NFJF 1N1ZA 3TC1A 3KRPB 3TFNA 3WCCA 1YQ7A 3KRPA 4DWGA 1HX9A 3EFQA 4OKMA 5E8HA 5HN7A 3ADZA 4WK5A 3W7FA 2OPMA 2VF6A 1YYSA 2E4OA 5DGSF 1YHKA 5DGMF 3RYWA 5IMPA 1VG7A 1RQIA 5JUZF 3N5JF 3SDRA 4KQ5A 3VJDA 3AQCB 1RTRA 3WJNA 5DHKA 4LPGF 2ZCQA 3N3DA 5B01A 3EZ3A 3Q1OA 2AEKA 4LZ3A 3LGZB 3KRAB 5B02A 4LXWA 3WEHA 3P41A 1WY0A 3KRAA 1N1BA 3PYBA 2F8ZF 3WSAA 5DW7A 3DYFA 4JXNA 1PS1A 2E8TA 4NG6A 4MC8A 4LFGA 4KVYA 5HN8A 3LG5A 1WL3A 5H9DA 5JV1F 3ZMCA 2ZEUA 3SDQA 5A0IA 4KK2A 4RXDA 3ICZA 5CG6A 4DEMF 2F94F 2Z7HA 3MAVA 3WCAA 3ICKA 3MZVA 3ACWA 3WEFA 5ERMA 2E95A 3N0FA 3ZCDA 3M01A 2AETA 4GP2A 2OA6A 1N20A 4JZXA 4LIXA 2P1CA 3NPKA 4JYXA 2Z4ZA 3SDVA 3TS7A 1RQJA 5DZ2A 1YYTA 3OABB 3SDTA 4LPHF 5ILKA 1UBXA 3OABA 3WSBA 5IKAA 4NUAA 3ZL6A 4OGUA 4E9UA 4XQSF 4JXYA 3WCMA 2Q80A 3N1WF 2PS5A 3KRCB 5DJPF 5ER8A 2Z4YA 1HM4A 2F7MF 3ID0A 5EROA 3KRCA 3KROB 4H5CF 4OMGA 3IPIA 4QXSF 3KROA 3CC9A 3WCFA 1HM7A 1VG6A 4H5EF 4QPFA 4EA1A 3PKOA 3N0GA 3ZOUA 3WJKA 4NFKF 2AZKA 4LFVF 2Z4VA 3N46F 2Z4XA 3M00A 5DGNF 4LOBA 5B0KA 2F8CF 3OACB 3WEGA 3Q30A 5IL8A 3N3LF 3LSNA 3VJCA 2I19A 3OACA 3VJ8A 3BNYA 4EA0A 3AE0A 3ASXA 5HN9A 3ACYA 3LMDA 4OMHA 5E8KA 3M0GA 5EAUA 3NRIA 2E8XA 4F6XA 3CKEA 5HNAA 3LK5A 1UBYA 4LA5A 3G4FA 4JZBA 5B00A 1V4EA 1N23A 3WCLA 4F6VA 1DI1A 2E91A 3PH7A 2F92F 1N22A 4OKZA 3LDWA 5ILJA 2E93A 3RBMA 3VJEA 2F89F 5KSXF 1VG2A 2EWGA 5ILDA 4NKFA 4K10A 3LVSA 3DYHA 4P0VA 3SDUA 3TFPA 4FP4A 2E8VA 2AZJA 2Z4WA 5A0KA 2Z7IA 3RMGA 5JV0F 3V66A 1WL0A 5DIQF 1WL2A 4RYPA 1JFGA 2Z52A 5C05A 5AFXA 1FPSA 3P5PA 1WMWA 4RXCA 5ILHA 5DHIA 3AQBB 1KIYA 3PYAA 2PS7A 3LLWA 4EA2A 3CP6A 2F9KF 5AELA 3LJIA 5B0MA 2ZCSA 2E8WA 5I1UA 1HXAA 5DJRF 4KQSA 4KPJA 2DH4A 3UCAA 3ICNA 3N45F 5E8LA 3DYGA 5AYPA 3VJAA 4XQRF 1KIZA 2AELA 5ILIA 3N5HF 1DGPA 3PDEA 3WJOA 5JV2F
chains in the Genus database with same CATH topology
2QISA 4LZ0A 4H5DF 4XQTF 4GP1A 3SAEA 1WL1A 3P8RA 1HXCA 3B7LA 3KRFB 4DHDA 4LLTA 1V4KA 3Q2QA 3KRFA 4Q23A 4N1ZF 1YV5A 5IKHA 2RAHA 3P8LA 4F62A 2PS4A 4MC3A 4LLSA 4ZQ8A 1N21A 5IN8A 5EASA 3N1VF 1EZFA 4KWDA 3ICMA 2ZCOA 1YHMA 5B0JA 2ONHA 3ACXA 5B0IA 3ZMBA 3WCJA 5IM1A 1V4IA 4RXEA 3WCIA 5CG5A 2E92A 2ONGA 1UBVA 2H8OA 2Q9ZA 4N9UA 3NF2A 3QQVA 3EGTA 5IMIA 3TFVA 1HXGA 3VJ9A 5IK9A 3NPRA 5IK0A 5AHUB 3M02A 1UBWA 4LZCA 3Q2ZA 2E94A 5IVGA 