5IMIA

Crystal structure of s303a aspergillus terreus aristolochene synthase complexed with (1s,8s,9ar)-1,9a-dimethyl-8-(prop-1-en-2-yl)decahydroquinolizin-5-ium
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
306
structure length
306
Chain Sequence
LEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGILCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWAQTTLRYSVVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase/lyase inhibitor
molecule keywords Aristolochene synthase
publication title Probing the Role of Active Site Water in the Sesquiterpene Cyclization Reaction Catalyzed by Aristolochene Synthase.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 127
structure length 306
sequence length 306
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2016-03-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5imiA00
1VG2A 4LZCA 2E8UA 3KBKA 1VG7A 1HXAA 5ILZA 2DH4A 4RXCA 4F6XA 3WJOA 5A0KA 4NFJF 3RYEA 2AZKA 3WCFA 2PS7A 4LXWA 3G4FA 4JVJF 3Q1OA 2Z50A 1YYTA 3KRCB 2ONHA 3LZ9A 1WL0A 3ICZA 2F8CF 2QISA 3UCAA 4RXAA 3ZMCA 2F9KF 4GP1A 4KUXA 2ZEVA 3AQBB 2VF6A 2E4OA 4JZBA 3S4JA 3P5RA 4F62A 4JYXA 1WL1A 3CC9A 3PYBA 3LLWA 5IN8A 4LZ3A 3V1VA 1UBWA 3M9UA 3EGTA 2O1OA 5DJPF 3WEFA 4H5DF 3WCLA 3WCHA 5ILJA 5DW7A 1V4KA 4GP2A 5ERMA 3N6KF 3ADZA 5JV0F 3NRIA 5E8LA 1V4JA 3NPRA 4UMJA 5IVGA 4H5EF 5B03A 4KK2A 4JZXA 4P0XA 4N9UA 5B0MA 3N5HF 4N1ZF 5E8HA 4EA0A 2E8XA 3WC9A 2AETA 3SDUA 3ID0A 4LFGA 2F7MF 3OACA 5H9DA 3WEHA 3V66A 2J1PA 3WSAA 4EA1A 4LTVA 4L2XF 2Q58A 3N3LF 5JV2F 3ACWA 2F92F 4HD1A 5EATA 2E95A 1HX9A 4OKZA 2Z4YA 4XQRF 1V4IA 4LLSA 1N20A 1WL3A 2PS6A 3WSBA 3LDWA 3TS7A 5IMNA 3Q30A 4LFEA 3IBAA 5IK0A 4JXYA 4NUAA 3N3DA 3V1XA 4KPJA 1YYQA 3LOMA 2J5CA 3QKCA 5AHUB 3AQCB 3M01A 4FP4A 3TFVA 4KVDA 4MC8A 5B02A 4P0VA 5HN9A 3LMDA 3NF2A 3WCBA 3RMGA 1PS1A 1RQIA 3LG5A 5DZ2A 1V4EA 3ZOUA 3B7LA 3N5JF 1DI1A 4LIXA 2Q9ZA 1N1ZA 5I1UA 2OPMA 3ICMA 3TFNA 2ONGA 3KROA 2E91A 4E9UA 5IL3A 3G4DA 1YQ7A 5ILKA 3P5PA 1UBXA 2Z52A 3WEIA 5JUZF 3VJ8A 2FTZA 3EZ3A 