3LVSA

Crystal structure of farnesyl diphosphate synthase from rhodobacter capsulatus sb1003
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
288
structure length
270
Chain Sequence
SLFSERLKEIQDAVETAMAAAIGRLPAGDLRDAMAYAAQGGKRLRAFLAIESAAIHGISMAQAMPAALAVEALHAYSLVHDDMPCMDNDDLRRGLPTVHKKWDDATAVLAGDALQTLAFELCTDPVLGSAENRVALVAALAQASGAEGMVYGQALDIAAETAAVPLTLDEIIRLQAGKTGALISFAAQAGAILAGADRGPLTAYATALGLAFQIADDILDVEATFVSLLGLAGAKSRAADLVAEAEAALAPYGEAASTLRACARYVIERD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FARNESYL DIPHOSPHATE SYNTHASE
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Rhodobacter capsulatus
total genus 103
structure length 270
sequence length 288
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3lvsA00
2ZCQA 3N5JF 1YYTA 4H5CF 3WEFA 5IMIA 5EROA 1N23A 1N24A 3OACB 1RTRA 5IK0A 3Q2QA 3N1VF 4NFJF 5AFXA 5ILYA 1YYSA 3PH7A 1N1ZA 5IK9A 4LFEA 3KB9A 5DGNF 1YHLA 4LPHF 4DI5A 3AQCB 2Z4YA 2E4OA 4KVDA 1VG4A 2AZJA 4JXNA 3ICMA 4KPJA 3WCMA 2E90A 4F62A 4LZ0A 5ILKA 3WCLA 5IMPA 3EGTA 2OPNA 3VJ8A 4L2XF 3LLWA 1YQ7A 3VJ9A 4KVIA 1WL3A 3MAVA 2PS4A 5DJPF 3LVSA 4XQSF 5A0IA 5ILHA 2E92A 1VG6A 4KUXA 3KROA 2AZKA 3WEIA 5C05A 3PYAA 3WCFA 3WE9A 5ILIA 2E94A 3M9UA 3P8LA 2OA6A 3OABB 2E8VA 3WSBA 2H8OA 5HNAA 3LJIA 4KVYA 4DWBA 2OGDA 1RQIA 1ZW5A 3ZMBA 5ERNA 5B02A 3G4FA 3ICNA 1N20A 1KIYA 2PS6A 4NFKF 3WCAA 1N22A 5EAUA 1VG7A 3LDWA 3KRAB 4LOBA 5HN8A 3CC9A 2Z4WA 4LTZA 2ZY1A 4E1EA 1HXGA 4PVYF 5CG5A 5H9DA 4LXWA 1FPSA 2ZCRA 4NG6A 1V4IA 3EFQA 3APZA 3TS7A 5IL8A 1YHKA 2Z7IA 3WJOA 3M00A 3W7FA 3RBMA 1WL2A 4H5DF 3WEGA 4H5EF 5B0LA 3LMDA 4Q23A 3KRCA 3VJBA 4LUUA 5AYPA 2ZEUA 3N46F 4NFIF 2F8ZF 2PS5A 1KIZA 3WEJA 3P5PA 4HD1A 5EASA 3TC1A 3WCGA 4RXAA 5IK6A 3IPIA 3LG5A 1HM7A 5B03A 3TFNA 3ASXA 3ACYA 4NKEA 3M0GA 4LLSA 4GA3A 3WC9A 2F9KF 3ID0A 3VJCA 5IL3A 2J1PA 3KRFB 3WCEA 4JXYA 3NPRA 3CP6A 3VJDA 5IMNA 5ERMA 3S4JA 2ZCOA 3TFVA 3WCHA 4GP1A 4KVWA 3LGKA 5IN8A 4LTVA 3BNXA 3WEKA 4NUAA 4EA0A 1YYRA 1V4JA 5JUZF 2VF6A 4MC3A 2O1OA 1DI1A 3WCJA 5ILZA 2F94F 3SDTA 4LZCA 5IM1A 1HX9A 5DJRF 3KRPB 5DHIA 1WKZA 1HXCA 5B0KA 2E95A 5DHKA 3RMGA 3WJNA 2J1OA 3OACA 5E8KA 1YHMA 5AELA 3LZ9A 5HN7A 2AELA 3ZMCA 5A0JA 2RAHA 5B00A 5IKAA 4OMHA 1V4HA 2OPMA 2AZLA 2E93A 4LIXA 1WL0A 2E8TA 3BNYA 2I19A 2ONHA 5ILDA 5B01A 1JFGA 3V1XA 5JV1F 2EWGA 2F92F 2Z7HA 3M01A 3NRIA 4DHDA 2FTZA 2E8XA 2Z50A 4OKZA 4DXJA 2Z4VA 3DYHA 4DZWA 2Z52A 3Q30A 3SDUA 5IKHA 1N1BA 1YYQA 1WY0A 4OMGA 4RXCA 3KRFA 4E9ZA 3ZCDA 3WCBA 3WCCA 3WSAA 2Z78A 1N21A 3G4DA 4QPFA 3ACXA 4DEMF 3QQVA 3KBKA 5AHUB 3OYRA 3ICZA 3ZOUA 2E8UA 3P41A 5JA0F 3SDQA 5DGSF 4P0XA 4JVJF 4NKFA 1YJ4A 3P8RA 3KRPA 4OKMA 3WJKA 3RYWA 5KSXF 5JV2F 4DWGA 3N3DA 4WK5A 3V1VA 5IVGA 2PS8A 3ZL6A 3UCAA 5ER8A 3KROB 3N1WF 2PS7A 3N6KF 4KK2A 3OABA 3RYEA 3DYFA 4P0WA 3Q1OA 4KPDA 4LZ3A 4EA1A 1JFAA 2J5CA 4KQUA 4LLTA 4F6XA 3VJEA 1UBYA 2ZCSA 3N45F 4K10A 4QXSF 3SAEA 4N1ZF 