5B01A

Structure of a prenyltransferase in its unbound form
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
262
structure length
262
Chain Sequence
YFQSMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MoeN5
publication title Structure and function of a prenyltransferase
rcsb
source organism Streptomyces ghanaensis
total genus 114
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b01A00
3LGZB 3ZCDA 3WCGA 3WCJA 4RXEA 2E8WA 1WY0A 1YV5A 5I1UA 4KQUA 3ADZA 3Q2QA 3AQBB 2ZCOA 3M02A 3V66A 4UMJA 4LPHF 3LLWA 5C05A 5DGMF 4LTZA 1VG2A 5AFXA 2F89F 3M0GA 3KB9A 3CC9A 3TFPA 5H9DA 2PS4A 5DHKA 1YYSA 4OKMA 3WJKA 3LVSA 4OKZA 3ASXA 1WMWA 5KSXF 3KRFB 3ICMA 3IPIA 3WCAA 5ILIA 3QKCA 4H5EF 4XQSF 3VJBA 4DZWA 5DGSF 4OMHA 3WSAA 3UCAA 3ICZA 2J5CA 3WCIA 4N1ZF 4RNQA 4MC8A 4KPJA 3VJEA 2AELA 4RXCA 5IM1A 3PH7A 3LK5A 3N45F 1UBWA 4NKEA 4F6VA 4LLSA 5CG6A 4KKMA 2ZEUA 4RXDA 2F8CF 3WEJA 2E4OA 3SAEA 3P8RA 3ICKA 5JA0F 5DZ2A 2Z4WA 4KVIA 3DYGA 2Q58A 2PS7A 1PS1A 1WL1A 4P0VA 2E93A 1N22A 2AZJA 3PKOA 3ZL6A 3WEKA 3LEEA 2F94F 4MC0A 3N1WF 5ERMA 5HNAA 5JV2F 4GP1A 4LZ0A 3SDQA 4PVYF 1V4JA 4Q23A 5B00A 4LFGA 3WCMA 5DW7A 5DHIA 3ID0A 5EATA 4KQ5A 4NFIF 4EA2A 4KQSA 3M9UA 2OPMA 5IL3A 3ZOUA 3VJ9A 3WJOA 3NRIA 2FORA 3EZ3A 3N49F 3P41A 4KPDA 4KVYA 2AETA 1RQJA 5IL8A 2RAHA 2Z52A 2Z4XA 4NKFA 2Z7HA 5AYPA 3WEIA 5IKAA 1V4HA 3BNXA 3TC1A 4KVWA 4LZ3A 1HXCA 1YYRA 3APZA 5B0JA 1HX9A 5HN8A 3G4DA 3TFNA 4NUAA 3OACB 5E8HA 3P5PA 3LG5A 2F8ZF 4P0WA 5ILDA 1VG7A 5A0JA 2AZKA 1DGPA 1N24A 3LOMA 2F7MF 3M00A 3VJCA 3N0FA 4LOBA 2PS5A 3TFVA 5DJVF 4DWGA 2Q80A 2FTZA 3WEGA 4QPFA 3G4FA 5B01A 1HM4A 3KROB 3RYEA 3N5HF 1YYTA 4NFJF 2F9KF 2E8VA 3BNYA 5EAUA 3ZMBA 1VG3A 3EFQA 3MZVA 3AE0A 3ICNA 3LGKA 1EZFA 2E95A 3DYHA 2Q9YA 4LA5A 5IMPA 5B0LA 1YYQA 4FJQA 4LFVF 3Q1OA 3QQVA 5B03A 4RYPA 2F92F 3LSNA 3KRPB 4DHDA 5HN7A 4L2XF 5JV1F 2E92A 4DWBA 5ERNA 2ONGA 4EA0A 1KIYA 3WCFA 3KRAB 1UBXA 4HD1A 2E91A 5IK9A 3OABB 3SDTA 3MAVA 3OACA 3WCLA 2J1PA 2P1CA 4JVJF 5EASA 3OYRA 3KRCB 3SDUA 3NPKA 2EWGA 3KRFA 2O1OA 3NPRA 3N6KF 2Z78A 3SDRA 3N3DA 4DI5A 1VG6A 2OGDA 2OA6A 1N21A 3N1VF 5IMIA 4JXNA 1RTRA 4H5DF 5ILHA 3S4JA 4GAXA 3ACXA 5JV0F 5CG5A 3KROA 2OPNA 4KFAA 5DGNF 4GP2A 1VG4A 4LTVA 3ACWA 1DI1A 3Q2ZA 3LJIA 2ONHA 5A0KA 1N1ZA 3WCEA 1WL2A 4LFEA 3WEFA 3RYWA 5JUZF 4XQRF 3LMDA 4NG6A 3KRPA 4LXWA 1WL3A 5ILJA 2E8UA 4KWDA 2Q9ZA 2E94A 5E8LA 2Z4VA 5B0IA 5IK0A 5B0MA 4WK5A 3CP6A 4LUUA 1WKZA 3KRAA 5AELA 3PDEA 1JFAA 1YHMA 4JYXA 4GA3A 1FPSA 3ACYA 4F6XA 5IN8A 1V4KA 2E8XA 3CKEA 4ZQ8A 3AQ0A 3KRCA 2Z50A 2ZCRA 3EGTA 4RXAA 3VJDA 2E90A 2ZCQA 4OGUA 5HN9A 1V4IA 3LDWA 5IMNA 5IKHA 3WCBA 5ILKA 1YJ4A 4QXSF 5DJPF 3N3LF 3N0GA 3W7FA 3RBMA 2PS8A 1HM7A 2ZEVA 3ZMCA 3Q30A 2PS6A 5DIQF 3IBAA 4MC3A 4H5CF 4KK2A 3P8LA 1N1BA 4LZCA 3P5RA 3PYAA 4K10A 3WE9A 4JZBA 4KVDA 3S9VA 3NF2A 4FP4A 2AZLA 5DJRF 3RMGA 3VJ8A 1N20A 