3LOMA 3WEIA 2PS8A 4KPDA 1YJ4A 1YYQA 4PVYF 1V4HA 4P0WA 2ZY1A 2Z78A 5A0JA 4KQUA 4KKMA 5B0LA 3N49F 5JA0F 3N6KF 3WC9A 1YYRA 2J1OA 4DI5A 4LFEA 4LTZA 4RXAA 4GAXA 2OPNA 3WCDA 3V1VA 3IBAA 4DZWA 3M9UA 1JFAA 4LUUA 3WCBA 5ILZA 4KVIA 4NKEA 4DWBA 1ZW5A 3LGKA 3WE9A 3V1XA 1VG4A 4HD1A 5ILYA 2AZLA 2PS6A 3LZ9A 2J5CA 4JVJF 2FTZA 2O1OA 5IL3A 4KVDA 2ZEVA 3RYEA 2E90A 5IK6A 3WCEA 3LEEA 5B03A 1VG3A 3WCGA 3WEKA 5DJVF 4E1EA 4KVWA 4GA3A 4DXJA 3AQ0A 4LA6A 4E9ZA 4LTVA 4KUXA 2ZCRA 4NFIF 4PVXF 5ERNA 3WCHA 4KFAA 3BNXA 5IMNA 1YYUA 4RNQA 2Q9YA 3P5RA 1V4JA 1YHLA 2E8UA 3APZA 2J1PA 1N24A 4UMJA 2OGDA 4MC0A 4FJQA 3S9VA 3WEJA 3S4JA 3KBKA 4L2XF 2Q58A 3KB9A 3G4DA 1WKZA 2FORA 2Z50A 3QKCA 5EATA 4P0XA 3VJBA 3OYRA 4NFJF 1N1ZA 3TC1A 3KRPB 3TFNA 3WCCA 1YQ7A 3KRPA 4DWGA 1HX9A 3EFQA 4OKMA 5E8HA 5HN7A 3ADZA 4WK5A 3W7FA 2OPMA 2VF6A 1YYSA 2E4OA 5DGSF 1YHKA 5DGMF 3RYWA 5IMPA 1VG7A 1RQIA 5JUZF 3N5JF 3SDRA 4KQ5A 3VJDA 3AQCB 1RTRA 3WJNA 5DHKA 4LPGF 2ZCQA 3N3DA 5B01A 3EZ3A 3Q1OA 2AEKA 4LZ3A 3LGZB 3KRAB 5B02A 4LXWA 3WEHA 3P41A 1WY0A 3KRAA 1N1BA 3PYBA 2F8ZF 3WSAA 5DW7A 3DYFA 4JXNA 1PS1A 2E8TA 4NG6A 4MC8A 4LFGA 4KVYA 5HN8A 3LG5A 1WL3A 5H9DA 5JV1F 3ZMCA 2ZEUA 3SDQA 5A0IA 4KK2A 4RXDA 3ICZA 5CG6A 4DEMF 2F94F 2Z7HA 3MAVA 3WCAA 3ICKA 3MZVA 3ACWA 3WEFA 5ERMA 2E95A 3N0FA 3ZCDA 3M01A 2AETA 4GP2A 2OA6A 1N20A 4JZXA 4LIXA 2P1CA 3NPKA 4JYXA 2Z4ZA 3SDVA 3TS7A 1RQJA 5DZ2A 1YYTA 3OABB 3SDTA 4LPHF 5ILKA 1UBXA 3OABA 3WSBA 5IKAA 4NUAA 3ZL6A 4OGUA 4E9UA 4XQSF 4JXYA 3WCMA 2Q80A 3N1WF 2PS5A 3KRCB 5DJPF 5ER8A 2Z4YA 1HM4A 2F7MF 3ID0A 5EROA 3KRCA 3KROB 4H5CF 4OMGA 3IPIA 4QXSF 3KROA 3CC9A 3WCFA 1HM7A 1VG6A 4H5EF 4QPFA 4EA1A 3PKOA 3N0GA 3ZOUA 3WJKA 4NFKF 2AZKA 4LFVF 2Z4VA 3N46F 2Z4XA 3M00A 5DGNF 4LOBA 5B0KA 2F8CF 3OACB 3WEGA 3Q30A 5IL8A 3N3LF 3LSNA 3VJCA 2I19A 3OACA 3VJ8A 3BNYA 4EA0A 3AE0A 3ASXA 5HN9A 3ACYA 3LMDA 4OMHA 5E8KA 3M0GA 5EAUA 3NRIA 2E8XA 4F6XA 3CKEA 5HNAA 3LK5A 1UBYA 4LA5A 3G4FA 4JZBA 5B00A 1V4EA 1N23A 3WCLA 4F6VA 1DI1A 2E91A 3PH7A 2F92F 1N22A 4OKZA 3LDWA 5ILJA 2E93A 3RBMA 3VJEA 2F89F 5KSXF 1VG2A 2EWGA 5ILDA 4NKFA 4K10A 3LVSA 3DYHA 4P0VA 3SDUA 3TFPA 4FP4A 2E8VA 2AZJA 2Z4WA 5A0KA 2Z7IA 3RMGA 5JV0F 3V66A 1WL0A 5DIQF 1WL2A 4RYPA 1JFGA 2Z52A 5C05A 5AFXA 1FPSA 3P5PA 1WMWA 4RXCA 5ILHA 5DHIA 3AQBB 