4XQRF 4RXDA 5ILJA 4JZXA 3AQ0A 1V4EA 2F89F 5B0IA 3B7LA 3WEHA 3N5HF 1EZFA 4KFAA 2DH4A 3LSNA 4KKMA 4N9UA 3KRAA 2F8CF 5DIQF 4KWDA 4RXEA 1YYUA 3LOMA 5I1UA 3MZVA 3WCDA 5B0JA 3AQBB 3VJAA 4UMJA 4P0VA 2Z4XA 2Q9YA 3AE0A 3N49F 5EATA 5JV0F 2Q80A 3PDEA 3S9VA 5B0MA 1V4KA 2E8WA 4KQ5A 3QKCA 2Z4ZA 3ACWA 2AEKA 4RNQA 4KQSA 3NPKA 3NF2A 3WCIA 4PVXF 4EA2A 3LK5A 5E8LA 4MC0A 3KRCB 3N0GA 5DZ2A 3TFPA 4MC8A 3ADZA 5CG6A 2E91A 3CKEA 3Q2ZA 4F6VA 2P1CA 1VG3A 4FP4A 2AETA 1PS1A 3EZ3A 4XQTF 1RQJA 2Q9ZA 1VG2A 1HXAA 3IBAA 2ZEVA 1UBVA 3DYGA 1HM4A 1YV5A 5DJVF 2FORA 5DGMF 4FJQA 3ICKA 3V66A 3LGZB 3SDRA 4GAXA 4LA5A 3N0FA 4GP2A 1WMWA 4ZQ8A 1WL1A 5DW7A 4JYXA 3LEEA 4LFVF 5A0KA 2Q58A 2ONGA 4JZBA 4LA6A 3SDVA 1UBWA 5E8HA 3PYBA 1DGPA 4E9UA 1UBXA 2QISA 3M02A 3P5RA 4LFGA 4RYPA 3PKOA 4LPGF 4OGUA 2F7MF 5HN9A 3N3LF
chains in the Genus database with same CATH superfamily
2ZCQA 3N5JF 1YYTA 4H5CF 3WEFA 5IMIA 5EROA 1N23A 1N24A 3OACB 1RTRA 5IK0A 3Q2QA 3N1VF 4NFJF 5AFXA 5ILYA 1YYSA 3PH7A 1N1ZA 5IK9A 4LFEA 3KB9A 5DGNF 1YHLA 4LPHF 4DI5A 3AQCB 2Z4YA 2E4OA 4KVDA 1VG4A 2AZJA 4JXNA 3ICMA 4KPJA 3WCMA 2E90A 4F62A 4LZ0A 5ILKA 3WCLA 5IMPA 3EGTA 2OPNA 3VJ8A 4L2XF 3LLWA 1YQ7A 3VJ9A 4KVIA 1WL3A 3MAVA 2PS4A 5DJPF 3LVSA 4XQSF 5A0IA 5ILHA 2E92A 1VG6A 4KUXA 3KROA 2AZKA 3WEIA 5C05A 3PYAA 3WCFA 3WE9A 5ILIA 2E94A 3M9UA 3P8LA 2OA6A 3OABB 2E8VA 3WSBA 2H8OA 5HNAA 3LJIA 4KVYA 4DWBA 2OGDA 1RQIA 1ZW5A 3ZMBA 5ERNA 5B02A 3G4FA 3ICNA 1N20A 1KIYA 2PS6A 4NFKF 3WCAA 1N22A 5EAUA 1VG7A 3LDWA 3KRAB 4LOBA 5HN8A 3CC9A 2Z4WA 4LTZA 2ZY1A 4E1EA 1HXGA 4PVYF 5CG5A 5H9DA 4LXWA 1FPSA 2ZCRA 4NG6A 1V4IA 3EFQA 3APZA 3TS7A 5IL8A 1YHKA 2Z7IA 3WJOA 3M00A 3W7FA 3RBMA 1WL2A 4H5DF 3WEGA 4H5EF 5B0LA 3LMDA 4Q23A 3KRCA 3VJBA 4LUUA 5AYPA 2ZEUA 3N46F 4NFIF 2F8ZF 2PS5A 1KIZA 3WEJA 3P5PA 4HD1A 5EASA 3TC1A 3WCGA 4RXAA 5IK6A 3IPIA 3LG5A 1HM7A 5B03A 3TFNA 3ASXA 3ACYA 4NKEA 3M0GA 4LLSA 4GA3A 3WC9A 2F9KF 3ID0A 3VJCA 5IL3A 2J1PA 3KRFB 3WCEA 4JXYA 3NPRA 3CP6A 3VJDA 5IMNA 5ERMA 3S4JA 2ZCOA 3TFVA 3WCHA 4GP1A 4KVWA 3LGKA 5IN8A 4LTVA 3BNXA 3WEKA 4NUAA 4EA0A 1YYRA 1V4JA 5JUZF 2VF6A 4MC3A 2O1OA 1DI1A 3WCJA 5ILZA 2F94F 3SDTA 4LZCA 5IM1A 1HX9A 5DJRF 3KRPB 5DHIA 1WKZA 1HXCA 5B0KA 2E95A 5DHKA 3RMGA 3WJNA 2J1OA 3OACA 5E8KA 1YHMA 5AELA 3LZ9A 5HN7A 2AELA 3ZMCA 5A0JA 2RAHA 5B00A 5IKAA 4OMHA 1V4HA 2OPMA 2AZLA 2E93A 4LIXA 1WL0A 2E8TA 3BNYA 2I19A 2ONHA 5ILDA 5B01A 1JFGA 3V1XA 5JV1F 2EWGA 2F92F 2Z7HA 3M01A 3NRIA 4DHDA 2FTZA 2E8XA 2Z50A 4OKZA 4DXJA 2Z4VA 3DYHA 4DZWA 2Z52A 3Q30A 3SDUA 5IKHA 1N1BA 1YYQA 1WY0A 4OMGA 4RXCA 3KRFA 4E9ZA 3ZCDA 3WCBA 3WCCA 3WSAA 2Z78A 1N21A 3G4DA 4QPFA 3ACXA 4DEMF 3QQVA 3KBKA 5AHUB 3OYRA 3ICZA 3ZOUA 2E8UA 3P41A 5JA0F 3SDQA 5DGSF 4P0XA 4JVJF 4NKFA 1YJ4A 3P8RA 3KRPA 4OKMA 3WJKA 3RYWA 5KSXF 5JV2F 4DWGA 3N3DA 4WK5A 3V1VA 5IVGA 2PS8A 3ZL6A 3UCAA 5ER8A 3KROB 3N1WF 2PS7A 3N6KF 4KK2A 3OABA 3RYEA 3DYFA 4P0WA 