5CG6A 2PS5A 2E8TA 3VJCA 3KRPA 1RQJA 4NKFA 2J1OA 3DYGA 4DI5A 3KRFB 4LZ0A 2F8ZF 3OACB 4KQ5A 3DYHA 4NKEA 4MC3A 2Q80A 3WEKA 3P8LA 2E92A 4KWDA 4RNQA 2OA6A 4ZQ8A 5CG5A 5AELA 5AYPA 3ICKA 3WJKA 1HM7A 5IMIA 5B0JA 2FORA 3KRAB 3PKOA 3APZA 3LSNA 5A0JA 2E93A 3VJEA 3WCGA 1YYRA 2AZJA 3Q2QA 4WK5A 3SDQA 2ZY1A 3M0GA 2Z4XA 5B0LA 5DHKA 3WE9A 1RTRA 3Q2ZA 4LUUA 5ILHA 2ZCSA 4LA6A 4OMHA 3P8RA 5HN7A 5IL8A 3S9VA 5DGMF 3WCAA 4QPFA 1DGPA 3LVSA 5HNAA 3NPKA 2AEKA 3M00A 3N0GA 3CKEA 4MC0A 4JXNA 2ZEUA 3WCIA 3N1WF 2E8VA 3BNYA 5KSXF 2Z7IA 4GAXA 5EAUA 1N23A 1FPSA 2E94A 4K10A 3ACXA 3KROB 4XQTF 3SDTA 1VG3A 3LGZB 2E8WA 5E8KA 4LPGF 5ILYA 5DGNF 1WMWA 1YJ4A 1YYUA 3PDEA 4LLTA 5B0KA 3SDRA 4DEMF 5IKAA 3CP6A 3VJ9A 3KRPB 1YHMA 5C05A 3WCCA 3OABA 3AE0A 1UBYA 4NFIF 5A0IA 4NFKF 4OMGA 3N46F 5DHIA 1WKZA 5ILIA 3PYAA 3AQ0A 4FJQA 2ZCRA 4Q23A 4E9ZA 4LA5A 3ICNA 5DJVF 3ACYA 3M02A 4DWGA 4LFVF 5ERNA 3DYFA 5DGSF 4KVIA 4DZWA 4DXJA 5IM1A 5IMPA 5DIQF 5EASA 1YV5A 4EA2A 4DHDA 2ZCQA 3LGKA 1JFGA 4KVYA 5DJRF 3WCJA 4LPHF 1KIZA 4NG6A 2F94F 4E1EA 2Z7HA 3WEGA 3EFQA 4KQSA 2F89F 1N22A 1HXGA 2H8OA 1WL2A 2I19A 3WJNA 3PH7A 5ILDA 4KVWA 2AZLA 4KQUA 3ZMBA 1ZW5A 5JV1F 5B00A 2Z4VA 5IK6A 3IPIA 3SDVA 5IK9A 2OGDA 5AFXA 1N1BA 2Z78A 1YHLA 3TC1A 3SAEA 3LK5A 4KKMA 2EWGA 4OGUA 3KRCA 3WCEA 3N49F 4KFAA 3MZVA 2E90A 1JFAA 2OPNA 3N45F 4PVYF 3VJBA 4P0WA 1HM4A 4H5CF 3ZL6A 3OABB 1N24A 5B0IA 4RYPA 3N1VF 3BNXA 2PS4A 1YHKA 4LTZA 2ZCOA 3KRFA 3VJDA 3VJAA 4QXSF 4F6VA 1V4HA 3ASXA 1UBVA 5JA0F 2RAHA 5HN8A 4LOBA 2AELA 3KB9A 1HXCA 3WEJA 3LEEA 4RXDA 1VG6A 3LJIA 3WCDA 5B01A 1YYSA 4KPDA 4XQSF 3ZCDA 1WY0A 5ER8A 3KRAA 2Z4ZA 3RYWA 1VG4A 2PS8A 3N0FA 3W7FA 5EROA 2Z4WA 3P41A 1EZFA 4RXEA 2Q9YA 3OYRA 4OKMA 3QQVA 3RBMA 4GA3A 1N21A 1KIYA 3MAVA 3TFPA 4DWBA 3WCMA 2P1CA 4PVXF 5IKHA
chains in the Genus database with same CATH superfamily