1UBYA 4E9UA 1RQIA 3LZ9A 5IVGA 2ZY1A 3B7LA 4DEMF 1ZW5A 1YHLA 5EROA 3WSBA 1HXAA 3TS7A 3WCCA 4N9UA 5E8KA 4PVXF 3WC9A 1HXGA 3PYBA 2H8OA 2QISA 3KBKA 2J1OA 2Z4ZA 5B0KA 5AHUB 5IK6A 4EA1A 4E9ZA 4OMGA 4LIXA 4P0XA 3M01A 1JFGA 1WL0A 1YHKA 1YQ7A 4F62A 3N46F 3WCHA 4LLTA 3N5JF 1N23A 1V4EA 2ZCSA 4LA6A 5ILZA 4JZXA 3WEHA 3WJNA 2Z4YA 4JXYA 4LPGF 3V1XA 2I19A 3SDVA 4E1EA 1UBVA 4XQTF 1KIZA 4KUXA 1YYUA 5B02A 5ILYA 3AQCB 2E8TA 4DXJA 3WCDA 2VF6A 2AEKA 5ER8A 3VJAA 3DYFA 5A0IA 3V1VA 2Z7IA 3OABA 2DH4A 4NFKF
chains in the Genus database with same CATH superfamily
3LGZB 3ZCDA 3WCGA 3WCJA 4RXEA 2E8WA 1WY0A 1YV5A 5I1UA 4KQUA 3ADZA 3Q2QA 3AQBB 2ZCOA 3M02A 3V66A 4UMJA 4LPHF 3LLWA 5C05A 5DGMF 4LTZA 1VG2A 5AFXA 2F89F 3M0GA 3KB9A 3CC9A 3TFPA 5H9DA 2PS4A 5DHKA 1YYSA 4OKMA 3WJKA 3LVSA 4OKZA 3ASXA 1WMWA 5KSXF 3KRFB 3ICMA 3IPIA 3WCAA 5ILIA 3QKCA 4H5EF 4XQSF 3VJBA 4DZWA 5DGSF 4OMHA 3WSAA 3UCAA 3ICZA 2J5CA 3WCIA 4N1ZF 4RNQA 4MC8A 4KPJA 3VJEA 2AELA 4RXCA 5IM1A 3PH7A 3LK5A 3N45F 1UBWA 4NKEA 4F6VA 4LLSA 5CG6A 4KKMA 2ZEUA 4RXDA 2F8CF 3WEJA 2E4OA 3SAEA 3P8RA 3ICKA 5JA0F 5DZ2A 2Z4WA 4KVIA 3DYGA 2Q58A 2PS7A 1PS1A 1WL1A 4P0VA 2E93A 1N22A 2AZJA 3PKOA 3ZL6A 3WEKA 3LEEA 2F94F 4MC0A 3N1WF 5ERMA 5HNAA 5JV2F 4GP1A 4LZ0A 3SDQA 4PVYF 1V4JA 4Q23A 5B00A 4LFGA 3WCMA 5DW7A 5DHIA 3ID0A 5EATA 4KQ5A 4NFIF 4EA2A 4KQSA 3M9UA 2OPMA 5IL3A 3ZOUA 3VJ9A 3WJOA 3NRIA 2FORA 3EZ3A 3N49F 3P41A 4KPDA 4KVYA 2AETA 1RQJA 5IL8A 2RAHA 2Z52A 2Z4XA 4NKFA 2Z7HA 5AYPA 3WEIA 5IKAA 1V4HA 3BNXA 3TC1A 4KVWA 4LZ3A 1HXCA 1YYRA 3APZA 5B0JA 1HX9A 5HN8A 3G4DA 3TFNA 4NUAA 3OACB 5E8HA 3P5PA 3LG5A 2F8ZF 4P0WA 5ILDA 1VG7A 5A0JA 2AZKA 1DGPA 1N24A 3LOMA 2F7MF 3M00A 3VJCA 3N0FA 4LOBA 2PS5A 3TFVA 5DJVF 4DWGA 2Q80A 2FTZA 3WEGA 4QPFA 3G4FA 5B01A 1HM4A 3KROB 3RYEA 3N5HF 1YYTA 4NFJF 2F9KF 2E8VA 3BNYA 5EAUA 3ZMBA 1VG3A 3EFQA 3MZVA 3AE0A 3ICNA 3LGKA 1EZFA 2E95A 3DYHA 2Q9YA 4LA5A 5IMPA 5B0LA 1YYQA 4FJQA 4LFVF 3Q1OA 3QQVA 5B03A 4RYPA 2F92F 3LSNA 3KRPB 4DHDA 5HN7A 4L2XF 5JV1F 2E92A 4DWBA 5ERNA 2ONGA 4EA0A 1KIYA 3WCFA 3KRAB 1UBXA 4HD1A 2E91A 5IK9A 3OABB 3SDTA 3MAVA 3OACA 3WCLA 2J1PA 2P1CA 4JVJF 5EASA 3OYRA 3KRCB 3SDUA 3NPKA 2EWGA 3KRFA 2O1OA 3NPRA 3N6KF 2Z78A 3SDRA 3N3DA 4DI5A 1VG6A 2OGDA 2OA6A 1N21A 3N1VF 5IMIA 4JXNA 1RTRA 4H5DF 5ILHA 3S4JA 4GAXA 3ACXA 5JV0F 5CG5A 3KROA 2OPNA 4KFAA 5DGNF 4GP2A 1VG4A 4LTVA 3ACWA 1DI1A 3Q2ZA 3LJIA 2ONHA 5A0KA 1N1ZA 3WCEA 1WL2A 4LFEA 3WEFA 3RYWA 5JUZF 4XQRF 3LMDA 4NG6A 3KRPA 4LXWA 1WL3A 5ILJA 2E8UA 4KWDA 2Q9ZA 2E94A 5E8LA 2Z4VA 5B0IA 5IK0A 5B0MA 4WK5A 3CP6A 4LUUA 1WKZA 3KRAA 5AELA 3PDEA 1JFAA 1YHMA 4JYXA 4GA3A 1FPSA 3ACYA 4F6XA 5IN8A 1V4KA 2E8XA 3CKEA 4ZQ8A 3AQ0A 3KRCA 2Z50A 2ZCRA 3EGTA 4RXAA 3VJDA 2E90A 2ZCQA 4OGUA 5HN9A 1V4IA 3LDWA 5IMNA 5IKHA 3WCBA 5ILKA 1YJ4A 4QXSF 5DJPF 3N3LF 3N0GA 3W7FA 3RBMA 2PS8A 1HM7A 2ZEVA 3ZMCA 3Q30A 