3Q1OA 4KPDA 4LZ3A 4EA1A 1JFAA 2J5CA 4KQUA 4LLTA 4F6XA 3VJEA 1UBYA 2ZCSA 3N45F 4K10A 4QXSF 3SAEA 4N1ZF 4XQRF 4RXDA 5ILJA 4JZXA 3AQ0A 1V4EA 2F89F 5B0IA 3B7LA 3WEHA 3N5HF 1EZFA 4KFAA 2DH4A 3LSNA 4KKMA 4N9UA 3KRAA 2F8CF 5DIQF 4KWDA 4RXEA 1YYUA 3LOMA 5I1UA 3MZVA 3WCDA 5B0JA 3AQBB 3VJAA 4UMJA 4P0VA 2Z4XA 2Q9YA 3AE0A 3N49F 5EATA 5JV0F 2Q80A 3PDEA 3S9VA 5B0MA 1V4KA 2E8WA 4KQ5A 3QKCA 2Z4ZA 3ACWA 2AEKA 4RNQA 4KQSA 3NPKA 3NF2A 3WCIA 4PVXF 4EA2A 3LK5A 5E8LA 4MC0A 3KRCB 3N0GA 5DZ2A 3TFPA 4MC8A 3ADZA 5CG6A 2E91A 3CKEA 3Q2ZA 4F6VA 2P1CA 1VG3A 4FP4A 2AETA 1PS1A 3EZ3A 4XQTF 1RQJA 2Q9ZA 1VG2A 1HXAA 3IBAA 2ZEVA 1UBVA 3DYGA 1HM4A 1YV5A 5DJVF 2FORA 5DGMF 4FJQA 3ICKA 3V66A 3LGZB 3SDRA 4GAXA 4LA5A 3N0FA 4GP2A 1WMWA 4ZQ8A 1WL1A 5DW7A 4JYXA 3LEEA 4LFVF 5A0KA 2Q58A 2ONGA 4JZBA 4LA6A 3SDVA 1UBWA 5E8HA 3PYBA 1DGPA 4E9UA 1UBXA 2QISA 3M02A 3P5RA 4LFGA 4RYPA 3PKOA 4LPGF 4OGUA 2F7MF 5HN9A 3N3LF
chains in the Genus database with same CATH topology
2ZCQA 3N5JF 1YYTA 4H5CF 3WEFA 5IMIA 5EROA 1N23A 1N24A 3OACB 1RTRA 5IK0A 3Q2QA 3N1VF 4NFJF 5AFXA 5ILYA 1YYSA 3PH7A 1N1ZA 5IK9A 4LFEA 3KB9A 5DGNF 1YHLA 4LPHF 4DI5A 3AQCB 2Z4YA 2E4OA 4KVDA 1VG4A 2AZJA 4JXNA 3ICMA 4KPJA 3WCMA 2E90A 4F62A 4LZ0A 5ILKA 3WCLA 5IMPA 3EGTA 2OPNA 3VJ8A 4L2XF 3LLWA 1YQ7A 3VJ9A 4KVIA 1WL3A 3MAVA 2PS4A 5DJPF 3LVSA 4XQSF 5A0IA 5ILHA 2E92A 1VG6A 4KUXA 3KROA 2AZKA 3WEIA 5C05A 3PYAA 3WCFA 3WE9A 5ILIA 2E94A 3M9UA 3P8LA 2OA6A 3OABB 2E8VA 3WSBA 2H8OA 5HNAA 3LJIA 4KVYA 4DWBA 2OGDA 1RQIA 1ZW5A 3ZMBA 5ERNA 5B02A 3G4FA 3ICNA 1N20A 1KIYA 2PS6A 4NFKF 3WCAA 1N22A 5EAUA 1VG7A 3LDWA 3KRAB 4LOBA 5HN8A 3CC9A 2Z4WA 4LTZA 2ZY1A 4E1EA 1HXGA 4PVYF 5CG5A 5H9DA 4LXWA 1FPSA 2ZCRA 4NG6A 1V4IA 3EFQA 3APZA 3TS7A 5IL8A 1YHKA 2Z7IA 3WJOA 3M00A 3W7FA 3RBMA 1WL2A 4H5DF 3WEGA 4H5EF 5B0LA 3LMDA 4Q23A 3KRCA 3VJBA 4LUUA 5AYPA 2ZEUA 3N46F 4NFIF 2F8ZF 2PS5A 1KIZA 3WEJA 3P5PA 4HD1A 5EASA 3TC1A 3WCGA 4RXAA 5IK6A 3IPIA 3LG5A 1HM7A 5B03A 3TFNA 3ASXA 3ACYA 4NKEA 3M0GA 4LLSA 4GA3A 3WC9A 2F9KF 3ID0A 3VJCA 5IL3A 2J1PA 3KRFB 3WCEA 4JXYA 3NPRA 3CP6A 3VJDA 5IMNA 5ERMA 3S4JA 2ZCOA 3TFVA 3WCHA 4GP1A 4KVWA 3LGKA 5IN8A 4LTVA 3BNXA 3WEKA 4NUAA 4EA0A 1YYRA 1V4JA 5JUZF 2VF6A 4MC3A 2O1OA 1DI1A 3WCJA 5ILZA 2F94F 3SDTA 4LZCA 5IM1A 1HX9A 5DJRF 3KRPB 5DHIA 1WKZA 1HXCA 5B0KA 2E95A 5DHKA 3RMGA 3WJNA 2J1OA 3OACA 5E8KA 1YHMA 5AELA 3LZ9A 5HN7A 2AELA 3ZMCA 5A0JA 2RAHA 5B00A 5IKAA 4OMHA 1V4HA 2OPMA 2AZLA 2E93A 4LIXA 1WL0A 2E8TA 3BNYA 2I19A 2ONHA 5ILDA 5B01A 1JFGA 3V1XA 5JV1F 2EWGA 2F92F 2Z7HA 3M01A 3NRIA 4DHDA 2FTZA 2E8XA 2Z50A 4OKZA 4DXJA 2Z4VA 3DYHA 4DZWA 2Z52A 3Q30A 3SDUA 5IKHA 1N1BA 1YYQA 1WY0A 4OMGA 4RXCA 3KRFA 4E9ZA 3ZCDA 3WCBA 3WCCA 3WSAA 2Z78A 1N21A 3G4DA 4QPFA 3ACXA 4DEMF 3QQVA 3KBKA 5AHUB 3OYRA 3ICZA 3ZOUA 2E8UA 3P41A 5JA0F 3SDQA 5DGSF 4P0XA 4JVJF 4NKFA 1YJ4A 3P8RA 3KRPA 4OKMA 3WJKA 3RYWA 5KSXF 5JV2F 4DWGA 3N3DA 4WK5A 