1VG2A 4LZCA 2E8UA 3KBKA 1VG7A 1HXAA 5ILZA 2DH4A 4RXCA 4F6XA 3WJOA 5A0KA 4NFJF 3RYEA 2AZKA 3WCFA 2PS7A 4LXWA 3G4FA 4JVJF 3Q1OA 2Z50A 1YYTA 3KRCB 2ONHA 3LZ9A 1WL0A 3ICZA 2F8CF 2QISA 3UCAA 4RXAA 3ZMCA 2F9KF 4GP1A 4KUXA 2ZEVA 3AQBB 2VF6A 2E4OA 4JZBA 3S4JA 3P5RA 4F62A 4JYXA 1WL1A 3CC9A 3PYBA 3LLWA 5IN8A 4LZ3A 3V1VA 1UBWA 3M9UA 3EGTA 2O1OA 5DJPF 3WEFA 4H5DF 3WCLA 3WCHA 5ILJA 5DW7A 1V4KA 4GP2A 5ERMA 3N6KF 3ADZA 5JV0F 3NRIA 5E8LA 1V4JA 3NPRA 4UMJA 5IVGA 4H5EF 5B03A 4KK2A 4JZXA 4P0XA 4N9UA 5B0MA 3N5HF 4N1ZF 5E8HA 4EA0A 2E8XA 3WC9A 2AETA 3SDUA 3ID0A 4LFGA 2F7MF 3OACA 5H9DA 3WEHA 3V66A 2J1PA 3WSAA 4EA1A 4LTVA 4L2XF 2Q58A 3N3LF 5JV2F 3ACWA 2F92F 4HD1A 5EATA 2E95A 1HX9A 4OKZA 2Z4YA 4XQRF 1V4IA 4LLSA 1N20A 1WL3A 2PS6A 3WSBA 3LDWA 3TS7A 5IMNA 3Q30A 4LFEA 3IBAA 5IK0A 4JXYA 4NUAA 3N3DA 3V1XA 4KPJA 1YYQA 3LOMA 2J5CA 3QKCA 5AHUB 3AQCB 3M01A 4FP4A 3TFVA 4KVDA 4MC8A 5B02A 4P0VA 5HN9A 3LMDA 3NF2A 3WCBA 3RMGA 1PS1A 1RQIA 3LG5A 5DZ2A 1V4EA 3ZOUA 3B7LA 3N5JF 1DI1A 4LIXA 2Q9ZA 1N1ZA 5I1UA 2OPMA 3ICMA 3TFNA 2ONGA 3KROA 2E91A 4E9UA 5IL3A 3G4DA 1YQ7A 5ILKA 3P5PA 1UBXA 2Z52A 3WEIA 5JUZF 3VJ8A 2FTZA 3EZ3A 5CG6A 2PS5A 2E8TA 3VJCA 3KRPA 1RQJA 4NKFA 2J1OA 3DYGA 4DI5A 3KRFB 4LZ0A 2F8ZF 3OACB 4KQ5A 3DYHA 4NKEA 4MC3A 2Q80A 3WEKA 3P8LA 2E92A 4KWDA 4RNQA 2OA6A 4ZQ8A 5CG5A 5AELA 5AYPA 3ICKA 3WJKA 1HM7A 5IMIA 5B0JA 2FORA 3KRAB 3PKOA 3APZA 3LSNA 5A0JA 2E93A 3VJEA 3WCGA 1YYRA 2AZJA 3Q2QA 4WK5A 3SDQA 2ZY1A 3M0GA 2Z4XA 5B0LA 5DHKA 3WE9A 1RTRA 3Q2ZA 4LUUA 5ILHA 2ZCSA 4LA6A 4OMHA 3P8RA 5HN7A 5IL8A 3S9VA 5DGMF 3WCAA 4QPFA 1DGPA 3LVSA 5HNAA 3NPKA 2AEKA 3M00A 3N0GA 3CKEA 4MC0A 4JXNA 2ZEUA 3WCIA 3N1WF 2E8VA 3BNYA 5KSXF 2Z7IA 4GAXA 5EAUA 1N23A 1FPSA 2E94A 4K10A 3ACXA 3KROB 4XQTF 3SDTA 1VG3A 3LGZB 2E8WA 5E8KA 4LPGF 5ILYA 5DGNF 1WMWA 1YJ4A 1YYUA 3PDEA 4LLTA 5B0KA 3SDRA 4DEMF 5IKAA 3CP6A 3VJ9A 3KRPB 1YHMA 5C05A 3WCCA 3OABA 3AE0A 1UBYA 4NFIF 5A0IA 4NFKF 4OMGA 3N46F 5DHIA 1WKZA 5ILIA 3PYAA 3AQ0A 4FJQA 2ZCRA 4Q23A 4E9ZA 4LA5A 3ICNA 5DJVF 3ACYA 3M02A 4DWGA 4LFVF 5ERNA 3DYFA 5DGSF 4KVIA 4DZWA 4DXJA 5IM1A 5IMPA 5DIQF 5EASA 1YV5A 4EA2A 4DHDA 2ZCQA 3LGKA 1JFGA 4KVYA 5DJRF 3WCJA 4LPHF 1KIZA 4NG6A 2F94F 4E1EA 2Z7HA 3WEGA 3EFQA 4KQSA 2F89F 1N22A 1HXGA 2H8OA 