1KIYA 3PYAA 2PS7A 3LLWA 4EA2A 3CP6A 2F9KF 5AELA 3LJIA 5B0MA 2ZCSA 2E8WA 5I1UA 1HXAA 5DJRF 4KQSA 4KPJA 2DH4A 3UCAA 3ICNA 3N45F 5E8LA 3DYGA 5AYPA 3VJAA 4XQRF 1KIZA 2AELA 5ILIA 3N5HF 1DGPA 3PDEA 3WJOA 5JV2F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIS A;  4LZ0 A;  4H5D F;  4XQT F;  4GP1 A;  3SAE A;  1WL1 A;  3P8R A;  1HXC A;  3B7L A;  3KRF B;  4DHD A;  4LLT A;  1V4K A;  3Q2Q A;  3KRF A;  4Q23 A;  4N1Z F;  1YV5 A;  5IKH A;  2RAH A;  3P8L A;  4F62 A;  2PS4 A;  4MC3 A;  4LLS A;  4ZQ8 A;  1N21 A;  5IN8 A;  5EAS A;  3N1V F;  1EZF A;  4KWD A;  3ICM A;  2ZCO A;  1YHM A;  5B0J A;  2ONH A;  3ACX A;  5B0I A;  3ZMB A;  3WCJ A;  5IM1 A;  1V4I A;  4RXE A;  3WCI A;  5CG5 A;  2E92 A;  2ONG A;  1UBV A;  2H8O A;  2Q9Z A;  4N9U A;  3NF2 A;  3QQV A;  3EGT A;  5IMI A;  3TFV A;  1HXG A;  3VJ9 A;  5IK9 A;  3NPR A;  5IK0 A;  5AHU B;  3M02 A;  1UBW A;  4LZC A;  3Q2Z A;  2E94 A;  5IVG A;  3LOM A;  3WEI A;  2PS8 A;  4KPD A;  1YJ4 A;  1YYQ A;  4PVY F;  1V4H A;  4P0W A;  2ZY1 A;  2Z78 A;  5A0J A;  4KQU A;  4KKM A;  5B0L A;  3N49 F;  5JA0 F;  3N6K F;  3WC9 A;  1YYR A;  2J1O A;  4DI5 A;  4LFE A;  4LTZ A;  4RXA A;  4GAX A;  2OPN A;  3WCD A;  3V1V A;  3IBA A;  4DZW A;  3M9U A;  1JFA A;  4LUU A;  3WCB A;  5ILZ A;  4KVI A;  4NKE A;  4DWB A;  1ZW5 A;  3LGK A;  3WE9 A;  3V1X A;  1VG4 A;  4HD1 A;  5ILY A;  2AZL A;  2PS6 A;  3LZ9 A;  2J5C A;  4JVJ F;  2FTZ A;  2O1O A;  5IL3 A;  4KVD A;  2ZEV A;  3RYE A;  2E90 A;  5IK6 A;  3WCE A;  3LEE A;  5B03 A;  1VG3 A;  3WCG A;  3WEK A;  5DJV F;  4E1E A;  4KVW A;  4GA3 A;  4DXJ A;  3AQ0 A;  4LA6 A;  4E9Z A;  4LTV A;  4KUX A;  2ZCR A;  4NFI F;  4PVX F;  5ERN A;  3WCH A;  4KFA A;  3BNX A;  5IMN A;  1YYU A;  4RNQ A;  2Q9Y A;  3P5R A;  1V4J A;  1YHL A;  2E8U A;  3APZ A;  2J1P A;  1N24 A;  4UMJ A;  2OGD A;  4MC0 A;  4FJQ A;  3S9V A;  3WEJ A;  3S4J A;  3KBK A;  4L2X F;  2Q58 A;  3KB9 A;  3G4D A;  1WKZ A;  2FOR A;  2Z50 A;  3QKC A;  5EAT A;  4P0X A;  3VJB A;  3OYR A;  4NFJ F;  1N1Z A;  3TC1 A;  3KRP B;  3TFN A;  3WCC A;  1YQ7 A;  3KRP A;  4DWG A;  1HX9 A;  3EFQ A;  4OKM A;  5E8H A;  5HN7 A;  3ADZ A;  4WK5 A;  3W7F A;  2OPM A;  2VF6 A;  1YYS A;  2E4O A;  5DGS F;  1YHK A;  5DGM F;  3RYW A;  5IMP A;  1VG7 A;  1RQI A;  