2PS6A 5DIQF 3IBAA 4MC3A 4H5CF 4KK2A 3P8LA 1N1BA 4LZCA 3P5RA 3PYAA 4K10A 3WE9A 4JZBA 4KVDA 3S9VA 3NF2A 4FP4A 2AZLA 5DJRF 3RMGA 3VJ8A 1N20A 1UBYA 4E9UA 1RQIA 3LZ9A 5IVGA 2ZY1A 3B7LA 4DEMF 1ZW5A 1YHLA 5EROA 3WSBA 1HXAA 3TS7A 3WCCA 4N9UA 5E8KA 4PVXF 3WC9A 1HXGA 3PYBA 2H8OA 2QISA 3KBKA 2J1OA 2Z4ZA 5B0KA 5AHUB 5IK6A 4EA1A 4E9ZA 4OMGA 4LIXA 4P0XA 3M01A 1JFGA 1WL0A 1YHKA 1YQ7A 4F62A 3N46F 3WCHA 4LLTA 3N5JF 1N23A 1V4EA 2ZCSA 4LA6A 5ILZA 4JZXA 3WEHA 3WJNA 2Z4YA 4JXYA 4LPGF 3V1XA 2I19A 3SDVA 4E1EA 1UBVA 4XQTF 1KIZA 4KUXA 1YYUA 5B02A 5ILYA 3AQCB 2E8TA 4DXJA 3WCDA 2VF6A 2AEKA 5ER8A 3VJAA 3DYFA 5A0IA 3V1VA 2Z7IA 3OABA 2DH4A 4NFKF
chains in the Genus database with same CATH topology
3LGZB 3ZCDA 3WCGA 3WCJA 4RXEA 2E8WA 1WY0A 1YV5A 5I1UA 4KQUA 3ADZA 3Q2QA 3AQBB 2ZCOA 3M02A 3V66A 4UMJA 4LPHF 3LLWA 5C05A 5DGMF 4LTZA 1VG2A 5AFXA 2F89F 3M0GA 3KB9A 3CC9A 3TFPA 5H9DA 2PS4A 5DHKA 1YYSA 4OKMA 3WJKA 3LVSA 4OKZA 3ASXA 1WMWA 5KSXF 3KRFB 3ICMA 3IPIA 3WCAA 5ILIA 3QKCA 4H5EF 4XQSF 3VJBA 4DZWA 5DGSF 4OMHA 3WSAA 3UCAA 3ICZA 2J5CA 3WCIA 4N1ZF 4RNQA 4MC8A 4KPJA 3VJEA 2AELA 4RXCA 5IM1A 3PH7A 3LK5A 3N45F 1UBWA 4NKEA 4F6VA 4LLSA 5CG6A 4KKMA 2ZEUA 4RXDA 2F8CF 3WEJA 2E4OA 3SAEA 3P8RA 3ICKA 5JA0F 5DZ2A 2Z4WA 4KVIA 3DYGA 2Q58A 2PS7A 1PS1A 1WL1A 4P0VA 2E93A 1N22A 2AZJA 3PKOA 3ZL6A 3WEKA 3LEEA 2F94F 4MC0A 3N1WF 5ERMA 5HNAA 5JV2F 4GP1A 4LZ0A 3SDQA 4PVYF 1V4JA 4Q23A 5B00A 4LFGA 3WCMA 5DW7A 5DHIA 3ID0A 5EATA 4KQ5A 4NFIF 4EA2A 4KQSA 3M9UA 2OPMA 5IL3A 3ZOUA 3VJ9A 3WJOA 3NRIA 2FORA 3EZ3A 3N49F 3P41A 4KPDA 4KVYA 2AETA 1RQJA 5IL8A 2RAHA 2Z52A 2Z4XA 4NKFA 2Z7HA 5AYPA 3WEIA 5IKAA 1V4HA 3BNXA 3TC1A 4KVWA 4LZ3A 1HXCA 1YYRA 3APZA 5B0JA 1HX9A 5HN8A 3G4DA 3TFNA 4NUAA 3OACB 5E8HA 3P5PA 3LG5A 2F8ZF 4P0WA 5ILDA 1VG7A 5A0JA 2AZKA 1DGPA 1N24A 3LOMA 2F7MF 3M00A 3VJCA 3N0FA 4LOBA 2PS5A 3TFVA 5DJVF 4DWGA 2Q80A 2FTZA 3WEGA 4QPFA 3G4FA 5B01A 1HM4A 3KROB 3RYEA 3N5HF 1YYTA 4NFJF 2F9KF 2E8VA 3BNYA 5EAUA 3ZMBA 1VG3A 3EFQA 3MZVA 3AE0A 3ICNA 3LGKA 1EZFA 2E95A 3DYHA 2Q9YA 4LA5A 5IMPA 5B0LA 1YYQA 4FJQA 4LFVF 3Q1OA 3QQVA 5B03A 4RYPA 2F92F 3LSNA 3KRPB 4DHDA 5HN7A 4L2XF 5JV1F 2E92A 4DWBA 5ERNA 2ONGA 4EA0A 1KIYA 3WCFA 3KRAB 1UBXA 4HD1A 2E91A 5IK9A 3OABB 3SDTA 3MAVA 3OACA 3WCLA 2J1PA 2P1CA 4JVJF 5EASA 3OYRA 3KRCB 3SDUA 3NPKA 2EWGA 3KRFA 2O1OA 3NPRA 3N6KF 2Z78A 3SDRA 3N3DA 4DI5A 1VG6A 2OGDA 2OA6A 1N21A 3N1VF 5IMIA 4JXNA 1RTRA 4H5DF 5ILHA 3S4JA 4GAXA 3ACXA 5JV0F 5CG5A 3KROA 2OPNA 4KFAA 5DGNF 4GP2A 1VG4A 4LTVA 3ACWA 1DI1A 3Q2ZA 3LJIA 2ONHA 5A0KA 1N1ZA 3WCEA 1WL2A 4LFEA 3WEFA 3RYWA 5JUZF 4XQRF 3LMDA 4NG6A 3KRPA 4LXWA 1WL3A 5ILJA 2E8UA 4KWDA 2Q9ZA 2E94A 5E8LA 2Z4VA 5B0IA 5IK0A 5B0MA 4WK5A 3CP6A 4LUUA 1WKZA 3KRAA 5AELA 3PDEA 1JFAA 1YHMA 4JYXA 4GA3A 1FPSA 3ACYA 4F6XA 5IN8A 1V4KA 2E8XA 3CKEA 4ZQ8A 3AQ0A 3KRCA 2Z50A 2ZCRA 3EGTA 4RXAA 