1WL2A 2I19A 3WJNA 3PH7A 5ILDA 4KVWA 2AZLA 4KQUA 3ZMBA 1ZW5A 5JV1F 5B00A 2Z4VA 5IK6A 3IPIA 3SDVA 5IK9A 2OGDA 5AFXA 1N1BA 2Z78A 1YHLA 3TC1A 3SAEA 3LK5A 4KKMA 2EWGA 4OGUA 3KRCA 3WCEA 3N49F 4KFAA 3MZVA 2E90A 1JFAA 2OPNA 3N45F 4PVYF 3VJBA 4P0WA 1HM4A 4H5CF 3ZL6A 3OABB 1N24A 5B0IA 4RYPA 3N1VF 3BNXA 2PS4A 1YHKA 4LTZA 2ZCOA 3KRFA 3VJDA 3VJAA 4QXSF 4F6VA 1V4HA 3ASXA 1UBVA 5JA0F 2RAHA 5HN8A 4LOBA 2AELA 3KB9A 1HXCA 3WEJA 3LEEA 4RXDA 1VG6A 3LJIA 3WCDA 5B01A 1YYSA 4KPDA 4XQSF 3ZCDA 1WY0A 5ER8A 3KRAA 2Z4ZA 3RYWA 1VG4A 2PS8A 3N0FA 3W7FA 5EROA 2Z4WA 3P41A 1EZFA 4RXEA 2Q9YA 3OYRA 4OKMA 3QQVA 3RBMA 4GA3A 1N21A 1KIYA 3MAVA 3TFPA 4DWBA 3WCMA 2P1CA 4PVXF 5IKHA
chains in the Genus database with same CATH topology
1VG2A 4LZCA 2E8UA 3KBKA 1VG7A 1HXAA 5ILZA 2DH4A 4RXCA 4F6XA 3WJOA 5A0KA 4NFJF 3RYEA 2AZKA 3WCFA 2PS7A 4LXWA 3G4FA 4JVJF 3Q1OA 2Z50A 1YYTA 3KRCB 2ONHA 3LZ9A 1WL0A 3ICZA 2F8CF 2QISA 3UCAA 4RXAA 3ZMCA 2F9KF 4GP1A 4KUXA 2ZEVA 3AQBB 2VF6A 2E4OA 4JZBA 3S4JA 3P5RA 4F62A 4JYXA 1WL1A 3CC9A 3PYBA 3LLWA 5IN8A 4LZ3A 3V1VA 1UBWA 3M9UA 3EGTA 2O1OA 5DJPF 3WEFA 4H5DF 3WCLA 3WCHA 5ILJA 5DW7A 1V4KA 4GP2A 5ERMA 3N6KF 3ADZA 5JV0F 3NRIA 5E8LA 1V4JA 3NPRA 4UMJA 5IVGA 4H5EF 5B03A 4KK2A 4JZXA 4P0XA 4N9UA 5B0MA 3N5HF 4N1ZF 5E8HA 4EA0A 2E8XA 3WC9A 2AETA 3SDUA 3ID0A 4LFGA 2F7MF 3OACA 5H9DA 3WEHA 3V66A 2J1PA 3WSAA 4EA1A 4LTVA 4L2XF 2Q58A 3N3LF 5JV2F 3ACWA 2F92F 4HD1A 5EATA 2E95A 1HX9A 4OKZA 2Z4YA 4XQRF 1V4IA 4LLSA 1N20A 1WL3A 2PS6A 3WSBA 3LDWA 3TS7A 5IMNA 3Q30A 4LFEA 3IBAA 5IK0A 4JXYA 4NUAA 3N3DA 3V1XA 4KPJA 1YYQA 3LOMA 2J5CA 3QKCA 5AHUB 3AQCB 3M01A 4FP4A 3TFVA 4KVDA 4MC8A 5B02A 4P0VA 5HN9A 3LMDA 3NF2A 3WCBA 3RMGA 1PS1A 1RQIA 3LG5A 5DZ2A 1V4EA 3ZOUA 3B7LA 3N5JF 1DI1A 4LIXA 2Q9ZA 1N1ZA 5I1UA 2OPMA 3ICMA 3TFNA 2ONGA 3KROA 2E91A 4E9UA 5IL3A 3G4DA 1YQ7A 5ILKA 3P5PA 1UBXA 2Z52A 3WEIA 5JUZF 3VJ8A 2FTZA 3EZ3A 5CG6A 2PS5A 2E8TA 3VJCA 3KRPA 1RQJA 4NKFA 2J1OA 3DYGA 4DI5A 3KRFB 4LZ0A 2F8ZF 3OACB 4KQ5A 3DYHA 4NKEA 4MC3A 2Q80A 3WEKA 3P8LA 2E92A 4KWDA 4RNQA 