3V1VA 5IVGA 2PS8A 3ZL6A 3UCAA 5ER8A 3KROB 3N1WF 2PS7A 3N6KF 4KK2A 3OABA 3RYEA 3DYFA 4P0WA 3Q1OA 4KPDA 4LZ3A 4EA1A 1JFAA 2J5CA 4KQUA 4LLTA 4F6XA 3VJEA 1UBYA 2ZCSA 3N45F 4K10A 4QXSF 3SAEA 4N1ZF 4XQRF 4RXDA 5ILJA 4JZXA 3AQ0A 1V4EA 2F89F 5B0IA 3B7LA 3WEHA 3N5HF 1EZFA 4KFAA 2DH4A 3LSNA 4KKMA 4N9UA 3KRAA 2F8CF 5DIQF 4KWDA 4RXEA 1YYUA 3LOMA 5I1UA 3MZVA 3WCDA 5B0JA 3AQBB 3VJAA 4UMJA 4P0VA 2Z4XA 2Q9YA 3AE0A 3N49F 5EATA 5JV0F 2Q80A 3PDEA 3S9VA 5B0MA 1V4KA 2E8WA 4KQ5A 3QKCA 2Z4ZA 3ACWA 2AEKA 4RNQA 4KQSA 3NPKA 3NF2A 3WCIA 4PVXF 4EA2A 3LK5A 5E8LA 4MC0A 3KRCB 3N0GA 5DZ2A 3TFPA 4MC8A 3ADZA 5CG6A 2E91A 3CKEA 3Q2ZA 4F6VA 2P1CA 1VG3A 4FP4A 2AETA 1PS1A 3EZ3A 4XQTF 1RQJA 2Q9ZA 1VG2A 1HXAA 3IBAA 2ZEVA 1UBVA 3DYGA 1HM4A 1YV5A 5DJVF 2FORA 5DGMF 4FJQA 3ICKA 3V66A 3LGZB 3SDRA 4GAXA 4LA5A 3N0FA 4GP2A 1WMWA 4ZQ8A 1WL1A 5DW7A 4JYXA 3LEEA 4LFVF 5A0KA 2Q58A 2ONGA 4JZBA 4LA6A 3SDVA 1UBWA 5E8HA 3PYBA 1DGPA 4E9UA 1UBXA 2QISA 3M02A 3P5RA 4LFGA 4RYPA 3PKOA 4LPGF 4OGUA 2F7MF 5HN9A 3N3LF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCQ A;  3N5J F;  1YYT A;  4H5C F;  3WEF A;  5IMI A;  5ERO A;  1N23 A;  1N24 A;  3OAC B;  1RTR A;  5IK0 A;  3Q2Q A;  3N1V F;  4NFJ F;  5AFX A;  5ILY A;  1YYS A;  3PH7 A;  1N1Z A;  5IK9 A;  4LFE A;  3KB9 A;  5DGN F;  1YHL A;  4LPH F;  4DI5 A;  3AQC B;  2Z4Y A;  2E4O A;  4KVD A;  1VG4 A;  2AZJ A;  4JXN A;  3ICM A;  4KPJ A;  3WCM A;  2E90 A;  4F62 A;  4LZ0 A;  5ILK A;  3WCL A;  5IMP A;  3EGT A;  2OPN A;  3VJ8 A;  4L2X F;  3LLW A;  1YQ7 A;  3VJ9 A;  4KVI A;  1WL3 A;  3MAV A;  2PS4 A;  5DJP F;  3LVS A;  4XQS F;  5A0I A;  5ILH A;  2E92 A;  1VG6 A;  4KUX A;  3KRO A;  2AZK A;  3WEI A;  5C05 A;  3PYA A;  3WCF A;  3WE9 A;  5ILI A;  2E94 A;  3M9U A;  3P8L A;  2OA6 A;  3OAB B;  2E8V A;  3WSB A;  2H8O A;  5HNA A;  3LJI A;  4KVY A;  4DWB A;  2OGD A;  1RQI A;  1ZW5 A;  3ZMB A;  5ERN A;  5B02 A;  3G4F A;  3ICN A;  1N20 A;  1KIY A;  2PS6 A;  4NFK F;  3WCA A;  1N22 A;  5EAU A;  1VG7 A;  3LDW A;  3KRA B;  4LOB A;  5HN8 A;  3CC9 A;  2Z4W A;  4LTZ A;  2ZY1 A;  4E1E A;  1HXG A;  4PVY F;  5CG5 A;  5H9D A;  4LXW A;  1FPS A;  2ZCR A;  4NG6 A;  1V4I A;  3EFQ A;  3APZ A;  3TS7 A;  5IL8 A;  1YHK A;  2Z7I A;  3WJO A;  3M00 A;  3W7F A;  3RBM A;  1WL2 A;  4H5D F;  3WEG A;  4H5E F;  5B0L A;  3LMD A;  4Q23 A;  3KRC A;  3VJB A;  4LUU A;  5AYP A;  2ZEU A;  3N46 F;  4NFI F;  2F8Z F;  2PS5 A;  1KIZ A;  3WEJ A;  3P5P A;  4HD1 A;  5EAS A;  3TC1 A;  3WCG A;  4RXA A;  5IK6 A;  3IPI A;  3LG5 A;  1HM7 A;  5B03 A;  3TFN A;  3ASX A;  3ACY A;  4NKE A;  3M0G A;  4LLS A;  4GA3 A;  3WC9 A;  2F9K F;  3ID0 A;  3VJC A;  5IL3 A;  2J1P A;  3KRF B;  3WCE A;  4JXY A;  3NPR A;  3CP6 A;  3VJD A;  5IMN A;  5ERM A;  3S4J A;  2ZCO A;  3TFV A;  3WCH A;  4GP1 A;  4KVW A;  3LGK A;  5IN8 A;  4LTV A;  3BNX A;  3WEK A;  4NUA A;  4EA0 A;  1YYR A;  1V4J A;  