5B01A

Structure of a prenyltransferase in its unbound form
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
262
structure length
262
Chain Sequence
YFQSMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MoeN5
publication title Structure and function of a prenyltransferase
rcsb
source organism Streptomyces ghanaensis
molecule tags Transferase
total genus 114
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b01A00
4F62A 2E92A 4KVIA 4MC0A 4JYXA 2AZLA 4LTVA 3KRPB 1VG2A 3BNYA 5ERNA 5HN8A 4F6VA 3ASXA 3N49F 3WCCA 1VG3A 3PKOA 3CC9A 3N1WF 3VJDA 4OKMA 3PYAA 2F89F 1V4KA 4XQRF 5JV2F 5B03A 4KWDA 3P5RA 3LLWA 4GP2A 3DYFA 2QISA 3WCEA 3LJIA 1DI1A 5IK0A 1RQIA 2Z52A 4OGUA 5CG5A 2AZJA 3Q2QA 4LPGF 3WSAA 4P0WA 4RXDA 4LTZA 2J5CA 4HD1A 4LIXA 5DGSF 1N22A 3SAEA 3M02A 2E95A 3WCJA 4KVYA 1YYSA 4RXAA 1HXGA 4DWGA 4JXYA 3RMGA 4ZQ8A 2E8VA 1V4IA 2Q9ZA 1VG6A 5AELA 3OACB 2AETA 4KQ5A 3CKEA 3OACA 2E8XA 4QPFA 1UBYA 5IVGA 1KIYA 1VG4A 3BNXA 2F92F 5IL3A 5EATA 3EFQA 2ZCQA 2E91A 2E93A 4LLSA 4PVXF 3N5HF 4OMHA 4KPDA 2F7MF 1DGPA 3RYWA 3ZL6A 1N23A 2DH4A 4XQTF 2H8OA 5IK6A 1N1ZA 4NG6A 4JVJF 3WCLA 4NKFA 3WCGA 4NFIF 5JV0F 4N1ZF 4LFVF 2J1PA 3EGTA 3SDVA 4WK5A 5IM1A 1WKZA 4P0XA 2E94A 4E9UA 3TC1A 3QKCA 4GP1A 2PS6A 2F8ZF 3KROB 4LA6A 1N20A 3ZMCA 3ACYA 5DHIA 5A0JA 5A0KA 2J1OA 1UBWA 3M00A 5DHKA 3AE0A 3KRAB 3KROA 1RQJA 2OPMA 4DZWA 3WCIA 1N21A 3ACWA 3KRAA 3SDQA 3LEEA 4LLTA 3NF2A 5EASA 3N3LF 3V1XA 4E9ZA 3G4FA 4LUUA 5ERMA 3WCAA 5IN8A 4NFJF 5B01A 4LZ0A 3M9UA 5DGNF 5IKHA 2E90A 5ILDA 3WJNA 3TFPA 5E8KA 3PDEA 5JV1F 3Q1OA 3QQVA 3TFNA 1YYRA 3WJKA 3OABB 1KIZA 3ZMBA 2PS7A 4EA2A 2OA6A 4H5EF 2ZEVA 5C05A 3OABA 4Q23A 3KRFB 3VJEA 3G4DA 1ZW5A 3ICNA 2FORA 4F6XA 1N24A 5B02A 5ER8A 3KRFA 4NUAA 3WEKA 1WY0A 5JA0F 5EAUA 5AYPA 4NKEA 1RTRA 4LFEA 3WCBA 2VF6A 3DYHA 3TS7A 5CG6A 3P8RA 2ZEUA 2I19A 2EWGA 5A0IA 1YYTA 3LG5A 1EZFA 4OMGA 2AELA 2PS5A 3VJ8A 4LZ3A 5ILYA 3ICZA 5IMIA 4DXJA 3WEJA 2RAHA 1JFGA 4JZXA 3PYBA 4KK2A 2Q80A 4H5DF 2E8WA 3P8LA 4KPJA 3WEFA 5ILKA 2F94F 2PS4A 5IK9A 1WL1A 3N0FA 3ADZA 3N6KF 4JXNA 3SDTA 4NFKF 4PVYF 1HM7A 2Z4YA 3N46F 3V1VA 5AHUB 2E8UA 1YV5A 4LPHF 3IPIA 2F8CF 4KVWA 5AFXA 5JUZF 2F9KF 1YYQA 2Z4XA 2P1CA 5DIQF 3SDUA 3LSNA 1YYUA 1UBVA 3N1VF 3N5JF 1UBXA 2ZY1A 4DEMF 3LOMA 5HN7A 3RBMA 3VJCA 5B0JA 3AQ0A 3UCAA 4FP4A 2ZCRA 3ICMA 2ZCOA 5DGMF 4XQSF 5IL8A 5ILJA 1HXAA 4MC8A 1WL3A 5DW7A 5DZ2A 3LGKA 1HX9A 3NPRA 4RYPA 4RXEA 2O1OA 4EA0A 3LDWA 3EZ3A 3P41A 2ZCSA 3M01A 5DJPF 2ONHA 3RYEA 4KQSA 4KUXA 3S4JA 1WMWA 3ACXA 2AZKA 4GAXA 4KVDA 4KFAA 1HM4A 4KQUA 3KRCA 5HNAA 5DJRF 2Z4ZA 3VJAA 2Z78A 2Z50A 5ILIA 5E8HA 3KRPA 3WJOA 5E8LA 1FPSA 3W7FA 3LZ9A 4LA5A 5DJVF 3APZA 4H5CF 1YJ4A 5B0MA 1V4EA 3WCHA 2Z7HA 4UMJA 3N3DA 2E4OA 4RXCA 5H9DA 4OKZA 3DYGA 1JFAA 3CP6A 4QXSF 3VJ9A 3WCDA 3LK5A 5B0IA 3Q30A 3VJBA 3WEGA 5HN9A 1HXCA 3ZCDA 3PH7A 3WCMA 3S9VA 