5JUZ F;  3N5J F;  3SDR A;  4KQ5 A;  3VJD A;  3AQC B;  1RTR A;  3WJN A;  5DHK A;  4LPG F;  2ZCQ A;  3N3D A;  5B01 A;  3EZ3 A;  3Q1O A;  2AEK A;  4LZ3 A;  3LGZ B;  3KRA B;  5B02 A;  4LXW A;  3WEH A;  3P41 A;  1WY0 A;  3KRA A;  1N1B A;  3PYB A;  2F8Z F;  3WSA A;  5DW7 A;  3DYF A;  4JXN A;  1PS1 A;  2E8T A;  4NG6 A;  4MC8 A;  4LFG A;  4KVY A;  5HN8 A;  3LG5 A;  1WL3 A;  5H9D A;  5JV1 F;  3ZMC A;  2ZEU A;  3SDQ A;  5A0I A;  4KK2 A;  4RXD A;  3ICZ A;  5CG6 A;  4DEM F;  2F94 F;  2Z7H A;  3MAV A;  3WCA A;  3ICK A;  3MZV A;  3ACW A;  3WEF A;  5ERM A;  2E95 A;  3N0F A;  3ZCD A;  3M01 A;  2AET A;  4GP2 A;  2OA6 A;  1N20 A;  4JZX A;  4LIX A;  2P1C A;  3NPK A;  4JYX A;  2Z4Z A;  3SDV A;  3TS7 A;  1RQJ A;  5DZ2 A;  1YYT A;  3OAB B;  3SDT A;  4LPH F;  5ILK A;  1UBX A;  3OAB A;  3WSB A;  5IKA A;  4NUA A;  3ZL6 A;  4OGU A;  4E9U A;  4XQS F;  4JXY A;  3WCM A;  2Q80 A;  3N1W F;  2PS5 A;  3KRC B;  5DJP F;  5ER8 A;  2Z4Y A;  1HM4 A;  2F7M F;  3ID0 A;  5ERO A;  3KRC A;  3KRO B;  4H5C F;  4OMG A;  3IPI A;  4QXS F;  3KRO A;  3CC9 A;  3WCF A;  1HM7 A;  1VG6 A;  4H5E F;  4QPF A;  4EA1 A;  3PKO A;  3N0G A;  3ZOU A;  3WJK A;  4NFK F;  2AZK A;  4LFV F;  2Z4V A;  3N46 F;  2Z4X A;  3M00 A;  5DGN F;  4LOB A;  5B0K A;  2F8C F;  3OAC B;  3WEG A;  3Q30 A;  5IL8 A;  3N3L F;  3LSN A;  3VJC A;  2I19 A;  3OAC A;  3VJ8 A;  3BNY A;  4EA0 A;  3AE0 A;  3ASX A;  5HN9 A;  3ACY A;  3LMD A;  4OMH A;  5E8K A;  3M0G A;  5EAU A;  3NRI A;  2E8X A;  4F6X A;  3CKE A;  5HNA A;  3LK5 A;  1UBY A;  4LA5 A;  3G4F A;  4JZB A;  5B00 A;  1V4E A;  1N23 A;  3WCL A;  4F6V A;  1DI1 A;  2E91 A;  3PH7 A;  2F92 F;  1N22 A;  4OKZ A;  3LDW A;  5ILJ A;  2E93 A;  3RBM A;  3VJE A;  2F89 F;  5KSX F;  1VG2 A;  2EWG A;  5ILD A;  4NKF A;  4K10 A;  3LVS A;  3DYH A;  4P0V A;  3SDU A;  3TFP A;  4FP4 A;  2E8V A;  2AZJ A;  2Z4W A;  5A0K A;  2Z7I A;  3RMG A;  5JV0 F;  3V66 A;  1WL0 A;  5DIQ F;  1WL2 A;  4RYP A;  1JFG A;  2Z52 A;  5C05 A;  5AFX A;  1FPS A;  3P5P A;  1WMW A;  4RXC A;  5ILH A;  5DHI A;  3AQB B;  1KIY A;  3PYA A;  2PS7 A;  3LLW A;  4EA2 A;  3CP6 A;  2F9K F;  5AEL A;  3LJI A;  5B0M A;  2ZCS A;  2E8W A;  5I1U A;  1HXA A;  5DJR F;  4KQS A;  4KPJ A;  2DH4 A;  3UCA A;  3ICN A;  3N45 F;  5E8L A;  3DYG A;  5AYP A;  3VJA A;  4XQR F;  1KIZ A;  2AEL A;  5ILI A;  3N5H F;  1DGP A;  3PDE A;  3WJO A;  5JV2 F; 