3VJDA 2E90A 2ZCQA 4OGUA 5HN9A 1V4IA 3LDWA 5IMNA 5IKHA 3WCBA 5ILKA 1YJ4A 4QXSF 5DJPF 3N3LF 3N0GA 3W7FA 3RBMA 2PS8A 1HM7A 2ZEVA 3ZMCA 3Q30A 2PS6A 5DIQF 3IBAA 4MC3A 4H5CF 4KK2A 3P8LA 1N1BA 4LZCA 3P5RA 3PYAA 4K10A 3WE9A 4JZBA 4KVDA 3S9VA 3NF2A 4FP4A 2AZLA 5DJRF 3RMGA 3VJ8A 1N20A 1UBYA 4E9UA 1RQIA 3LZ9A 5IVGA 2ZY1A 3B7LA 4DEMF 1ZW5A 1YHLA 5EROA 3WSBA 1HXAA 3TS7A 3WCCA 4N9UA 5E8KA 4PVXF 3WC9A 1HXGA 3PYBA 2H8OA 2QISA 3KBKA 2J1OA 2Z4ZA 5B0KA 5AHUB 5IK6A 4EA1A 4E9ZA 4OMGA 4LIXA 4P0XA 3M01A 1JFGA 1WL0A 1YHKA 1YQ7A 4F62A 3N46F 3WCHA 4LLTA 3N5JF 1N23A 1V4EA 2ZCSA 4LA6A 5ILZA 4JZXA 3WEHA 3WJNA 2Z4YA 4JXYA 4LPGF 3V1XA 2I19A 3SDVA 4E1EA 1UBVA 4XQTF 1KIZA 4KUXA 1YYUA 5B02A 5ILYA 3AQCB 2E8TA 4DXJA 3WCDA 2VF6A 2AEKA 5ER8A 3VJAA 3DYFA 5A0IA 3V1VA 2Z7IA 3OABA 2DH4A 4NFKF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LGZ B;  3ZCD A;  3WCG A;  3WCJ A;  4RXE A;  2E8W A;  1WY0 A;  1YV5 A;  5I1U A;  4KQU A;  3ADZ A;  3Q2Q A;  3AQB B;  2ZCO A;  3M02 A;  3V66 A;  4UMJ A;  4LPH F;  3LLW A;  5C05 A;  5DGM F;  4LTZ A;  1VG2 A;  5AFX A;  2F89 F;  3M0G A;  3KB9 A;  3CC9 A;  3TFP A;  5H9D A;  2PS4 A;  5DHK A;  1YYS A;  4OKM A;  3WJK A;  3LVS A;  4OKZ A;  3ASX A;  1WMW A;  5KSX F;  3KRF B;  3ICM A;  3IPI A;  3WCA A;  5ILI A;  3QKC A;  4H5E F;  4XQS F;  3VJB A;  4DZW A;  5DGS F;  4OMH A;  3WSA A;  3UCA A;  3ICZ A;  2J5C A;  3WCI A;  4N1Z F;  4RNQ A;  4MC8 A;  4KPJ A;  3VJE A;  2AEL A;  4RXC A;  5IM1 A;  3PH7 A;  3LK5 A;  3N45 F;  1UBW A;  4NKE A;  4F6V A;  4LLS A;  5CG6 A;  4KKM A;  2ZEU A;  4RXD A;  2F8C F;  3WEJ A;  2E4O A;  3SAE A;  3P8R A;  3ICK A;  5JA0 F;  5DZ2 A;  2Z4W A;  4KVI A;  3DYG A;  2Q58 A;  2PS7 A;  1PS1 A;  1WL1 A;  4P0V A;  2E93 A;  1N22 A;  2AZJ A;  3PKO A;  3ZL6 A;  3WEK A;  3LEE A;  2F94 F;  4MC0 A;  3N1W F;  5ERM A;  5HNA A;  5JV2 F;  4GP1 A;  4LZ0 A;  3SDQ A;  4PVY F;  1V4J A;  4Q23 A;  5B00 A;  4LFG A;  3WCM A;  5DW7 A;  5DHI A;  3ID0 A;  5EAT A;  4KQ5 A;  4NFI F;  4EA2 A;  4KQS A;  3M9U A;  2OPM A;  5IL3 A;  3ZOU A;  3VJ9 A;  3WJO A;  3NRI A;  2FOR A;  3EZ3 A;  3N49 F;  3P41 A;  4KPD A;  4KVY A;  2AET A;  1RQJ A;  5IL8 A;  2RAH A;  2Z52 A;  2Z4X A;  4NKF A;  2Z7H A;  5AYP A;  3WEI A;  5IKA A;  1V4H A;  3BNX A;  3TC1 A;  4KVW A;  4LZ3 A;  1HXC A;  1YYR A;  3APZ A;  5B0J A;  1HX9 A;  5HN8 A;  3G4D A;  3TFN A;  4NUA A;  3OAC B;  5E8H A;  3P5P A;  3LG5 A;  2F8Z F;  4P0W A;  5ILD A;  1VG7 A;  5A0J A;  2AZK A;  1DGP A;  1N24 A;  3LOM A;  2F7M F;  3M00 A;  3VJC A;  3N0F A;  4LOB A;  2PS5 A;  3TFV A;  5DJV F;  4DWG A;  2Q80 A;  2FTZ A;  3WEG A;  4QPF A;  3G4F A;  5B01 A;  1HM4 A;  3KRO B;  3RYE A;  3N5H F;  1YYT A;  4NFJ F;  2F9K F;  2E8V A;  3BNY A;  5EAU A;  3ZMB A;  1VG3 A;  3EFQ A;  3MZV A;  3AE0 A;  3ICN A;  3LGK A;  1EZF A;  2E95 A;  3DYH A;  2Q9Y A;  