1PS1A 3LMDA 3WEHA 5B00A 3LGZB 4JZBA 2ONGA 3ZOUA 1YQ7A 3M0GA 4L2XF 2Q58A 5IMNA 1VG7A 2Z4WA 3MAVA 5IKAA 3WC9A 4LZCA 2Q9YA 3SDRA 2Z4VA 3N45F 2PS8A 3ICKA 2OPNA 4DWBA 4GA3A 4LXWA 3MZVA 3ID0A 3V66A 3WSBA 2OGDA 3KB9A 2E8TA 3TFVA 4RNQA 3NPKA 3Q2ZA 2FTZA 4N9UA 3NRIA 1N1BA 1YHKA 1YHMA 1YHLA 5I1UA 1V4HA 1V4JA 4FJQA 4LOBA 2Z7IA 4EA1A 3LVSA 3IBAA 4LFGA 3AQCB 1WL2A 3WCFA 2AEKA 3AQBB 3WEIA 3N0GA 5EROA 5ILHA 3P5PA 4KKMA 1WL0A 3KBKA 4E1EA 4P0VA 3WE9A 3KRCB 4DI5A 3B7LA 4MC3A 5IMPA 3OYRA 5B0LA 5B0KA 4DHDA 5ILZA 4K10A 5KSXF
chains in the Genus database with same CATH superfamily
4F62A 2E92A 4KVIA 4MC0A 4JYXA 2AZLA 4LTVA 3KRPB 1VG2A 3BNYA 5ERNA 5HN8A 4F6VA 3ASXA 3N49F 3WCCA 1VG3A 3PKOA 3CC9A 3N1WF 3VJDA 4OKMA 3PYAA 2F89F 1V4KA 4XQRF 5JV2F 5B03A 4KWDA 3P5RA 3LLWA 4GP2A 3DYFA 2QISA 3WCEA 3LJIA 1DI1A 5IK0A 1RQIA 2Z52A 4OGUA 5CG5A 2AZJA 3Q2QA 4LPGF 3WSAA 4P0WA 4RXDA 4LTZA 2J5CA 4HD1A 4LIXA 5DGSF 1N22A 3SAEA 3M02A 2E95A 3WCJA 4KVYA 1YYSA 4RXAA 1HXGA 4DWGA 4JXYA 3RMGA 4ZQ8A 2E8VA 1V4IA 2Q9ZA 1VG6A 5AELA 3OACB 2AETA 4KQ5A 3CKEA 3OACA 2E8XA 4QPFA 1UBYA 5IVGA 1KIYA 1VG4A 3BNXA 2F92F 5IL3A 5EATA 3EFQA 2ZCQA 2E91A 2E93A 4LLSA 4PVXF 3N5HF 4OMHA 4KPDA 2F7MF 1DGPA 3RYWA 3ZL6A 1N23A 2DH4A 4XQTF 2H8OA 5IK6A 1N1ZA 4NG6A 4JVJF 3WCLA 4NKFA 3WCGA 4NFIF 5JV0F 4N1ZF 4LFVF 2J1PA 3EGTA 3SDVA 4WK5A 5IM1A 1WKZA 4P0XA 2E94A 4E9UA 3TC1A 3QKCA 4GP1A 2PS6A 2F8ZF 3KROB 4LA6A 1N20A 3ZMCA 3ACYA 5DHIA 5A0JA 5A0KA 2J1OA 1UBWA 3M00A 5DHKA 3AE0A 3KRAB 3KROA 1RQJA 2OPMA 4DZWA 3WCIA 1N21A 3ACWA 3KRAA 3SDQA 3LEEA 4LLTA 3NF2A 5EASA 3N3LF 3V1XA 4E9ZA 3G4FA 4LUUA 5ERMA 3WCAA 5IN8A 4NFJF 5B01A 4LZ0A 3M9UA 5DGNF 5IKHA 2E90A 5ILDA 3WJNA 3TFPA 5E8KA 3PDEA 5JV1F 3Q1OA 3QQVA 3TFNA 1YYRA 3WJKA 3OABB 1KIZA 3ZMBA 2PS7A 4EA2A 2OA6A 4H5EF 2ZEVA 5C05A 3OABA 4Q23A 3KRFB 3VJEA 3G4DA 1ZW5A 3ICNA 2FORA 4F6XA 1N24A 5B02A 5ER8A 3KRFA 4NUAA 3WEKA 1WY0A 5JA0F 5EAUA 5AYPA 4NKEA 1RTRA 4LFEA 3WCBA 2VF6A 3DYHA 3TS7A 5CG6A 3P8RA 2ZEUA 2I19A 2EWGA 5A0IA 1YYTA 3LG5A 1EZFA 4OMGA 2AELA 2PS5A 3VJ8A 4LZ3A 5ILYA 3ICZA 5IMIA 4DXJA 3WEJA 2RAHA 1JFGA 4JZXA 3PYBA 4KK2A 2Q80A 4H5DF 2E8WA 3P8LA 4KPJA 3WEFA 5ILKA 2F94F 2PS4A 5IK9A 1WL1A 3N0FA 3ADZA 3N6KF 4JXNA 3SDTA 4NFKF 4PVYF 1HM7A 2Z4YA 3N46F 3V1VA 5AHUB 2E8UA 1YV5A 4LPHF 3IPIA 2F8CF 4KVWA 5AFXA 5JUZF 2F9KF 1YYQA 2Z4XA 2P1CA 5DIQF 3SDUA 3LSNA 1YYUA 1UBVA 3N1VF 3N5JF 1UBXA 2ZY1A 4DEMF 3LOMA 5HN7A 3RBMA 3VJCA 5B0JA 3AQ0A 3UCAA 4FP4A 2ZCRA 3ICMA 2ZCOA 5DGMF 4XQSF 5IL8A 5ILJA 1HXAA 4MC8A 1WL3A 5DW7A 5DZ2A 3LGKA 1HX9A 3NPRA 4RYPA 4RXEA 2O1OA 4EA0A 3LDWA 3EZ3A 3P41A 2ZCSA 3M01A 5DJPF 2ONHA 3RYEA 4KQSA 4KUXA 3S4JA 1WMWA 3ACXA 2AZKA 4GAXA 4KVDA 4KFAA 1HM4A 4KQUA 3KRCA 5HNAA 5DJRF 2Z4ZA 3VJAA 2Z78A 2Z50A 5ILIA 5E8HA 3KRPA 3WJOA 5E8LA 1FPSA 3W7FA 3LZ9A 4LA5A 5DJVF 3APZA 4H5CF 1YJ4A 5B0MA 1V4EA 3WCHA 2Z7HA 4UMJA 