#chains in the Genus database with same CATH topology
 2QIS A;  4LZ0 A;  4H5D F;  4XQT F;  4GP1 A;  3SAE A;  1WL1 A;  3P8R A;  1HXC A;  3B7L A;  3KRF B;  4DHD A;  4LLT A;  1V4K A;  3Q2Q A;  3KRF A;  4Q23 A;  4N1Z F;  1YV5 A;  5IKH A;  2RAH A;  3P8L A;  4F62 A;  2PS4 A;  4MC3 A;  4LLS A;  4ZQ8 A;  1N21 A;  5IN8 A;  5EAS A;  3N1V F;  1EZF A;  4KWD A;  3ICM A;  2ZCO A;  1YHM A;  5B0J A;  2ONH A;  3ACX A;  5B0I A;  3ZMB A;  3WCJ A;  5IM1 A;  1V4I A;  4RXE A;  3WCI A;  5CG5 A;  2E92 A;  2ONG A;  1UBV A;  2H8O A;  2Q9Z A;  4N9U A;  3NF2 A;  3QQV A;  3EGT A;  5IMI A;  3TFV A;  1HXG A;  3VJ9 A;  5IK9 A;  3NPR A;  5IK0 A;  5AHU B;  3M02 A;  1UBW A;  4LZC A;  3Q2Z A;  2E94 A;  5IVG A;  3LOM A;  3WEI A;  2PS8 A;  4KPD A;  1YJ4 A;  1YYQ A;  4PVY F;  1V4H A;  4P0W A;  2ZY1 A;  2Z78 A;  5A0J A;  4KQU A;  4KKM A;  5B0L A;  3N49 F;  5JA0 F;  3N6K F;  3WC9 A;  1YYR A;  2J1O A;  4DI5 A;  4LFE A;  4LTZ A;  4RXA A;  4GAX A;  2OPN A;  3WCD A;  3V1V A;  3IBA A;  4DZW A;  3M9U A;  1JFA A;  4LUU A;  3WCB A;  5ILZ A;  4KVI A;  4NKE A;  4DWB A;  1ZW5 A;  3LGK A;  3WE9 A;  3V1X A;  1VG4 A;  4HD1 A;  5ILY A;  2AZL A;  2PS6 A;  3LZ9 A;  2J5C A;  4JVJ F;  2FTZ A;  2O1O A;  5IL3 A;  4KVD A;  2ZEV A;  3RYE A;  2E90 A;  5IK6 A;  3WCE A;  3LEE A;  5B03 A;  1VG3 A;  3WCG A;  3WEK A;  5DJV F;  4E1E A;  4KVW A;  4GA3 A;  4DXJ A;  3AQ0 A;  4LA6 A;  4E9Z A;  4LTV A;  4KUX A;  2ZCR A;  4NFI F;  4PVX F;  5ERN A;  3WCH A;  4KFA A;  3BNX A;  5IMN A;  1YYU A;  4RNQ A;  2Q9Y A;  3P5R A;  1V4J A;  1YHL A;  2E8U A;  3APZ A;  2J1P A;  1N24 A;  4UMJ A;  2OGD A;  4MC0 A;  4FJQ A;  3S9V A;  3WEJ A;  3S4J A;  3KBK A;  4L2X F;  2Q58 A;  3KB9 A;  3G4D A;  1WKZ A;  2FOR A;  2Z50 A;  3QKC A;  5EAT A;  4P0X A;  3VJB A;  3OYR A;  4NFJ F;  1N1Z A;  3TC1 A;  3KRP B;  3TFN A;  3WCC A;  1YQ7 A;  3KRP A;  4DWG A;  1HX9 A;  3EFQ A;  4OKM A;  5E8H A;  5HN7 A;  3ADZ A;  4WK5 A;  3W7F A;  2OPM A;  2VF6 A;  1YYS A;  2E4O A;  5DGS F;  1YHK A;  5DGM F;  3RYW A;  5IMP A;  1VG7 A;  1RQI A;  5JUZ F;  3N5J F;  3SDR A;  4KQ5 A;  3VJD A;  3AQC B;  1RTR A;  3WJN A;  5DHK A;  