5JUZ F;  2VF6 A;  4MC3 A;  2O1O A;  1DI1 A;  3WCJ A;  5ILZ A;  2F94 F;  3SDT A;  4LZC A;  5IM1 A;  1HX9 A;  5DJR F;  3KRP B;  5DHI A;  1WKZ A;  1HXC A;  5B0K A;  2E95 A;  5DHK A;  3RMG A;  3WJN A;  2J1O A;  3OAC A;  5E8K A;  1YHM A;  5AEL A;  3LZ9 A;  5HN7 A;  2AEL A;  3ZMC A;  5A0J A;  2RAH A;  5B00 A;  5IKA A;  4OMH A;  1V4H A;  2OPM A;  2AZL A;  2E93 A;  4LIX A;  1WL0 A;  2E8T A;  3BNY A;  2I19 A;  2ONH A;  5ILD A;  5B01 A;  1JFG A;  3V1X A;  5JV1 F;  2EWG A;  2F92 F;  2Z7H A;  3M01 A;  3NRI A;  4DHD A;  2FTZ A;  2E8X A;  2Z50 A;  4OKZ A;  4DXJ A;  2Z4V A;  3DYH A;  4DZW A;  2Z52 A;  3Q30 A;  3SDU A;  5IKH A;  1N1B A;  1YYQ A;  1WY0 A;  4OMG A;  4RXC A;  3KRF A;  4E9Z A;  3ZCD A;  3WCB A;  3WCC A;  3WSA A;  2Z78 A;  1N21 A;  3G4D A;  4QPF A;  3ACX A;  4DEM F;  3QQV A;  3KBK A;  5AHU B;  3OYR A;  3ICZ A;  3ZOU A;  2E8U A;  3P41 A;  5JA0 F;  3SDQ A;  5DGS F;  4P0X A;  4JVJ F;  4NKF A;  1YJ4 A;  3P8R A;  3KRP A;  4OKM A;  3WJK A;  3RYW A;  5KSX F;  5JV2 F;  4DWG A;  3N3D A;  4WK5 A;  3V1V A;  5IVG A;  2PS8 A;  3ZL6 A;  3UCA A;  5ER8 A;  3KRO B;  3N1W F;  2PS7 A;  3N6K F;  4KK2 A;  3OAB A;  3RYE A;  3DYF A;  4P0W A;  3Q1O A;  4KPD A;  4LZ3 A;  4EA1 A;  1JFA A;  2J5C A;  4KQU A;  4LLT A;  4F6X A;  3VJE A;  1UBY A;  2ZCS A;  3N45 F;  4K10 A;  4QXS F;  3SAE A;  4N1Z F;  4XQR F;  4RXD A;  5ILJ A;  4JZX A;  3AQ0 A;  1V4E A;  2F89 F;  5B0I A;  3B7L A;  3WEH A;  3N5H F;  1EZF A;  4KFA A;  2DH4 A;  3LSN A;  4KKM A;  4N9U A;  3KRA A;  2F8C F;  5DIQ F;  4KWD A;  4RXE A;  1YYU A;  3LOM A;  5I1U A;  3MZV A;  3WCD A;  5B0J A;  3AQB B;  3VJA A;  4UMJ A;  4P0V A;  2Z4X A;  2Q9Y A;  3AE0 A;  3N49 F;  5EAT A;  5JV0 F;  2Q80 A;  3PDE A;  3S9V A;  5B0M A;  1V4K A;  2E8W A;  4KQ5 A;  3QKC A;  2Z4Z A;  3ACW A;  2AEK A;  4RNQ A;  4KQS A;  3NPK A;  3NF2 A;  3WCI A;  4PVX F;  4EA2 A;  3LK5 A;  5E8L A;  4MC0 A;  3KRC B;  3N0G A;  5DZ2 A;  3TFP A;  4MC8 A;  3ADZ A;  5CG6 A;  2E91 A;  3CKE A;  3Q2Z A;  4F6V A;  2P1C A;  1VG3 A;  4FP4 A;  2AET A;  1PS1 A;  3EZ3 A;  4XQT F;  1RQJ A;  2Q9Z A;  1VG2 A;  1HXA A;  3IBA A;  2ZEV A;  1UBV A;  3DYG A;  1HM4 A;  1YV5 A;  5DJV F;  2FOR A;  5DGM F;  4FJQ A;  3ICK A;  3V66 A;  3LGZ B;  3SDR A;  4GAX A;  4LA5 A;  3N0F A;  4GP2 A;  1WMW A;  4ZQ8 A;  1WL1 A;  5DW7 A;  4JYX A;  3LEE A;  4LFV F;  5A0K A;  2Q58 A;  2ONG A;  4JZB A;  4LA6 A;  3SDV A;  1UBW A;  5E8H A;  3PYB A;  1DGP A;  4E9U A;  1UBX A;  2QIS A;  3M02 A;  3P5R A;  4LFG A;  4RYP A;  3PKO A;  4LPG F;  4OGU A;  2F7M F;  5HN9 A;  3N3L F; 
#chains in the Genus database with same CATH topology