3N3DA 2E4OA 4RXCA 5H9DA 4OKZA 3DYGA 1JFAA 3CP6A 4QXSF 3VJ9A 3WCDA 3LK5A 5B0IA 3Q30A 3VJBA 3WEGA 5HN9A 1HXCA 3ZCDA 3PH7A 3WCMA 3S9VA 1PS1A 3LMDA 3WEHA 5B00A 3LGZB 4JZBA 2ONGA 3ZOUA 1YQ7A 3M0GA 4L2XF 2Q58A 5IMNA 1VG7A 2Z4WA 3MAVA 5IKAA 3WC9A 4LZCA 2Q9YA 3SDRA 2Z4VA 3N45F 2PS8A 3ICKA 2OPNA 4DWBA 4GA3A 4LXWA 3MZVA 3ID0A 3V66A 3WSBA 2OGDA 3KB9A 2E8TA 3TFVA 4RNQA 3NPKA 3Q2ZA 2FTZA 4N9UA 3NRIA 1N1BA 1YHKA 1YHMA 1YHLA 5I1UA 1V4HA 1V4JA 4FJQA 4LOBA 2Z7IA 4EA1A 3LVSA 3IBAA 4LFGA 3AQCB 1WL2A 3WCFA 2AEKA 3AQBB 3WEIA 3N0GA 5EROA 5ILHA 3P5PA 4KKMA 1WL0A 3KBKA 4E1EA 4P0VA 3WE9A 3KRCB 4DI5A 3B7LA 4MC3A 5IMPA 3OYRA 5B0LA 5B0KA 4DHDA 5ILZA 4K10A 5KSXF
chains in the Genus database with same CATH topology
4F62A 2E92A 4KVIA 4MC0A 4JYXA 2AZLA 4LTVA 3KRPB 1VG2A 3BNYA 5ERNA 5HN8A 4F6VA 3ASXA 3N49F 3WCCA 1VG3A 3PKOA 3CC9A 3N1WF 3VJDA 4OKMA 3PYAA 2F89F 1V4KA 4XQRF 5JV2F 5B03A 4KWDA 3P5RA 3LLWA 4GP2A 3DYFA 2QISA 3WCEA 3LJIA 1DI1A 5IK0A 1RQIA 2Z52A 4OGUA 5CG5A 2AZJA 3Q2QA 4LPGF 3WSAA 4P0WA 4RXDA 4LTZA 2J5CA 4HD1A 4LIXA 5DGSF 1N22A 3SAEA 3M02A 2E95A 3WCJA 4KVYA 1YYSA 4RXAA 1HXGA 4DWGA 4JXYA 3RMGA 4ZQ8A 2E8VA 1V4IA 2Q9ZA 1VG6A 5AELA 3OACB 2AETA 4KQ5A 3CKEA 3OACA 2E8XA 4QPFA 1UBYA 5IVGA 1KIYA 1VG4A 3BNXA 2F92F 5IL3A 5EATA 3EFQA 2ZCQA 2E91A 2E93A 4LLSA 4PVXF 3N5HF 4OMHA 4KPDA 2F7MF 1DGPA 3RYWA 3ZL6A 1N23A 2DH4A 4XQTF 2H8OA 5IK6A 1N1ZA 4NG6A 4JVJF 3WCLA 4NKFA 3WCGA 4NFIF 5JV0F 4N1ZF 4LFVF 2J1PA 3EGTA 3SDVA 4WK5A 5IM1A 1WKZA 4P0XA 2E94A 4E9UA 3TC1A 3QKCA 4GP1A 2PS6A 2F8ZF 3KROB 4LA6A 1N20A 3ZMCA 3ACYA 5DHIA 5A0JA 5A0KA 2J1OA 1UBWA 3M00A 5DHKA 3AE0A 3KRAB 3KROA 1RQJA 2OPMA 4DZWA 3WCIA 1N21A 3ACWA 3KRAA 3SDQA 3LEEA 4LLTA 3NF2A 5EASA 3N3LF 3V1XA 4E9ZA 3G4FA 4LUUA 5ERMA 3WCAA 5IN8A 4NFJF 5B01A 4LZ0A 3M9UA 5DGNF 5IKHA 2E90A 5ILDA 3WJNA 3TFPA 5E8KA 3PDEA 5JV1F 3Q1OA 3QQVA 3TFNA 1YYRA 3WJKA 3OABB 1KIZA 3ZMBA 2PS7A 4EA2A 2OA6A 4H5EF 2ZEVA 5C05A 3OABA 4Q23A 3KRFB 3VJEA 3G4DA 1ZW5A 3ICNA 2FORA 4F6XA 1N24A 5B02A 5ER8A 3KRFA 4NUAA 3WEKA 1WY0A 5JA0F 5EAUA 5AYPA 4NKEA 1RTRA 4LFEA 3WCBA 2VF6A 3DYHA 3TS7A 5CG6A 3P8RA 2ZEUA 2I19A 2EWGA 5A0IA 1YYTA 3LG5A 1EZFA 4OMGA 2AELA 2PS5A 3VJ8A 4LZ3A 5ILYA 3ICZA 5IMIA 4DXJA 3WEJA 2RAHA 1JFGA 4JZXA 3PYBA 4KK2A 2Q80A 4H5DF 2E8WA 3P8LA 4KPJA 3WEFA 5ILKA 2F94F 2PS4A 5IK9A 1WL1A 3N0FA 3ADZA 3N6KF 4JXNA 3SDTA 4NFKF 4PVYF 1HM7A 2Z4YA 3N46F 3V1VA 5AHUB 2E8UA 1YV5A 4LPHF 3IPIA 2F8CF 4KVWA 5AFXA 5JUZF 2F9KF 1YYQA 2Z4XA 2P1CA 5DIQF 3SDUA 3LSNA 1YYUA 1UBVA 3N1VF 3N5JF 1UBXA 2ZY1A 4DEMF 3LOMA 5HN7A 3RBMA 3VJCA 5B0JA 3AQ0A 3UCAA 4FP4A 2ZCRA 3ICMA 2ZCOA 5DGMF 4XQSF 5IL8A 5ILJA 1HXAA 4MC8A 1WL3A 5DW7A 5DZ2A 3LGKA 1HX9A 3NPRA 4RYPA 4RXEA 2O1OA 4EA0A 3LDWA 3EZ3A 3P41A 2ZCSA 3M01A 5DJPF 2ONHA 3RYEA 4KQSA 4KUXA 3S4JA 1WMWA 3ACXA 2AZKA 4GAXA 4KVDA 4KFAA 1HM4A 4KQUA 3KRCA 5HNAA 5DJRF 