4LA5 A;  5IMP A;  5B0L A;  1YYQ A;  4FJQ A;  4LFV F;  3Q1O A;  3QQV A;  5B03 A;  4RYP A;  2F92 F;  3LSN A;  3KRP B;  4DHD A;  5HN7 A;  4L2X F;  5JV1 F;  2E92 A;  4DWB A;  5ERN A;  2ONG A;  4EA0 A;  1KIY A;  3WCF A;  3KRA B;  1UBX A;  4HD1 A;  2E91 A;  5IK9 A;  3OAB B;  3SDT A;  3MAV A;  3OAC A;  3WCL A;  2J1P A;  2P1C A;  4JVJ F;  5EAS A;  3OYR A;  3KRC B;  3SDU A;  3NPK A;  2EWG A;  3KRF A;  2O1O A;  3NPR A;  3N6K F;  2Z78 A;  3SDR A;  3N3D A;  4DI5 A;  1VG6 A;  2OGD A;  2OA6 A;  1N21 A;  3N1V F;  5IMI A;  4JXN A;  1RTR A;  4H5D F;  5ILH A;  3S4J A;  4GAX A;  3ACX A;  5JV0 F;  5CG5 A;  3KRO A;  2OPN A;  4KFA A;  5DGN F;  4GP2 A;  1VG4 A;  4LTV A;  3ACW A;  1DI1 A;  3Q2Z A;  3LJI A;  2ONH A;  5A0K A;  1N1Z A;  3WCE A;  1WL2 A;  4LFE A;  3WEF A;  3RYW A;  5JUZ F;  4XQR F;  3LMD A;  4NG6 A;  3KRP A;  4LXW A;  1WL3 A;  5ILJ A;  2E8U A;  4KWD A;  2Q9Z A;  2E94 A;  5E8L A;  2Z4V A;  5B0I A;  5IK0 A;  5B0M A;  4WK5 A;  3CP6 A;  4LUU A;  1WKZ A;  3KRA A;  5AEL A;  3PDE A;  1JFA A;  1YHM A;  4JYX A;  4GA3 A;  1FPS A;  3ACY A;  4F6X A;  5IN8 A;  1V4K A;  2E8X A;  3CKE A;  4ZQ8 A;  3AQ0 A;  3KRC A;  2Z50 A;  2ZCR A;  3EGT A;  4RXA A;  3VJD A;  2E90 A;  2ZCQ A;  4OGU A;  5HN9 A;  1V4I A;  3LDW A;  5IMN A;  5IKH A;  3WCB A;  5ILK A;  1YJ4 A;  4QXS F;  5DJP F;  3N3L F;  3N0G A;  3W7F A;  3RBM A;  2PS8 A;  1HM7 A;  2ZEV A;  3ZMC A;  3Q30 A;  2PS6 A;  5DIQ F;  3IBA A;  4MC3 A;  4H5C F;  4KK2 A;  3P8L A;  1N1B A;  4LZC A;  3P5R A;  3PYA A;  4K10 A;  3WE9 A;  4JZB A;  4KVD A;  3S9V A;  3NF2 A;  4FP4 A;  2AZL A;  5DJR F;  3RMG A;  3VJ8 A;  1N20 A;  1UBY A;  4E9U A;  1RQI A;  3LZ9 A;  5IVG A;  2ZY1 A;  3B7L A;  4DEM F;  1ZW5 A;  1YHL A;  5ERO A;  3WSB A;  1HXA A;  3TS7 A;  3WCC A;  4N9U A;  5E8K A;  4PVX F;  3WC9 A;  1HXG A;  3PYB A;  2H8O A;  2QIS A;  3KBK A;  2J1O A;  2Z4Z A;  5B0K A;  5AHU B;  5IK6 A;  4EA1 A;  4E9Z A;  4OMG A;  4LIX A;  4P0X A;  3M01 A;  1JFG A;  1WL0 A;  1YHK A;  1YQ7 A;  4F62 A;  3N46 F;  3WCH A;  4LLT A;  3N5J F;  1N23 A;  1V4E A;  2ZCS A;  4LA6 A;  5ILZ A;  4JZX A;  3WEH A;  3WJN A;  2Z4Y A;  4JXY A;  4LPG F;  3V1X A;  2I19 A;  3SDV A;  4E1E A;  1UBV A;  4XQT F;  1KIZ A;  4KUX A;  1YYU A;  5B02 A;  5ILY A;  3AQC B;  2E8T A;  4DXJ A;  3WCD A;  2VF6 A;  2AEK A;  5ER8 A;  3VJA A;  3DYF A;  5A0I A;  3V1V A;  2Z7I A;  3OAB A;  2DH4 A;  4NFK F; 
#chains in the Genus database with same CATH topology