2OA6A 4ZQ8A 5CG5A 5AELA 5AYPA 3ICKA 3WJKA 1HM7A 5IMIA 5B0JA 2FORA 3KRAB 3PKOA 3APZA 3LSNA 5A0JA 2E93A 3VJEA 3WCGA 1YYRA 2AZJA 3Q2QA 4WK5A 3SDQA 2ZY1A 3M0GA 2Z4XA 5B0LA 5DHKA 3WE9A 1RTRA 3Q2ZA 4LUUA 5ILHA 2ZCSA 4LA6A 4OMHA 3P8RA 5HN7A 5IL8A 3S9VA 5DGMF 3WCAA 4QPFA 1DGPA 3LVSA 5HNAA 3NPKA 2AEKA 3M00A 3N0GA 3CKEA 4MC0A 4JXNA 2ZEUA 3WCIA 3N1WF 2E8VA 3BNYA 5KSXF 2Z7IA 4GAXA 5EAUA 1N23A 1FPSA 2E94A 4K10A 3ACXA 3KROB 4XQTF 3SDTA 1VG3A 3LGZB 2E8WA 5E8KA 4LPGF 5ILYA 5DGNF 1WMWA 1YJ4A 1YYUA 3PDEA 4LLTA 5B0KA 3SDRA 4DEMF 5IKAA 3CP6A 3VJ9A 3KRPB 1YHMA 5C05A 3WCCA 3OABA 3AE0A 1UBYA 4NFIF 5A0IA 4NFKF 4OMGA 3N46F 5DHIA 1WKZA 5ILIA 3PYAA 3AQ0A 4FJQA 2ZCRA 4Q23A 4E9ZA 4LA5A 3ICNA 5DJVF 3ACYA 3M02A 4DWGA 4LFVF 5ERNA 3DYFA 5DGSF 4KVIA 4DZWA 4DXJA 5IM1A 5IMPA 5DIQF 5EASA 1YV5A 4EA2A 4DHDA 2ZCQA 3LGKA 1JFGA 4KVYA 5DJRF 3WCJA 4LPHF 1KIZA 4NG6A 2F94F 4E1EA 2Z7HA 3WEGA 3EFQA 4KQSA 2F89F 1N22A 1HXGA 2H8OA 1WL2A 2I19A 3WJNA 3PH7A 5ILDA 4KVWA 2AZLA 4KQUA 3ZMBA 1ZW5A 5JV1F 5B00A 2Z4VA 5IK6A 3IPIA 3SDVA 5IK9A 2OGDA 5AFXA 1N1BA 2Z78A 1YHLA 3TC1A 3SAEA 3LK5A 4KKMA 2EWGA 4OGUA 3KRCA 3WCEA 3N49F 4KFAA 3MZVA 2E90A 1JFAA 2OPNA 3N45F 4PVYF 3VJBA 4P0WA 1HM4A 4H5CF 3ZL6A 3OABB 1N24A 5B0IA 4RYPA 3N1VF 3BNXA 2PS4A 1YHKA 4LTZA 2ZCOA 3KRFA 3VJDA 3VJAA 4QXSF 4F6VA 1V4HA 3ASXA 1UBVA 5JA0F 2RAHA 5HN8A 4LOBA 2AELA 3KB9A 1HXCA 3WEJA 3LEEA 4RXDA 1VG6A 3LJIA 3WCDA 5B01A 1YYSA 4KPDA 4XQSF 3ZCDA 1WY0A 5ER8A 3KRAA 2Z4ZA 3RYWA 1VG4A 2PS8A 3N0FA 3W7FA 5EROA 2Z4WA 3P41A 1EZFA 4RXEA 2Q9YA 3OYRA 4OKMA 3QQVA 3RBMA 4GA3A 1N21A 1KIYA 3MAVA 3TFPA 4DWBA 3WCMA 2P1CA 4PVXF 5IKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VG2 A;  4LZC A;  2E8U A;  3KBK A;  1VG7 A;  1HXA A;  5ILZ A;  2DH4 A;  4RXC A;  4F6X A;  3WJO A;  5A0K A;  4NFJ F;  3RYE A;  2AZK A;  3WCF A;  2PS7 A;  4LXW A;  3G4F A;  4JVJ F;  3Q1O A;  2Z50 A;  1YYT A;  3KRC B;  2ONH A;  3LZ9 A;  1WL0 A;  3ICZ A;  2F8C F;  2QIS A;  3UCA A;  4RXA A;  3ZMC A;  2F9K F;  4GP1 A;  4KUX A;  2ZEV A;  3AQB B;  2VF6 A;  