 2ZCQ A;  3N5J F;  1YYT A;  4H5C F;  3WEF A;  5IMI A;  5ERO A;  1N23 A;  1N24 A;  3OAC B;  1RTR A;  5IK0 A;  3Q2Q A;  3N1V F;  4NFJ F;  5AFX A;  5ILY A;  1YYS A;  3PH7 A;  1N1Z A;  5IK9 A;  4LFE A;  3KB9 A;  5DGN F;  1YHL A;  4LPH F;  4DI5 A;  3AQC B;  2Z4Y A;  2E4O A;  4KVD A;  1VG4 A;  2AZJ A;  4JXN A;  3ICM A;  4KPJ A;  3WCM A;  2E90 A;  4F62 A;  4LZ0 A;  5ILK A;  3WCL A;  5IMP A;  3EGT A;  2OPN A;  3VJ8 A;  4L2X F;  3LLW A;  1YQ7 A;  3VJ9 A;  4KVI A;  1WL3 A;  3MAV A;  2PS4 A;  5DJP F;  3LVS A;  4XQS F;  5A0I A;  5ILH A;  2E92 A;  1VG6 A;  4KUX A;  3KRO A;  2AZK A;  3WEI A;  5C05 A;  3PYA A;  3WCF A;  3WE9 A;  5ILI A;  2E94 A;  3M9U A;  3P8L A;  2OA6 A;  3OAB B;  2E8V A;  3WSB A;  2H8O A;  5HNA A;  3LJI A;  4KVY A;  4DWB A;  2OGD A;  1RQI A;  1ZW5 A;  3ZMB A;  5ERN A;  5B02 A;  3G4F A;  3ICN A;  1N20 A;  1KIY A;  2PS6 A;  4NFK F;  3WCA A;  1N22 A;  5EAU A;  1VG7 A;  3LDW A;  3KRA B;  4LOB A;  5HN8 A;  3CC9 A;  2Z4W A;  4LTZ A;  2ZY1 A;  4E1E A;  1HXG A;  4PVY F;  5CG5 A;  5H9D A;  4LXW A;  1FPS A;  2ZCR A;  4NG6 A;  1V4I A;  3EFQ A;  3APZ A;  3TS7 A;  5IL8 A;  1YHK A;  2Z7I A;  3WJO A;  3M00 A;  3W7F A;  3RBM A;  1WL2 A;  4H5D F;  3WEG A;  4H5E F;  5B0L A;  3LMD A;  4Q23 A;  3KRC A;  3VJB A;  4LUU A;  5AYP A;  2ZEU A;  3N46 F;  4NFI F;  2F8Z F;  2PS5 A;  1KIZ A;  3WEJ A;  3P5P A;  4HD1 A;  5EAS A;  3TC1 A;  3WCG A;  4RXA A;  5IK6 A;  3IPI A;  3LG5 A;  1HM7 A;  5B03 A;  3TFN A;  3ASX A;  3ACY A;  4NKE A;  3M0G A;  4LLS A;  4GA3 A;  3WC9 A;  2F9K F;  3ID0 A;  3VJC A;  5IL3 A;  2J1P A;  3KRF B;  3WCE A;  4JXY A;  3NPR A;  3CP6 A;  3VJD A;  5IMN A;  5ERM A;  3S4J A;  2ZCO A;  3TFV A;  3WCH A;  4GP1 A;  4KVW A;  3LGK A;  5IN8 A;  4LTV A;  3BNX A;  3WEK A;  4NUA A;  4EA0 A;  1YYR A;  1V4J A;  5JUZ F;  2VF6 A;  4MC3 A;  2O1O A;  1DI1 A;  3WCJ A;  5ILZ A;  2F94 F;  3SDT A;  4LZC A;  5IM1 A;  1HX9 A;  5DJR F;  3KRP B;  5DHI A;  1WKZ A;  1HXC A;  5B0K A;  2E95 A;  5DHK A;  3RMG A;  3WJN A;  2J1O A;  3OAC A;  5E8K A;  1YHM A;  5AEL A;  3LZ9 A;  5HN7 A;  2AEL A;  3ZMC A;  5A0J A;  2RAH A;  5B00 A;  5IKA A;  4OMH A;  1V4H A;  2OPM A;  2AZL A;  2E93 A;  4LIX A;  1WL0 A;  2E8T A;  3BNY A;  2I19 A;  2ONH A;  5ILD A;  5B01 A;  1JFG A;  3V1X A;  5JV1 F;  2EWG A;  2F92 F;  2Z7H A;  3M01 A;  3NRI A;  4DHD A;  2FTZ A;  2E8X A;  2Z50 A;  4OKZ A;  4DXJ A;  2Z4V A;  3DYH A;  4DZW A;  2Z52 A;  3Q30 A;  3SDU A;  5IKH A;  1N1B A;  1YYQ A;  1WY0 A;  4OMG A;  4RXC A;  3KRF A;  4E9Z A;  3ZCD A;  3WCB A;  3WCC A;  3WSA A;  2Z78 A;  1N21 A;  3G4D A;  4QPF A;  3ACX A;  4DEM F;  3QQV A;  3KBK A;  5AHU B;  3OYR A;  3ICZ A;  3ZOU A;  2E8U A;  3P41 A;  5JA0 F;  3SDQ A;  5DGS F;  4P0X A;  4JVJ F;  4NKF A;  1YJ4 A;  3P8R A;  3KRP A;  4OKM A;  3WJK A;  3RYW A;  5KSX F;  5JV2 F;  4DWG A;  3N3D A;  4WK5 A;  3V1V A;  5IVG A;  2PS8 A;  3ZL6 A;  3UCA A;  5ER8 A;  3KRO B;  3N1W F;  2PS7 A;  3N6K F;  4KK2 A;  3OAB A;  3RYE A;  3DYF A;  4P0W A;  3Q1O A;  4KPD A;  4LZ3 A;  4EA1 A;  1JFA A;  2J5C A;  4KQU A;  4LLT A;  4F6X A;  3VJE A;  1UBY A;  2ZCS A;  3N45 F;  