 3LGZ B;  3ZCD A;  3WCG A;  3WCJ A;  4RXE A;  2E8W A;  1WY0 A;  1YV5 A;  5I1U A;  4KQU A;  3ADZ A;  3Q2Q A;  3AQB B;  2ZCO A;  3M02 A;  3V66 A;  4UMJ A;  4LPH F;  3LLW A;  5C05 A;  5DGM F;  4LTZ A;  1VG2 A;  5AFX A;  2F89 F;  3M0G A;  3KB9 A;  3CC9 A;  3TFP A;  5H9D A;  2PS4 A;  5DHK A;  1YYS A;  4OKM A;  3WJK A;  3LVS A;  4OKZ A;  3ASX A;  1WMW A;  5KSX F;  3KRF B;  3ICM A;  3IPI A;  3WCA A;  5ILI A;  3QKC A;  4H5E F;  4XQS F;  3VJB A;  4DZW A;  5DGS F;  4OMH A;  3WSA A;  3UCA A;  3ICZ A;  2J5C A;  3WCI A;  4N1Z F;  4RNQ A;  4MC8 A;  4KPJ A;  3VJE A;  2AEL A;  4RXC A;  5IM1 A;  3PH7 A;  3LK5 A;  3N45 F;  1UBW A;  4NKE A;  4F6V A;  4LLS A;  5CG6 A;  4KKM A;  2ZEU A;  4RXD A;  2F8C F;  3WEJ A;  2E4O A;  3SAE A;  3P8R A;  3ICK A;  5JA0 F;  5DZ2 A;  2Z4W A;  4KVI A;  3DYG A;  2Q58 A;  2PS7 A;  1PS1 A;  1WL1 A;  4P0V A;  2E93 A;  1N22 A;  2AZJ A;  3PKO A;  3ZL6 A;  3WEK A;  3LEE A;  2F94 F;  4MC0 A;  3N1W F;  5ERM A;  5HNA A;  5JV2 F;  4GP1 A;  4LZ0 A;  3SDQ A;  4PVY F;  1V4J A;  4Q23 A;  5B00 A;  4LFG A;  3WCM A;  5DW7 A;  5DHI A;  3ID0 A;  5EAT A;  4KQ5 A;  4NFI F;  4EA2 A;  4KQS A;  3M9U A;  2OPM A;  5IL3 A;  3ZOU A;  3VJ9 A;  3WJO A;  3NRI A;  2FOR A;  3EZ3 A;  3N49 F;  3P41 A;  4KPD A;  4KVY A;  2AET A;  1RQJ A;  5IL8 A;  2RAH A;  2Z52 A;  2Z4X A;  4NKF A;  2Z7H A;  5AYP A;  3WEI A;  5IKA A;  1V4H A;  3BNX A;  3TC1 A;  4KVW A;  4LZ3 A;  1HXC A;  1YYR A;  3APZ A;  5B0J A;  1HX9 A;  5HN8 A;  3G4D A;  3TFN A;  4NUA A;  3OAC B;  5E8H A;  3P5P A;  3LG5 A;  2F8Z F;  4P0W A;  5ILD A;  1VG7 A;  5A0J A;  2AZK A;  1DGP A;  1N24 A;  3LOM A;  2F7M F;  3M00 A;  3VJC A;  3N0F A;  4LOB A;  2PS5 A;  3TFV A;  5DJV F;  4DWG A;  2Q80 A;  2FTZ A;  3WEG A;  4QPF A;  3G4F A;  5B01 A;  1HM4 A;  3KRO B;  3RYE A;  3N5H F;  1YYT A;  4NFJ F;  2F9K F;  2E8V A;  3BNY A;  5EAU A;  3ZMB A;  1VG3 A;  3EFQ A;  3MZV A;  3AE0 A;  3ICN A;  3LGK A;  1EZF A;  2E95 A;  3DYH A;  2Q9Y A;  4LA5 A;  5IMP A;  5B0L A;  1YYQ A;  4FJQ A;  4LFV F;  3Q1O A;  3QQV A;  5B03 A;  4RYP A;  2F92 F;  3LSN A;  3KRP B;  4DHD A;  5HN7 A;  4L2X F;  5JV1 F;  2E92 A;  4DWB A;  5ERN A;  2ONG A;  4EA0 A;  1KIY A;  3WCF A;  3KRA B;  1UBX A;  4HD1 A;  2E91 A;  5IK9 A;  3OAB B;  3SDT A;  3MAV A;  3OAC A;  3WCL A;  2J1P A;  2P1C A;  4JVJ F;  5EAS A;  3OYR A;  3KRC B;  3SDU A;  3NPK A;  2EWG A;  3KRF A;  2O1O A;  3NPR A;  3N6K F;  2Z78 A;  3SDR A;  3N3D A;  4DI5 A;  1VG6 A;  2OGD A;  2OA6 A;  1N21 A;  3N1V F;  5IMI A;  4JXN A;  1RTR A;  4H5D F;  5ILH A;  3S4J A;  4GAX A;  3ACX A;  5JV0 F;  5CG5 A;  3KRO A;  2OPN A;  4KFA A;  5DGN F;  4GP2 A;  1VG4 A;  4LTV A;  3ACW A;  1DI1 A;  3Q2Z A;  3LJI A;  2ONH A;  5A0K A;  1N1Z A;  3WCE A;  1WL2 A;  4LFE A;  3WEF A;  3RYW A;  5JUZ F;  4XQR F;  3LMD A;  4NG6 A;  3KRP A;  4LXW A;  1WL3 A;  5ILJ A;  2E8U A;  4KWD A;  2Q9Z A;  2E94 A;  5E8L A;  2Z4V A;  5B0I A;  5IK0 A;  5B0M A;  4WK5 A;  3CP6 A;  4LUU A;  1WKZ A;  3KRA A;  5AEL A;  3PDE A;  1JFA A;  1YHM A;  4JYX A;  4GA3 A;  1FPS A;  3ACY A;  4F6X A;  5IN8 A;  1V4K A;  2E8X A;  3CKE A;  4ZQ8 A;  3AQ0 A;  3KRC A;  2Z50 A;  2ZCR A;  3EGT A;  4RXA A;  3VJD A;  2E90 A;  2ZCQ A;  