4LPG F;  2ZCQ A;  3N3D A;  5B01 A;  3EZ3 A;  3Q1O A;  2AEK A;  4LZ3 A;  3LGZ B;  3KRA B;  5B02 A;  4LXW A;  3WEH A;  3P41 A;  1WY0 A;  3KRA A;  1N1B A;  3PYB A;  2F8Z F;  3WSA A;  5DW7 A;  3DYF A;  4JXN A;  1PS1 A;  2E8T A;  4NG6 A;  4MC8 A;  4LFG A;  4KVY A;  5HN8 A;  3LG5 A;  1WL3 A;  5H9D A;  5JV1 F;  3ZMC A;  2ZEU A;  3SDQ A;  5A0I A;  4KK2 A;  4RXD A;  3ICZ A;  5CG6 A;  4DEM F;  2F94 F;  2Z7H A;  3MAV A;  3WCA A;  3ICK A;  3MZV A;  3ACW A;  3WEF A;  5ERM A;  2E95 A;  3N0F A;  3ZCD A;  3M01 A;  2AET A;  4GP2 A;  2OA6 A;  1N20 A;  4JZX A;  4LIX A;  2P1C A;  3NPK A;  4JYX A;  2Z4Z A;  3SDV A;  3TS7 A;  1RQJ A;  5DZ2 A;  1YYT A;  3OAB B;  3SDT A;  4LPH F;  5ILK A;  1UBX A;  3OAB A;  3WSB A;  5IKA A;  4NUA A;  3ZL6 A;  4OGU A;  4E9U A;  4XQS F;  4JXY A;  3WCM A;  2Q80 A;  3N1W F;  2PS5 A;  3KRC B;  5DJP F;  5ER8 A;  2Z4Y A;  1HM4 A;  2F7M F;  3ID0 A;  5ERO A;  3KRC A;  3KRO B;  4H5C F;  4OMG A;  3IPI A;  4QXS F;  3KRO A;  3CC9 A;  3WCF A;  1HM7 A;  1VG6 A;  4H5E F;  4QPF A;  4EA1 A;  3PKO A;  3N0G A;  3ZOU A;  3WJK A;  4NFK F;  2AZK A;  4LFV F;  2Z4V A;  3N46 F;  2Z4X A;  3M00 A;  5DGN F;  4LOB A;  5B0K A;  2F8C F;  3OAC B;  3WEG A;  3Q30 A;  5IL8 A;  3N3L F;  3LSN A;  3VJC A;  2I19 A;  3OAC A;  3VJ8 A;  3BNY A;  4EA0 A;  3AE0 A;  3ASX A;  5HN9 A;  3ACY A;  3LMD A;  4OMH A;  5E8K A;  3M0G A;  5EAU A;  3NRI A;  2E8X A;  4F6X A;  3CKE A;  5HNA A;  3LK5 A;  1UBY A;  4LA5 A;  3G4F A;  4JZB A;  5B00 A;  1V4E A;  1N23 A;  3WCL A;  4F6V A;  1DI1 A;  2E91 A;  3PH7 A;  2F92 F;  1N22 A;  4OKZ A;  3LDW A;  5ILJ A;  2E93 A;  3RBM A;  3VJE A;  2F89 F;  5KSX F;  1VG2 A;  2EWG A;  5ILD A;  4NKF A;  4K10 A;  3LVS A;  3DYH A;  4P0V A;  3SDU A;  3TFP A;  4FP4 A;  2E8V A;  2AZJ A;  2Z4W A;  5A0K A;  2Z7I A;  3RMG A;  5JV0 F;  3V66 A;  1WL0 A;  5DIQ F;  1WL2 A;  4RYP A;  1JFG A;  2Z52 A;  5C05 A;  5AFX A;  1FPS A;  3P5P A;  1WMW A;  4RXC A;  5ILH A;  5DHI A;  3AQB B;  1KIY A;  3PYA A;  2PS7 A;  3LLW A;  4EA2 A;  3CP6 A;  2F9K F;  5AEL A;  3LJI A;  5B0M A;  2ZCS A;  2E8W A;  5I1U A;  1HXA A;  5DJR F;  4KQS A;  4KPJ A;  2DH4 A;  3UCA A;  3ICN A;  3N45 F;  5E8L A;  3DYG A;  5AYP A;  3VJA A;  4XQR F;  1KIZ A;  2AEL A;  5ILI A;  3N5H F;  1DGP A;  3PDE A;  3WJO A;  5JV2 F; 