4K10 A;  4QXS F;  3SAE A;  4N1Z F;  4XQR F;  4RXD A;  5ILJ A;  4JZX A;  3AQ0 A;  1V4E A;  2F89 F;  5B0I A;  3B7L A;  3WEH A;  3N5H F;  1EZF A;  4KFA A;  2DH4 A;  3LSN A;  4KKM A;  4N9U A;  3KRA A;  2F8C F;  5DIQ F;  4KWD A;  4RXE A;  1YYU A;  3LOM A;  5I1U A;  3MZV A;  3WCD A;  5B0J A;  3AQB B;  3VJA A;  4UMJ A;  4P0V A;  2Z4X A;  2Q9Y A;  3AE0 A;  3N49 F;  5EAT A;  5JV0 F;  2Q80 A;  3PDE A;  3S9V A;  5B0M A;  1V4K A;  2E8W A;  4KQ5 A;  3QKC A;  2Z4Z A;  3ACW A;  2AEK A;  4RNQ A;  4KQS A;  3NPK A;  3NF2 A;  3WCI A;  4PVX F;  4EA2 A;  3LK5 A;  5E8L A;  4MC0 A;  3KRC B;  3N0G A;  5DZ2 A;  3TFP A;  4MC8 A;  3ADZ A;  5CG6 A;  2E91 A;  3CKE A;  3Q2Z A;  4F6V A;  2P1C A;  1VG3 A;  4FP4 A;  2AET A;  1PS1 A;  3EZ3 A;  4XQT F;  1RQJ A;  2Q9Z A;  1VG2 A;  1HXA A;  3IBA A;  2ZEV A;  1UBV A;  3DYG A;  1HM4 A;  1YV5 A;  5DJV F;  2FOR A;  5DGM F;  4FJQ A;  3ICK A;  3V66 A;  3LGZ B;  3SDR A;  4GAX A;  4LA5 A;  3N0F A;  4GP2 A;  1WMW A;  4ZQ8 A;  1WL1 A;  5DW7 A;  4JYX A;  3LEE A;  4LFV F;  5A0K A;  2Q58 A;  2ONG A;  4JZB A;  4LA6 A;  3SDV A;  1UBW A;  5E8H A;  3PYB A;  1DGP A;  4E9U A;  1UBX A;  2QIS A;  3M02 A;  3P5R A;  4LFG A;  4RYP A;  3PKO A;  4LPG F;  4OGU A;  2F7M F;  5HN9 A;  3N3L F; 
#chains in the Genus database with same CATH homology
 2ZCQ A;  3N5J F;  1YYT A;  4H5C F;  3WEF A;  5IMI A;  5ERO A;  1N23 A;  1N24 A;  3OAC B;  1RTR A;  5IK0 A;  3Q2Q A;  3N1V F;  4NFJ F;  5AFX A;  5ILY A;  1YYS A;  3PH7 A;  1N1Z A;  5IK9 A;  4LFE A;  3KB9 A;  5DGN F;  1YHL A;  4LPH F;  4DI5 A;  3AQC B;  2Z4Y A;  2E4O A;  4KVD A;  1VG4 A;  2AZJ A;  4JXN A;  3ICM A;  4KPJ A;  3WCM A;  2E90 A;  4F62 A;  4LZ0 A;  5ILK A;  3WCL A;  5IMP A;  3EGT A;  2OPN A;  3VJ8 A;  4L2X F;  3LLW A;  1YQ7 A;  3VJ9 A;  4KVI A;  1WL3 A;  3MAV A;  2PS4 A;  5DJP F;  3LVS A;  4XQS F;  5A0I A;  5ILH A;  2E92 A;  1VG6 A;  4KUX A;  3KRO A;  2AZK A;  3WEI A;  5C05 A;  3PYA A;  3WCF A;  3WE9 A;  5ILI A;  2E94 A;  3M9U A;  3P8L A;  2OA6 A;  3OAB B;  2E8V A;  3WSB A;  2H8O A;  5HNA A;  3LJI A;  4KVY A;  4DWB A;  2OGD A;  1RQI A;  1ZW5 A;  3ZMB A;  5ERN A;  5B02 A;  3G4F A;  3ICN A;  1N20 A;  1KIY A;  2PS6 A;  4NFK F;  3WCA A;  1N22 A;  5EAU A;  1VG7 A;  3LDW A;  3KRA B;  4LOB A;  5HN8 A;  3CC9 A;  2Z4W A;  4LTZ A;  2ZY1 A;  4E1E A;  1HXG A;  4PVY F;  5CG5 A;  5H9D A;  4LXW A;  1FPS A;  2ZCR A;  4NG6 A;  1V4I A;  3EFQ A;  3APZ A;  3TS7 A;  5IL8 A;  1YHK A;  2Z7I A;  3WJO A;  3M00 A;  3W7F A;  3RBM A;  1WL2 A;  4H5D F;  3WEG A;  4H5E F;  5B0L A;  3LMD A;  4Q23 A;  3KRC A;  3VJB A;  4LUU A;  5AYP A;  2ZEU A;  3N46 F;  4NFI F;  2F8Z F;  2PS5 A;  1KIZ A;  3WEJ A;  3P5P A;  4HD1 A;  5EAS A;  3TC1 A;  3WCG A;  4RXA A;  5IK6 A;  3IPI A;  3LG5 A;  1HM7 A;  5B03 A;  3TFN A;  3ASX A;  3ACY A;  4NKE A;  3M0G A;  4LLS A;  4GA3 A;  3WC9 A;  2F9K F;  3ID0 A;  