4OGU A;  5HN9 A;  1V4I A;  3LDW A;  5IMN A;  5IKH A;  3WCB A;  5ILK A;  1YJ4 A;  4QXS F;  5DJP F;  3N3L F;  3N0G A;  3W7F A;  3RBM A;  2PS8 A;  1HM7 A;  2ZEV A;  3ZMC A;  3Q30 A;  2PS6 A;  5DIQ F;  3IBA A;  4MC3 A;  4H5C F;  4KK2 A;  3P8L A;  1N1B A;  4LZC A;  3P5R A;  3PYA A;  4K10 A;  3WE9 A;  4JZB A;  4KVD A;  3S9V A;  3NF2 A;  4FP4 A;  2AZL A;  5DJR F;  3RMG A;  3VJ8 A;  1N20 A;  1UBY A;  4E9U A;  1RQI A;  3LZ9 A;  5IVG A;  2ZY1 A;  3B7L A;  4DEM F;  1ZW5 A;  1YHL A;  5ERO A;  3WSB A;  1HXA A;  3TS7 A;  3WCC A;  4N9U A;  5E8K A;  4PVX F;  3WC9 A;  1HXG A;  3PYB A;  2H8O A;  2QIS A;  3KBK A;  2J1O A;  2Z4Z A;  5B0K A;  5AHU B;  5IK6 A;  4EA1 A;  4E9Z A;  4OMG A;  4LIX A;  4P0X A;  3M01 A;  1JFG A;  1WL0 A;  1YHK A;  1YQ7 A;  4F62 A;  3N46 F;  3WCH A;  4LLT A;  3N5J F;  1N23 A;  1V4E A;  2ZCS A;  4LA6 A;  5ILZ A;  4JZX A;  3WEH A;  3WJN A;  2Z4Y A;  4JXY A;  4LPG F;  3V1X A;  2I19 A;  3SDV A;  4E1E A;  1UBV A;  4XQT F;  1KIZ A;  4KUX A;  1YYU A;  5B02 A;  5ILY A;  3AQC B;  2E8T A;  4DXJ A;  3WCD A;  2VF6 A;  2AEK A;  5ER8 A;  3VJA A;  3DYF A;  5A0I A;  3V1V A;  2Z7I A;  3OAB A;  2DH4 A;  4NFK F; 
#chains in the Genus database with same CATH homology
 3LGZ B;  3ZCD A;  3WCG A;  3WCJ A;  4RXE A;  2E8W A;  1WY0 A;  1YV5 A;  5I1U A;  4KQU A;  3ADZ A;  3Q2Q A;  3AQB B;  2ZCO A;  3M02 A;  3V66 A;  4UMJ A;  4LPH F;  3LLW A;  5C05 A;  5DGM F;  4LTZ A;  1VG2 A;  5AFX A;  2F89 F;  3M0G A;  3KB9 A;  3CC9 A;  3TFP A;  5H9D A;  2PS4 A;  5DHK A;  1YYS A;  4OKM A;  3WJK A;  3LVS A;  4OKZ A;  3ASX A;  1WMW A;  5KSX F;  3KRF B;  3ICM A;  3IPI A;  3WCA A;  5ILI A;  3QKC A;  4H5E F;  4XQS F;  3VJB A;  4DZW A;  5DGS F;  4OMH A;  3WSA A;  3UCA A;  3ICZ A;  2J5C A;  3WCI A;  4N1Z F;  4RNQ A;  4MC8 A;  4KPJ A;  3VJE A;  2AEL A;  4RXC A;  5IM1 A;  3PH7 A;  3LK5 A;  3N45 F;  1UBW A;  4NKE A;  4F6V A;  4LLS A;  5CG6 A;  4KKM A;  2ZEU A;  4RXD A;  2F8C F;  3WEJ A;  2E4O A;  3SAE A;  3P8R A;  3ICK A;  5JA0 F;  5DZ2 A;  2Z4W A;  4KVI A;  3DYG A;  2Q58 A;  2PS7 A;  1PS1 A;  1WL1 A;  4P0V A;  2E93 A;  1N22 A;  2AZJ A;  3PKO A;  3ZL6 A;  3WEK A;  3LEE A;  2F94 F;  4MC0 A;  3N1W F;  5ERM A;  5HNA A;  5JV2 F;  4GP1 A;  4LZ0 A;  3SDQ A;  4PVY F;  1V4J A;  4Q23 A;  5B00 A;  4LFG A;  3WCM A;  5DW7 A;  5DHI A;  3ID0 A;  5EAT A;  4KQ5 A;  4NFI F;  4EA2 A;  4KQS A;  3M9U A;  2OPM A;  5IL3 A;  3ZOU A;  3VJ9 A;  3WJO A;  3NRI A;  2FOR A;  3EZ3 A;  3N49 F;  3P41 A;  4KPD A;  4KVY A;  2AET A;  1RQJ A;  5IL8 A;  2RAH A;  2Z52 A;  2Z4X A;  4NKF A;  2Z7H A;  5AYP A;  3WEI A;  5IKA A;  1V4H A;  3BNX A;  3TC1 A;  4KVW A;  4LZ3 A;  1HXC A;  1YYR A;  3APZ A;  5B0J A;  1HX9 A;  5HN8 A;  3G4D A;  3TFN A;  4NUA A;  3OAC B;  5E8H A;  3P5P A;  3LG5 A;  2F8Z F;  4P0W A;  5ILD A;  1VG7 A;  5A0J A;  2AZK