2Z4ZA 3VJAA 2Z78A 2Z50A 5ILIA 5E8HA 3KRPA 3WJOA 5E8LA 1FPSA 3W7FA 3LZ9A 4LA5A 5DJVF 3APZA 4H5CF 1YJ4A 5B0MA 1V4EA 3WCHA 2Z7HA 4UMJA 3N3DA 2E4OA 4RXCA 5H9DA 4OKZA 3DYGA 1JFAA 3CP6A 4QXSF 3VJ9A 3WCDA 3LK5A 5B0IA 3Q30A 3VJBA 3WEGA 5HN9A 1HXCA 3ZCDA 3PH7A 3WCMA 3S9VA 1PS1A 3LMDA 3WEHA 5B00A 3LGZB 4JZBA 2ONGA 3ZOUA 1YQ7A 3M0GA 4L2XF 2Q58A 5IMNA 1VG7A 2Z4WA 3MAVA 5IKAA 3WC9A 4LZCA 2Q9YA 3SDRA 2Z4VA 3N45F 2PS8A 3ICKA 2OPNA 4DWBA 4GA3A 4LXWA 3MZVA 3ID0A 3V66A 3WSBA 2OGDA 3KB9A 2E8TA 3TFVA 4RNQA 3NPKA 3Q2ZA 2FTZA 4N9UA 3NRIA 1N1BA 1YHKA 1YHMA 1YHLA 5I1UA 1V4HA 1V4JA 4FJQA 4LOBA 2Z7IA 4EA1A 3LVSA 3IBAA 4LFGA 3AQCB 1WL2A 3WCFA 2AEKA 3AQBB 3WEIA 3N0GA 5EROA 5ILHA 3P5PA 4KKMA 1WL0A 3KBKA 4E1EA 4P0VA 3WE9A 3KRCB 4DI5A 3B7LA 4MC3A 5IMPA 3OYRA 5B0LA 5B0KA 4DHDA 5ILZA 4K10A 5KSXF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F62 A;  2E92 A;  4KVI A;  4MC0 A;  4JYX A;  2AZL A;  4LTV A;  3KRP B;  1VG2 A;  3BNY A;  5ERN A;  5HN8 A;  4F6V A;  3ASX A;  3N49 F;  3WCC A;  1VG3 A;  3PKO A;  3CC9 A;  3N1W F;  3VJD A;  4OKM A;  3PYA A;  2F89 F;  1V4K A;  4XQR F;  5JV2 F;  5B03 A;  4KWD A;  3P5R A;  3LLW A;  4GP2 A;  3DYF A;  2QIS A;  3WCE A;  3LJI A;  1DI1 A;  5IK0 A;  1RQI A;  2Z52 A;  4OGU A;  5CG5 A;  2AZJ A;  3Q2Q A;  4LPG F;  3WSA A;  4P0W A;  4RXD A;  4LTZ A;  2J5C A;  4HD1 A;  4LIX A;  5DGS F;  1N22 A;  3SAE A;  3M02 A;  2E95 A;  3WCJ A;  4KVY A;  1YYS A;  4RXA A;  1HXG A;  4DWG A;  4JXY A;  3RMG A;  4ZQ8 A;  2E8V A;  1V4I A;  2Q9Z A;  1VG6 A;  5AEL A;  3OAC B;  2AET A;  4KQ5 A;  3CKE A;  3OAC A;  2E8X A;  4QPF A;  1UBY A;  5IVG A;  1KIY A;  1VG4 A;  3BNX A;  2F92 F;  5IL3 A;  5EAT A;  3EFQ A;  2ZCQ A;  2E91 A;  2E93 A;  4LLS A;  4PVX F;  3N5H F;  4OMH A;  4KPD A;  2F7M F;  1DGP A;  3RYW A;  3ZL6 A;  1N23 A;  2DH4 A;  4XQT F;  2H8O A;  5IK6 A;  1N1Z A;  4NG6 A;  4JVJ F;  3WCL A;  4NKF A;  3WCG A;  4NFI F;  5JV0 F;  4N1Z F;  4LFV F;  2J1P A;  3EGT A;  3SDV A;  4WK5 A;  5IM1 A;  1WKZ A;  4P0X A;  2E94 A;  4E9U A;  3TC1 A;  3QKC A;  4GP1 A;  2PS6 A;  2F8Z F;  3KRO B;  4LA6 A;  1N20 A;  3ZMC A;  3ACY A;  5DHI A;  5A0J A;  5A0K A;  2J1O A;  1UBW A;  3M00 A;  5DHK A;  3AE0 A;  3KRA B;  3KRO A;  1RQJ A;  2OPM A;  4DZW A;  3WCI A;  1N21 A;  3ACW A;  3KRA A;  3SDQ A;  3LEE A;  4LLT A;  3NF2 A;  5EAS A;  3N3L F;  3V1X A;  4E9Z A;  3G4F A;  4LUU A;  5ERM A;  3WCA A;  5IN8 A;  4NFJ F;  5B01 A;  4LZ0 A;  3M9U A;  5DGN F;  5IKH A;  2E90 A;  5ILD A;  3WJN A;  3TFP A;  5E8K A;  3PDE A;  5JV1 F;  3Q1O A;  3QQV A;  3TFN A;  1YYR A;  3WJK A;  3OAB B;  1KIZ A;  3ZMB A;  2PS7 A;  4EA2 A;  2OA6 A;  4H5E F;  2ZEV A;  5C05 A;  3OAB A;  4Q23 A;  3KRF B;  3VJE A;  3G4D A;  1ZW5 A;  3ICN A;  2FOR A;  4F6X A;  1N24 A;  5B02 A;  5ER8 A;  3KRF A;  4NUA A;  3WEK A;  1WY0 A;  5JA0 F;  5EAU A;  