2E4O A;  4JZB A;  3S4J A;  3P5R A;  4F62 A;  4JYX A;  1WL1 A;  3CC9 A;  3PYB A;  3LLW A;  5IN8 A;  4LZ3 A;  3V1V A;  1UBW A;  3M9U A;  3EGT A;  2O1O A;  5DJP F;  3WEF A;  4H5D F;  3WCL A;  3WCH A;  5ILJ A;  5DW7 A;  1V4K A;  4GP2 A;  5ERM A;  3N6K F;  3ADZ A;  5JV0 F;  3NRI A;  5E8L A;  1V4J A;  3NPR A;  4UMJ A;  5IVG A;  4H5E F;  5B03 A;  4KK2 A;  4JZX A;  4P0X A;  4N9U A;  5B0M A;  3N5H F;  4N1Z F;  5E8H A;  4EA0 A;  2E8X A;  3WC9 A;  2AET A;  3SDU A;  3ID0 A;  4LFG A;  2F7M F;  3OAC A;  5H9D A;  3WEH A;  3V66 A;  2J1P A;  3WSA A;  4EA1 A;  4LTV A;  4L2X F;  2Q58 A;  3N3L F;  5JV2 F;  3ACW A;  2F92 F;  4HD1 A;  5EAT A;  2E95 A;  1HX9 A;  4OKZ A;  2Z4Y A;  4XQR F;  1V4I A;  4LLS A;  1N20 A;  1WL3 A;  2PS6 A;  3WSB A;  3LDW A;  3TS7 A;  5IMN A;  3Q30 A;  4LFE A;  3IBA A;  5IK0 A;  4JXY A;  4NUA A;  3N3D A;  3V1X A;  4KPJ A;  1YYQ A;  3LOM A;  2J5C A;  3QKC A;  5AHU B;  3AQC B;  3M01 A;  4FP4 A;  3TFV A;  4KVD A;  4MC8 A;  5B02 A;  4P0V A;  5HN9 A;  3LMD A;  3NF2 A;  3WCB A;  3RMG A;  1PS1 A;  1RQI A;  3LG5 A;  5DZ2 A;  1V4E A;  3ZOU A;  3B7L A;  3N5J F;  1DI1 A;  4LIX A;  2Q9Z A;  1N1Z A;  5I1U A;  2OPM A;  3ICM A;  3TFN A;  2ONG A;  3KRO A;  2E91 A;  4E9U A;  5IL3 A;  3G4D A;  1YQ7 A;  5ILK A;  3P5P A;  1UBX A;  2Z52 A;  3WEI A;  5JUZ F;  3VJ8 A;  2FTZ A;  3EZ3 A;  5CG6 A;  2PS5 A;  2E8T A;  3VJC A;  3KRP A;  1RQJ A;  4NKF A;  2J1O A;  3DYG A;  4DI5 A;  3KRF B;  4LZ0 A;  2F8Z F;  3OAC B;  4KQ5 A;  3DYH A;  4NKE A;  4MC3 A;  2Q80 A;  3WEK A;  3P8L A;  2E92 A;  4KWD A;  4RNQ A;  2OA6 A;  4ZQ8 A;  5CG5 A;  5AEL A;  5AYP A;  3ICK A;  3WJK A;  1HM7 A;  5IMI A;  5B0J A;  2FOR A;  3KRA B;  3PKO A;  3APZ A;  3LSN A;  5A0J A;  2E93 A;  3VJE A;  3WCG A;  1YYR A;  2AZJ A;  3Q2Q A;  4WK5 A;  3SDQ A;  2ZY1 A;  3M0G A;  2Z4X A;  5B0L A;  5DHK A;  3WE9 A;  1RTR A;  3Q2Z A;  4LUU A;  5ILH A;  2ZCS A;  4LA6 A;  4OMH A;  3P8R A;  5HN7 A;  5IL8 A;  3S9V A;  5DGM F;  3WCA A;  4QPF A;  1DGP A;  3LVS A;  5HNA A;  3NPK A;  