A;  1DGP A;  1N24 A;  3LOM A;  2F7M F;  3M00 A;  3VJC A;  3N0F A;  4LOB A;  2PS5 A;  3TFV A;  5DJV F;  4DWG A;  2Q80 A;  2FTZ A;  3WEG A;  4QPF A;  3G4F A;  5B01 A;  1HM4 A;  3KRO B;  3RYE A;  3N5H F;  1YYT A;  4NFJ F;  2F9K F;  2E8V A;  3BNY A;  5EAU A;  3ZMB A;  1VG3 A;  3EFQ A;  3MZV A;  3AE0 A;  3ICN A;  3LGK A;  1EZF A;  2E95 A;  3DYH A;  2Q9Y A;  4LA5 A;  5IMP A;  5B0L A;  1YYQ A;  4FJQ A;  4LFV F;  3Q1O A;  3QQV A;  5B03 A;  4RYP A;  2F92 F;  3LSN A;  3KRP B;  4DHD A;  5HN7 A;  4L2X F;  5JV1 F;  2E92 A;  4DWB A;  5ERN A;  2ONG A;  4EA0 A;  1KIY A;  3WCF A;  3KRA B;  1UBX A;  4HD1 A;  2E91 A;  5IK9 A;  3OAB B;  3SDT A;  3MAV A;  3OAC A;  3WCL A;  2J1P A;  2P1C A;  4JVJ F;  5EAS A;  3OYR A;  3KRC B;  3SDU A;  3NPK A;  2EWG A;  3KRF A;  2O1O A;  3NPR A;  3N6K F;  2Z78 A;  3SDR A;  3N3D A;  4DI5 A;  1VG6 A;  2OGD A;  2OA6 A;  1N21 A;  3N1V F;  5IMI A;  4JXN A;  1RTR A;  4H5D F;  5ILH A;  3S4J A;  4GAX A;  3ACX A;  5JV0 F;  5CG5 A;  3KRO A;  2OPN A;  4KFA A;  5DGN F;  4GP2 A;  1VG4 A;  4LTV A;  3ACW A;  1DI1 A;  3Q2Z A;  3LJI A;  2ONH A;  5A0K A;  1N1Z A;  3WCE A;  1WL2 A;  4LFE A;  3WEF A;  3RYW A;  5JUZ F;  4XQR F;  3LMD A;  4NG6 A;  3KRP A;  4LXW A;  1WL3 A;  5ILJ A;  2E8U A;  4KWD A;  2Q9Z A;  2E94 A;  5E8L A;  2Z4V A;  5B0I A;  5IK0 A;  5B0M A;  4WK5 A;  3CP6 A;  4LUU A;  1WKZ A;  3KRA A;  5AEL A;  3PDE A;  1JFA A;  1YHM A;  4JYX A;  4GA3 A;  1FPS A;  3ACY A;  4F6X A;  5IN8 A;  1V4K A;  2E8X A;  3CKE A;  4ZQ8 A;  3AQ0 A;  3KRC A;  2Z50 A;  2ZCR A;  3EGT A;  4RXA A;  3VJD A;  2E90 A;  2ZCQ A;  4OGU A;  5HN9 A;  1V4I A;  3LDW A;  5IMN A;  5IKH A;  3WCB A;  5ILK A;  1YJ4 A;  4QXS F;  5DJP F;  3N3L F;  3N0G A;  3W7F A;  3RBM A;  2PS8 A;  1HM7 A;  2ZEV A;  3ZMC A;  3Q30 A;  2PS6 A;  5DIQ F;  3IBA A;  4MC3 A;  4H5C F;  4KK2 A;  3P8L A;  1N1B A;  4LZC A;  3P5R A;  3PYA A;  4K10 A;  3WE9 A;  4JZB A;  4KVD A;  3S9V A;  3NF2 A;  4FP4 A;  2AZL A;  5DJR F;  3RMG A;  3VJ8 A;  1N20 A;  1UBY A;  4E9U A;  1RQI A;  3LZ9 A;  5IVG A;  2ZY1 A;  3B7L A;  4DEM F;  1ZW5 A;  1YHL A;  5ERO A;  3WSB A;  1HXA A;  3TS7 A;  3WCC A;  4N9U A;  5E8K A;  4PVX F;  3WC9 A;  1HXG A;  3PYB A;  2H8O A;  2QIS A;  3KBK A;  2J1O A;  2Z4Z A;  5B0K A;  5AHU B;  5IK6 A;  4EA1 A;  4E9Z A;  4OMG A;  4LIX A;  4P0X A;  3M01 A;  1JFG A;  1WL0 A;  1YHK A;  1YQ7 A;  4F62 A;  3N46 F;  3WCH A;  4LLT A;  3N5J F;  1N23 A;  1V4E A;  2ZCS A;  4LA6 A;  5ILZ A;  4JZX A;  3WEH A;  3WJN A;  2Z4Y A;  4JXY A;  4LPG F;  3V1X A;  2I19 A;  3SDV A;  4E1E A;  1UBV A;  4XQT F;  1KIZ A;  4KUX A;  1YYU A;  5B02 A;  5ILY A;  3AQC B;  2E8T A;  4DXJ A;  3WCD A;  2VF6 A;  2AEK A;  5ER8 A;  3VJA A;  3DYF A;  5A0I A;  3V1V A;  2Z7I A;  3OAB A;  2DH4 A;  4NFK F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...