5AYP A;  4NKE A;  1RTR A;  4LFE A;  3WCB A;  2VF6 A;  3DYH A;  3TS7 A;  5CG6 A;  3P8R A;  2ZEU A;  2I19 A;  2EWG A;  5A0I A;  1YYT A;  3LG5 A;  1EZF A;  4OMG A;  2AEL A;  2PS5 A;  3VJ8 A;  4LZ3 A;  5ILY A;  3ICZ A;  5IMI A;  4DXJ A;  3WEJ A;  2RAH A;  1JFG A;  4JZX A;  3PYB A;  4KK2 A;  2Q80 A;  4H5D F;  2E8W A;  3P8L A;  4KPJ A;  3WEF A;  5ILK A;  2F94 F;  2PS4 A;  5IK9 A;  1WL1 A;  3N0F A;  3ADZ A;  3N6K F;  4JXN A;  3SDT A;  4NFK F;  4PVY F;  1HM7 A;  2Z4Y A;  3N46 F;  3V1V A;  5AHU B;  2E8U A;  1YV5 A;  4LPH F;  3IPI A;  2F8C F;  4KVW A;  5AFX A;  5JUZ F;  2F9K F;  1YYQ A;  2Z4X A;  2P1C A;  5DIQ F;  3SDU A;  3LSN A;  1YYU A;  1UBV A;  3N1V F;  3N5J F;  1UBX A;  2ZY1 A;  4DEM F;  3LOM A;  5HN7 A;  3RBM A;  3VJC A;  5B0J A;  3AQ0 A;  3UCA A;  4FP4 A;  2ZCR A;  3ICM A;  2ZCO A;  5DGM F;  4XQS F;  5IL8 A;  5ILJ A;  1HXA A;  4MC8 A;  1WL3 A;  5DW7 A;  5DZ2 A;  3LGK A;  1HX9 A;  3NPR A;  4RYP A;  4RXE A;  2O1O A;  4EA0 A;  3LDW A;  3EZ3 A;  3P41 A;  2ZCS A;  3M01 A;  5DJP F;  2ONH A;  3RYE A;  4KQS A;  4KUX A;  3S4J A;  1WMW A;  3ACX A;  2AZK A;  4GAX A;  4KVD A;  4KFA A;  1HM4 A;  4KQU A;  3KRC A;  5HNA A;  5DJR F;  2Z4Z A;  3VJA A;  2Z78 A;  2Z50 A;  5ILI A;  5E8H A;  3KRP A;  3WJO A;  5E8L A;  1FPS A;  3W7F A;  3LZ9 A;  4LA5 A;  5DJV F;  3APZ A;  4H5C F;  1YJ4 A;  5B0M A;  1V4E A;  3WCH A;  2Z7H A;  4UMJ A;  3N3D A;  2E4O A;  4RXC A;  5H9D A;  4OKZ A;  3DYG A;  1JFA A;  3CP6 A;  4QXS F;  3VJ9 A;  3WCD A;  3LK5 A;  5B0I A;  3Q30 A;  3VJB A;  3WEG A;  5HN9 A;  1HXC A;  3ZCD A;  3PH7 A;  3WCM A;  3S9V A;  1PS1 A;  3LMD A;  3WEH A;  5B00 A;  3LGZ B;  4JZB A;  2ONG A;  3ZOU A;  1YQ7 A;  3M0G A;  4L2X F;  2Q58 A;  5IMN A;  1VG7 A;  2Z4W A;  3MAV A;  5IKA A;  3WC9 A;  4LZC A;  2Q9Y A;  3SDR A;  2Z4V A;  3N45 F;  2PS8 A;  3ICK A;  2OPN A;  4DWB A;  4GA3 A;  4LXW A;  3MZV A;  3ID0 A;  3V66 A;  3WSB A;  2OGD A;  3KB9 A;  2E8T A;  3TFV A;  4RNQ A;  3NPK A;  3Q2Z A;  2FTZ A;  4N9U A;  3NRI A;  1N1B A;  1YHK A;  1YHM A;  1YHL A;  5I1U A;  1V4H A;  1V4J A;  4FJQ A;  4LOB A;  2Z7I A;  4EA1 A;  3LVS A;  3IBA A;  4LFG A;  3AQC B;  1WL2 A;  3WCF A;  2AEK A;  3AQB B;  3WEI A;  3N0G A;  5ERO A;  5ILH A;  3P5P A;  4KKM A;  1WL0 A;  3KBK A;  4E1E A;  4P0V A;  3WE9 A;  3KRC B;  4DI5 A;  3B7L A;  4MC3 A;  5IMP A;  3OYR A;  5B0L A;  5B0K A;  4DHD A;  5ILZ A;  4K10 A;  5KSX F; 
#chains in the Genus database with same CATH topology