#chains in the Genus database with same CATH homology
 2QIS A;  4LZ0 A;  4H5D F;  4XQT F;  4GP1 A;  3SAE A;  1WL1 A;  3P8R A;  1HXC A;  3B7L A;  3KRF B;  4DHD A;  4LLT A;  1V4K A;  3Q2Q A;  3KRF A;  4Q23 A;  4N1Z F;  1YV5 A;  5IKH A;  2RAH A;  3P8L A;  4F62 A;  2PS4 A;  4MC3 A;  4LLS A;  4ZQ8 A;  1N21 A;  5IN8 A;  5EAS A;  3N1V F;  1EZF A;  4KWD A;  3ICM A;  2ZCO A;  1YHM A;  5B0J A;  2ONH A;  3ACX A;  5B0I A;  3ZMB A;  3WCJ A;  5IM1 A;  1V4I A;  4RXE A;  3WCI A;  5CG5 A;  2E92 A;  2ONG A;  1UBV A;  2H8O A;  2Q9Z A;  4N9U A;  3NF2 A;  3QQV A;  3EGT A;  5IMI A;  3TFV A;  1HXG A;  3VJ9 A;  5IK9 A;  3NPR A;  5IK0 A;  5AHU B;  3M02 A;  1UBW A;  4LZC A;  3Q2Z A;  2E94 A;  5IVG A;  3LOM A;  3WEI A;  2PS8 A;  4KPD A;  1YJ4 A;  1YYQ A;  4PVY F;  1V4H A;  4P0W A;  2ZY1 A;  2Z78 A;  5A0J A;  4KQU A;  4KKM A;  5B0L A;  3N49 F;  5JA0 F;  3N6K F;  3WC9 A;  1YYR A;  2J1O A;  4DI5 A;  4LFE A;  4LTZ A;  4RXA A;  4GAX A;  2OPN A;  3WCD A;  3V1V A;  3IBA A;  4DZW A;  3M9U A;  1JFA A;  4LUU A;  3WCB A;  5ILZ A;  4KVI A;  4NKE A;  4DWB A;  1ZW5 A;  3LGK A;  3WE9 A;  3V1X A;  1VG4 A;  4HD1 A;  5ILY A;  2AZL A;  2PS6 A;  3LZ9 A;  2J5C A;  4JVJ F;  2FTZ A;  2O1O A;  5IL3 A;  4KVD A;  2ZEV A;  3RYE A;  2E90 A;  5IK6 A;  3WCE A;  3LEE A;  5B03 A;  1VG3 A;  3WCG A;  3WEK A;  5DJV F;  4E1E A;  4KVW A;  4GA3 A;  4DXJ A;  3AQ0 A;  4LA6 A;  4E9Z A;  4LTV A;  4KUX A;  2ZCR A;  4NFI F;  4PVX F;  5ERN A;  3WCH A;  4KFA A;  3BNX A;  5IMN A;  1YYU A;  4RNQ A;  2Q9Y A;  3P5R A;  1V4J A;  1YHL A;  2E8U A;  3APZ A;  2J1P A;  1N24 A;  4UMJ A;  2OGD A;  4MC0 A;  4FJQ A;  3S9V A;  3WEJ A;  3S4J A;  3KBK A;  4L2X F;  2Q58 A;  3KB9 A;  3G4D A;  1WKZ A;  2FOR A;  2Z50 A;  3QKC A;  5EAT A;  4P0X A;  3VJB A;  3OYR A;  4NFJ F;  1N1Z A;  3TC1 A;  3KRP B;  3TFN A;  3WCC A;  1YQ7 A;  3KRP A;  4DWG A;  1HX9 A;  3EFQ A;  4OKM A;  5E8H A;  5HN7 A;  3ADZ A;  4WK5 A;  3W7F A;  2OPM A;  2VF6 A;  1YYS A;  2E4O A;  5DGS F;  1YHK A;  5DGM F;  3RYW A;  5IMP A;  1VG7 A;  1RQI A;  5JUZ F;  3N5J F;  3SDR A;  4KQ5 A;  3VJD A;  3AQC B;  1RTR A;  3WJN A;  5DHK A;  4LPG F;  2ZCQ A;  3N3D A;  5B01 A;  3EZ3 A;  3Q1O A;  2AEK A;  4LZ3 A;  3LGZ B;  3KRA