3VJC A;  5IL3 A;  2J1P A;  3KRF B;  3WCE A;  4JXY A;  3NPR A;  3CP6 A;  3VJD A;  5IMN A;  5ERM A;  3S4J A;  2ZCO A;  3TFV A;  3WCH A;  4GP1 A;  4KVW A;  3LGK A;  5IN8 A;  4LTV A;  3BNX A;  3WEK A;  4NUA A;  4EA0 A;  1YYR A;  1V4J A;  5JUZ F;  2VF6 A;  4MC3 A;  2O1O A;  1DI1 A;  3WCJ A;  5ILZ A;  2F94 F;  3SDT A;  4LZC A;  5IM1 A;  1HX9 A;  5DJR F;  3KRP B;  5DHI A;  1WKZ A;  1HXC A;  5B0K A;  2E95 A;  5DHK A;  3RMG A;  3WJN A;  2J1O A;  3OAC A;  5E8K A;  1YHM A;  5AEL A;  3LZ9 A;  5HN7 A;  2AEL A;  3ZMC A;  5A0J A;  2RAH A;  5B00 A;  5IKA A;  4OMH A;  1V4H A;  2OPM A;  2AZL A;  2E93 A;  4LIX A;  1WL0 A;  2E8T A;  3BNY A;  2I19 A;  2ONH A;  5ILD A;  5B01 A;  1JFG A;  3V1X A;  5JV1 F;  2EWG A;  2F92 F;  2Z7H A;  3M01 A;  3NRI A;  4DHD A;  2FTZ A;  2E8X A;  2Z50 A;  4OKZ A;  4DXJ A;  2Z4V A;  3DYH A;  4DZW A;  2Z52 A;  3Q30 A;  3SDU A;  5IKH A;  1N1B A;  1YYQ A;  1WY0 A;  4OMG A;  4RXC A;  3KRF A;  4E9Z A;  3ZCD A;  3WCB A;  3WCC A;  3WSA A;  2Z78 A;  1N21 A;  3G4D A;  4QPF A;  3ACX A;  4DEM F;  3QQV A;  3KBK A;  5AHU B;  3OYR A;  3ICZ A;  3ZOU A;  2E8U A;  3P41 A;  5JA0 F;  3SDQ A;  5DGS F;  4P0X A;  4JVJ F;  4NKF A;  1YJ4 A;  3P8R A;  3KRP A;  4OKM A;  3WJK A;  3RYW A;  5KSX F;  5JV2 F;  4DWG A;  3N3D A;  4WK5 A;  3V1V A;  5IVG A;  2PS8 A;  3ZL6 A;  3UCA A;  5ER8 A;  3KRO B;  3N1W F;  2PS7 A;  3N6K F;  4KK2 A;  3OAB A;  3RYE A;  3DYF A;  4P0W A;  3Q1O A;  4KPD A;  4LZ3 A;  4EA1 A;  1JFA A;  2J5C A;  4KQU A;  4LLT A;  4F6X A;  3VJE A;  1UBY A;  2ZCS A;  3N45 F;  4K10 A;  4QXS F;  3SAE A;  4N1Z F;  4XQR F;  4RXD A;  5ILJ A;  4JZX A;  3AQ0 A;  1V4E A;  2F89 F;  5B0I A;  3B7L A;  3WEH A;  3N5H F;  1EZF A;  4KFA A;  2DH4 A;  3LSN A;  4KKM A;  4N9U A;  3KRA A;  2F8C F;  5DIQ F;  4KWD A;  4RXE A;  1YYU A;  3LOM A;  5I1U A;  3MZV A;  3WCD A;  5B0J A;  3AQB B;  3VJA A;  4UMJ A;  4P0V A;  2Z4X A;  2Q9Y A;  3AE0 A;  3N49 F;  5EAT A;  5JV0 F;  2Q80 A;  3PDE A;  3S9V A;  5B0M A;  1V4K A;  2E8W A;  4KQ5 A;  3QKC A;  2Z4Z A;  3ACW A;  2AEK A;  4RNQ A;  4KQS A;  3NPK A;  3NF2 A;  3WCI A;  4PVX F;  4EA2 A;  3LK5 A;  5E8L A;  4MC0 A;  3KRC B;  3N0G A;  5DZ2 A;  3TFP A;  4MC8 A;  3ADZ A;  5CG6 A;  2E91 A;  3CKE A;  3Q2Z A;  4F6V A;  2P1C A;  1VG3 A;  4FP4 A;  2AET A;  1PS1 A;  3EZ3 A;  4XQT F;  1RQJ A;  2Q9Z A;  1VG2 A;  1HXA A;  3IBA A;  2ZEV A;  1UBV A;  3DYG A;  1HM4 A;  1YV5 A;  5DJV F;  2FOR A;  5DGM F;  4FJQ A;  3ICK A;  3V66 A;  3LGZ B;  3SDR A;  4GAX A;  4LA5 A;  3N0F A;  4GP2 A;  1WMW A;  4ZQ8 A;  1WL1 A;  5DW7 A;  4JYX A;  3LEE A;  4LFV F;  5A0K A;  2Q58 A;  2ONG A;  4JZB A;  4LA6 A;  3SDV A;  1UBW A;  5E8H A;  3PYB A;  1DGP A;  4E9U A;  1UBX A;  2QIS A;  3M02 A;  3P5R A;  4LFG A;  4RYP A;  3PKO A;  4LPG F;  4OGU A;  2F7M F;  5HN9 A;  3N3L F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...