 4F62 A;  2E92 A;  4KVI A;  4MC0 A;  4JYX A;  2AZL A;  4LTV A;  3KRP B;  1VG2 A;  3BNY A;  5ERN A;  5HN8 A;  4F6V A;  3ASX A;  3N49 F;  3WCC A;  1VG3 A;  3PKO A;  3CC9 A;  3N1W F;  3VJD A;  4OKM A;  3PYA A;  2F89 F;  1V4K A;  4XQR F;  5JV2 F;  5B03 A;  4KWD A;  3P5R A;  3LLW A;  4GP2 A;  3DYF A;  2QIS A;  3WCE A;  3LJI A;  1DI1 A;  5IK0 A;  1RQI A;  2Z52 A;  4OGU A;  5CG5 A;  2AZJ A;  3Q2Q A;  4LPG F;  3WSA A;  4P0W A;  4RXD A;  4LTZ A;  2J5C A;  4HD1 A;  4LIX A;  5DGS F;  1N22 A;  3SAE A;  3M02 A;  2E95 A;  3WCJ A;  4KVY A;  1YYS A;  4RXA A;  1HXG A;  4DWG A;  4JXY A;  3RMG A;  4ZQ8 A;  2E8V A;  1V4I A;  2Q9Z A;  1VG6 A;  5AEL A;  3OAC B;  2AET A;  4KQ5 A;  3CKE A;  3OAC A;  2E8X A;  4QPF A;  1UBY A;  5IVG A;  1KIY A;  1VG4 A;  3BNX A;  2F92 F;  5IL3 A;  5EAT A;  3EFQ A;  2ZCQ A;  2E91 A;  2E93 A;  4LLS A;  4PVX F;  3N5H F;  4OMH A;  4KPD A;  2F7M F;  1DGP A;  3RYW A;  3ZL6 A;  1N23 A;  2DH4 A;  4XQT F;  2H8O A;  5IK6 A;  1N1Z A;  4NG6 A;  4JVJ F;  3WCL A;  4NKF A;  3WCG A;  4NFI F;  5JV0 F;  4N1Z F;  4LFV F;  2J1P A;  3EGT A;  3SDV A;  4WK5 A;  5IM1 A;  1WKZ A;  4P0X A;  2E94 A;  4E9U A;  3TC1 A;  3QKC A;  4GP1 A;  2PS6 A;  2F8Z F;  3KRO B;  4LA6 A;  1N20 A;  3ZMC A;  3ACY A;  5DHI A;  5A0J A;  5A0K A;  2J1O A;  1UBW A;  3M00 A;  5DHK A;  3AE0 A;  3KRA B;  3KRO A;  1RQJ A;  2OPM A;  4DZW A;  3WCI A;  1N21 A;  3ACW A;  3KRA A;  3SDQ A;  3LEE A;  4LLT A;  3NF2 A;  5EAS A;  3N3L F;  3V1X A;  4E9Z A;  3G4F A;  4LUU A;  5ERM A;  3WCA A;  5IN8 A;  4NFJ F;  5B01 A;  4LZ0 A;  3M9U A;  5DGN F;  5IKH A;  2E90 A;  5ILD A;  3WJN A;  3TFP A;  5E8K A;  3PDE A;  5JV1 F;  3Q1O A;  3QQV A;  3TFN A;  1YYR A;  3WJK A;  3OAB B;  1KIZ A;  3ZMB A;  2PS7 A;  4EA2 A;  2OA6 A;  4H5E F;  2ZEV A;  5C05 A;  3OAB A;  4Q23 A;  3KRF B;  3VJE A;  3G4D A;  1ZW5 A;  3ICN A;  2FOR A;  4F6X A;  1N24 A;  5B02 A;  5ER8 A;  3KRF A;  4NUA A;  3WEK A;  1WY0 A;  5JA0 F;  5EAU A;  5AYP A;  4NKE A;  1RTR A;  4LFE A;  3WCB A;  2VF6 A;  3DYH A;  3TS7 A;  5CG6 A;  3P8R A;  2ZEU A;  2I19 A;  2EWG A;  5A0I A;  1YYT A;  3LG5 A;  1EZF A;  4OMG A;  2AEL A;  2PS5 A;  3VJ8 A;  4LZ3 A;  5ILY A;  3ICZ A;  5IMI A;  4DXJ A;  3WEJ A;  2RAH A;  1JFG A;  4JZX A;  3PYB A;  4KK2 A;  2Q80 A;  4H5D F;  2E8W A;  3P8L A;  4KPJ A;  3WEF A;  5ILK A;  2F94 F;  2PS4 A;  5IK9 A;  1WL1 A;  3N0F A;  3ADZ A;  3N6K F;  4JXN A;  3SDT A;  4NFK F;  4PVY F;  1HM7 A;  2Z4Y A;  3N46 F;  3V1V A;  5AHU B;  2E8U A;  1YV5 A;  4LPH F;  3IPI A;  2F8C F;  4KVW A;  5AFX A;  5JUZ F;  2F9K F;  1YYQ A;  2Z4X A;  2P1C A;  5DIQ F;  3SDU A;  3LSN A;  1YYU A;  1UBV A;  3N1V F;  3N5J F;  1UBX A;  2ZY1 A;  4DEM F;  3LOM A;  5HN7 A;  3RBM A;  3VJC A;  5B0J A;  3AQ0 A;  3UCA A;  4FP4 A;  2ZCR A;  3ICM A;  2ZCO A;  5DGM F;  4XQS F;  5IL8 A;  5ILJ A;  1HXA A;  4MC8 A;  1WL3 A;  5DW7 A;  5DZ2 A;  3LGK A;  1HX9 A;  3NPR A;  4RYP A;  4RXE A;  2O1O A;  4EA0 A;  3LDW A;  3EZ3 A;  3P41 A;  2ZCS A;  3M01 A;  5DJP F;  2ONH A;  3RYE A;  4KQS A;  4KUX A;  3S4J A;  1WMW A;  3ACX A;  2AZK A;  4GAX A;  4KVD A;  4KFA A;  1HM4 A;  4KQU A;  3KRC A;  5HNA A;  5DJR F;  2Z4Z A;  3VJA A;  2Z78 A;  2Z50 A;  5ILI