B;  5B02 A;  4LXW A;  3WEH A;  3P41 A;  1WY0 A;  3KRA A;  1N1B A;  3PYB A;  2F8Z F;  3WSA A;  5DW7 A;  3DYF A;  4JXN A;  1PS1 A;  2E8T A;  4NG6 A;  4MC8 A;  4LFG A;  4KVY A;  5HN8 A;  3LG5 A;  1WL3 A;  5H9D A;  5JV1 F;  3ZMC A;  2ZEU A;  3SDQ A;  5A0I A;  4KK2 A;  4RXD A;  3ICZ A;  5CG6 A;  4DEM F;  2F94 F;  2Z7H A;  3MAV A;  3WCA A;  3ICK A;  3MZV A;  3ACW A;  3WEF A;  5ERM A;  2E95 A;  3N0F A;  3ZCD A;  3M01 A;  2AET A;  4GP2 A;  2OA6 A;  1N20 A;  4JZX A;  4LIX A;  2P1C A;  3NPK A;  4JYX A;  2Z4Z A;  3SDV A;  3TS7 A;  1RQJ A;  5DZ2 A;  1YYT A;  3OAB B;  3SDT A;  4LPH F;  5ILK A;  1UBX A;  3OAB A;  3WSB A;  5IKA A;  4NUA A;  3ZL6 A;  4OGU A;  4E9U A;  4XQS F;  4JXY A;  3WCM A;  2Q80 A;  3N1W F;  2PS5 A;  3KRC B;  5DJP F;  5ER8 A;  2Z4Y A;  1HM4 A;  2F7M F;  3ID0 A;  5ERO A;  3KRC A;  3KRO B;  4H5C F;  4OMG A;  3IPI A;  4QXS F;  3KRO A;  3CC9 A;  3WCF A;  1HM7 A;  1VG6 A;  4H5E F;  4QPF A;  4EA1 A;  3PKO A;  3N0G A;  3ZOU A;  3WJK A;  4NFK F;  2AZK A;  4LFV F;  2Z4V A;  3N46 F;  2Z4X A;  3M00 A;  5DGN F;  4LOB A;  5B0K A;  2F8C F;  3OAC B;  3WEG A;  3Q30 A;  5IL8 A;  3N3L F;  3LSN A;  3VJC A;  2I19 A;  3OAC A;  3VJ8 A;  3BNY A;  4EA0 A;  3AE0 A;  3ASX A;  5HN9 A;  3ACY A;  3LMD A;  4OMH A;  5E8K A;  3M0G A;  5EAU A;  3NRI A;  2E8X A;  4F6X A;  3CKE A;  5HNA A;  3LK5 A;  1UBY A;  4LA5 A;  3G4F A;  4JZB A;  5B00 A;  1V4E A;  1N23 A;  3WCL A;  4F6V A;  1DI1 A;  2E91 A;  3PH7 A;  2F92 F;  1N22 A;  4OKZ A;  3LDW A;  5ILJ A;  2E93 A;  3RBM A;  3VJE A;  2F89 F;  5KSX F;  1VG2 A;  2EWG A;  5ILD A;  4NKF A;  4K10 A;  3LVS A;  3DYH A;  4P0V A;  3SDU A;  3TFP A;  4FP4 A;  2E8V A;  2AZJ A;  2Z4W A;  5A0K A;  2Z7I A;  3RMG A;  5JV0 F;  3V66 A;  1WL0 A;  5DIQ F;  1WL2 A;  4RYP A;  1JFG A;  2Z52 A;  5C05 A;  5AFX A;  1FPS A;  3P5P A;  1WMW A;  4RXC A;  5ILH A;  5DHI A;  3AQB B;  1KIY A;  3PYA A;  2PS7 A;  3LLW A;  4EA2 A;  3CP6 A;  2F9K F;  5AEL A;  3LJI A;  5B0M A;  2ZCS A;  2E8W A;  5I1U A;  1HXA A;  5DJR F;  4KQS A;  4KPJ A;  2DH4 A;  3UCA A;  3ICN A;  3N45 F;  5E8L A;  3DYG A;  5AYP A;  3VJA A;  4XQR F;  1KIZ A;  2AEL A;  5ILI A;  3N5H F;  1DGP A;  3PDE A;  3WJO A;  5JV2 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...