A;  5E8H A;  3KRP A;  3WJO A;  5E8L A;  1FPS A;  3W7F A;  3LZ9 A;  4LA5 A;  5DJV F;  3APZ A;  4H5C F;  1YJ4 A;  5B0M A;  1V4E A;  3WCH A;  2Z7H A;  4UMJ A;  3N3D A;  2E4O A;  4RXC A;  5H9D A;  4OKZ A;  3DYG A;  1JFA A;  3CP6 A;  4QXS F;  3VJ9 A;  3WCD A;  3LK5 A;  5B0I A;  3Q30 A;  3VJB A;  3WEG A;  5HN9 A;  1HXC A;  3ZCD A;  3PH7 A;  3WCM A;  3S9V A;  1PS1 A;  3LMD A;  3WEH A;  5B00 A;  3LGZ B;  4JZB A;  2ONG A;  3ZOU A;  1YQ7 A;  3M0G A;  4L2X F;  2Q58 A;  5IMN A;  1VG7 A;  2Z4W A;  3MAV A;  5IKA A;  3WC9 A;  4LZC A;  2Q9Y A;  3SDR A;  2Z4V A;  3N45 F;  2PS8 A;  3ICK A;  2OPN A;  4DWB A;  4GA3 A;  4LXW A;  3MZV A;  3ID0 A;  3V66 A;  3WSB A;  2OGD A;  3KB9 A;  2E8T A;  3TFV A;  4RNQ A;  3NPK A;  3Q2Z A;  2FTZ A;  4N9U A;  3NRI A;  1N1B A;  1YHK A;  1YHM A;  1YHL A;  5I1U A;  1V4H A;  1V4J A;  4FJQ A;  4LOB A;  2Z7I A;  4EA1 A;  3LVS A;  3IBA A;  4LFG A;  3AQC B;  1WL2 A;  3WCF A;  2AEK A;  3AQB B;  3WEI A;  3N0G A;  5ERO A;  5ILH A;  3P5P A;  4KKM A;  1WL0 A;  3KBK A;  4E1E A;  4P0V A;  3WE9 A;  3KRC B;  4DI5 A;  3B7L A;  4MC3 A;  5IMP A;  3OYR A;  5B0L A;  5B0K A;  4DHD A;  5ILZ A;  4K10 A;  5KSX F; 
#chains in the Genus database with same CATH homology
 4F62 A;  2E92 A;  4KVI A;  4MC0 A;  4JYX A;  2AZL A;  4LTV A;  3KRP B;  1VG2 A;  3BNY A;  5ERN A;  5HN8 A;  4F6V A;  3ASX A;  3N49 F;  3WCC A;  1VG3 A;  3PKO A;  3CC9 A;  3N1W F;  3VJD A;  4OKM A;  3PYA A;  2F89 F;  1V4K A;  4XQR F;  5JV2 F;  5B03 A;  4KWD A;  3P5R A;  3LLW A;  4GP2 A;  3DYF A;  2QIS A;  3WCE A;  3LJI A;  1DI1 A;  5IK0 A;  1RQI A;  2Z52 A;  4OGU A;  5CG5 A;  2AZJ A;  3Q2Q A;  4LPG F;  3WSA A;  4P0W A;  4RXD A;  4LTZ A;  2J5C A;  4HD1 A;  4LIX A;  5DGS F;  1N22 A;  3SAE A;  3M02 A;  2E95 A;  3WCJ A;  4KVY A;  1YYS A;  4RXA A;  1HXG A;  4DWG A;  4JXY A;  3RMG A;  4ZQ8 A;  2E8V A;  1V4I A;  2Q9Z A;  1VG6 A;  5AEL A;  3OAC B;  2AET A;  4KQ5 A;  3CKE A;  3OAC A;  2E8X A;  4QPF A;  1UBY A;  5IVG A;  1KIY A;  1VG4 A;  3BNX A;  2F92 F;  5IL3 A;  5EAT A;  3EFQ A;  2ZCQ A;  2E91 A;  2E93 A;  4LLS A;  4PVX F;  3N5H F;  4OMH A;  4KPD A;  2F7M F;  1DGP A;  3RYW A;  3ZL6 A;  1N23 A;  2DH4 A;  4XQT F;  2H8O A;  5IK6 A;  1N1Z A;  4NG6 A;  4JVJ F;  3WCL A;  4NKF A;  3WCG A;  4NFI F;  5JV0 F;  4N1Z F;  4LFV F;  2J1P A;  3EGT A;  3SDV A;  4WK5 A;  5IM1 A;  1WKZ A;  4P0X A;  2E94 A;  4E9U A;  3TC1 A;  3QKC A;  4GP1 A;  2PS6 A;  2F8Z F;  3KRO B;  4LA6 A;  1N20 A;  3ZMC A;  3ACY A;  5DHI A;  5A0J A;  5A0K A;  2J1O A;  1UBW A;  3M00 A;  5DHK A;  3AE0 A;  3KRA B;  3KRO A;  1RQJ A;  2OPM A;  4DZW A;  3WCI A;  1N21 A;  3ACW A;  3KRA A;  3SDQ A;  3LEE A;  4LLT A;  3NF2 A;  5EAS A;  3N3L F;  3V1X A;  4E9Z A;  3G4F A;  4LUU A;  5ERM A;  3WCA A;  5IN8 A;  4NFJ F;  5B01 A;  4LZ0 A;  3M9U A;  5DGN F;  5IKH A;  2E90 A;  5ILD A;  3WJN A;  3TFP A;  5E8K A;  3PDE A;  5JV1 F;  3Q1O A;  3QQV A;  3TFN A;  1YYR A;  3WJK A;  3OAB B;  1KIZ A;  3ZMB A;  2PS7 A;  4EA2 A;  2OA6 A;  4H5E F;  2ZEV A;  5C05 A;  3OAB A;  4Q23 A;  3KRF B;  3VJE A;  3G4D A;  1ZW5 A;  3ICN A;  2FOR A;  4F6X A;  1N24 A;  5B02 A;  5ER8 A;  3KRF A;  4NUA A;  3WEK A;  1WY0 A;  5JA0 F;  5EAU A;  5AYP A;  4NKE A;  1RTR A;  4LFE A;  3WCB A;  2VF6 A;  3DYH A;  3TS7 A;  5CG6 A;  3P8R A;  2ZEU A;  2I19 A;  2EWG A;  5A0I A;  1YYT A;  3LG5 A;  1EZF A;  4OMG A;  2AEL A;  2PS5 A;  3VJ8 A;  4LZ3 A;  5ILY A;  3ICZ A;  5IMI A;  4DXJ A;  3WEJ A;  2RAH A;  1JFG A;  4JZX A;  3PYB A;  4KK2 A;  2Q80 A;  4H5D F;  2E8W A;  3P8L A;  4KPJ A;  3WEF A;  5ILK A;  2F94 F;  2PS4 A;  5IK9 A;  1WL1 A;  3N0F A;  3ADZ A;  3N6K F;  4JXN A;  3SDT A;  4NFK F;  4PVY F;  1HM7 A;  2Z4Y A;  3N46 F;  3V1V A;  5AHU B;  2E8U A;  1YV5 A;  4LPH F;  3IPI A;  2F8C F;  4KVW A;  5AFX A;  5JUZ F;  2F9K F;  1YYQ A;  2Z4X A;  2P1C A;  5DIQ F;  3SDU A;  3LSN A;  1YYU A;  1UBV A;  3N1V F;  3N5J F;  1UBX A;  2ZY1 A;  4DEM F;  3LOM A;  5HN7 A;  3RBM A;  3VJC A;  5B0J A;  3AQ0 A;  3UCA A;  4FP4 A;  2ZCR A;  3ICM A;  2ZCO A;  5DGM F;  4XQS F;  5IL8 A;  5ILJ A;  1HXA A;  4MC8 A;  1WL3 A;  5DW7 A;  5DZ2 A;  3LGK A;  1HX9 A;  3NPR A;  4RYP A;  4RXE A;  2O1O A;  4EA0 A;  3LDW A;  3EZ3 A;  3P41 A;  2ZCS A;  3M01 A;  5DJP F;  2ONH A;  3RYE A;  4KQS A;  4KUX A;  3S4J A;  1WMW A;  3ACX A;  2AZK A;  4GAX A;  4KVD A;  4KFA A;  1HM4 A;  4KQU A;  3KRC A;  5HNA A;  5DJR F;  2Z4Z A;  3VJA A;  2Z78 A;  2Z50 A;  5ILI A;  5E8H A;  3KRP A;  3WJO A;  5E8L A;  1FPS A;  3W7F A;  3LZ9 A;  4LA5 A;  5DJV F;  3APZ A;  4H5C F;  1YJ4 A;  5B0M A;  1V4E A;  3WCH A;  2Z7H A;  4UMJ A;  3N3D A;  2E4O A;  4RXC A;  5H9D A;  4OKZ A;  3DYG A;  1JFA A;  3CP6 A;  4QXS F;  3VJ9 A;  3WCD A;  3LK5 A;  5B0I A;  3Q30 A;  3VJB A;  3WEG A;  5HN9 A;  1HXC A;  3ZCD A;  3PH7 A;  3WCM A;  3S9V A;  1PS1 A;  3LMD A;  3WEH A;  5B00 A;  3LGZ B;  4JZB A;  2ONG A;  3ZOU A;  1YQ7 A;  3M0G A;  4L2X F;  2Q58 A;  5IMN A;  1VG7 A;  2Z4W A;  3MAV A;  5IKA A;  3WC9 A;  4LZC A;  2Q9Y A;  3SDR A;  2Z4V A;  3N45 F;  2PS8 A;  3ICK A;  2OPN A;  4DWB A;  4GA3 A;  4LXW A;  3MZV A;  3ID0 A;  3V66 A;  3WSB A;  2OGD A;  3KB9 A;  2E8T A;  3TFV A;  4RNQ A;  3NPK A;  3Q2Z A;  2FTZ A;  4N9U A;  3NRI A;  1N1B A;  1YHK A;  1YHM A;  1YHL A;  5I1U A;  1V4H A;  1V4J A;  4FJQ A;  4LOB A;  2Z7I A;  4EA1 A;  3LVS A;  3IBA A;  4LFG A;  3AQC B;  1WL2 A;  3WCF A;  2AEK A;  3AQB B;  3WEI A;  3N0G A;  5ERO A;  5ILH A;  3P5P A;  4KKM A;  1WL0 A;  3KBK A;  4E1E A;  4P0V A;  3WE9 A;  3KRC B;  4DI5 A;  3B7L A;  4MC3 A;  5IMP A;  3OYR A;  5B0L A;  5B0K A;  4DHD A;  5ILZ A;  4K10 A;  5KSX F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...