2AEK A;  3M00 A;  3N0G A;  3CKE A;  4MC0 A;  4JXN A;  2ZEU A;  3WCI A;  3N1W F;  2E8V A;  3BNY A;  5KSX F;  2Z7I A;  4GAX A;  5EAU A;  1N23 A;  1FPS A;  2E94 A;  4K10 A;  3ACX A;  3KRO B;  4XQT F;  3SDT A;  1VG3 A;  3LGZ B;  2E8W A;  5E8K A;  4LPG F;  5ILY A;  5DGN F;  1WMW A;  1YJ4 A;  1YYU A;  3PDE A;  4LLT A;  5B0K A;  3SDR A;  4DEM F;  5IKA A;  3CP6 A;  3VJ9 A;  3KRP B;  1YHM A;  5C05 A;  3WCC A;  3OAB A;  3AE0 A;  1UBY A;  4NFI F;  5A0I A;  4NFK F;  4OMG A;  3N46 F;  5DHI A;  1WKZ A;  5ILI A;  3PYA A;  3AQ0 A;  4FJQ A;  2ZCR A;  4Q23 A;  4E9Z A;  4LA5 A;  3ICN A;  5DJV F;  3ACY A;  3M02 A;  4DWG A;  4LFV F;  5ERN A;  3DYF A;  5DGS F;  4KVI A;  4DZW A;  4DXJ A;  5IM1 A;  5IMP A;  5DIQ F;  5EAS A;  1YV5 A;  4EA2 A;  4DHD A;  2ZCQ A;  3LGK A;  1JFG A;  4KVY A;  5DJR F;  3WCJ A;  4LPH F;  1KIZ A;  4NG6 A;  2F94 F;  4E1E A;  2Z7H A;  3WEG A;  3EFQ A;  4KQS A;  2F89 F;  1N22 A;  1HXG A;  2H8O A;  1WL2 A;  2I19 A;  3WJN A;  3PH7 A;  5ILD A;  4KVW A;  2AZL A;  4KQU A;  3ZMB A;  1ZW5 A;  5JV1 F;  5B00 A;  2Z4V A;  5IK6 A;  3IPI A;  3SDV A;  5IK9 A;  2OGD A;  5AFX A;  1N1B A;  2Z78 A;  1YHL A;  3TC1 A;  3SAE A;  3LK5 A;  4KKM A;  2EWG A;  4OGU A;  3KRC A;  3WCE A;  3N49 F;  4KFA A;  3MZV A;  2E90 A;  1JFA A;  2OPN A;  3N45 F;  4PVY F;  3VJB A;  4P0W A;  1HM4 A;  4H5C F;  3ZL6 A;  3OAB B;  1N24 A;  5B0I A;  4RYP A;  3N1V F;  3BNX A;  2PS4 A;  1YHK A;  4LTZ A;  2ZCO A;  3KRF A;  3VJD A;  3VJA A;  4QXS F;  4F6V A;  1V4H A;  3ASX A;  1UBV A;  5JA0 F;  2RAH A;  5HN8 A;  4LOB A;  2AEL A;  3KB9 A;  1HXC A;  3WEJ A;  3LEE A;  4RXD A;  1VG6 A;  3LJI A;  3WCD A;  5B01 A;  1YYS A;  4KPD A;  4XQS F;  3ZCD A;  1WY0 A;  5ER8 A;  3KRA A;  2Z4Z A;  3RYW A;  1VG4 A;  2PS8 A;  3N0F A;  3W7F A;  5ERO A;  2Z4W A;  3P41 A;  1EZF A;  4RXE A;  2Q9Y A;  3OYR A;  4OKM A;  3QQV A;  3RBM A;  4GA3 A;  1N21 A;  1KIY A;  3MAV A;  3TFP A;  4DWB A;  3WCM A;  2P1C A;  4PVX F;  5IKH A; 
#chains in the Genus database with same CATH topology
 1VG2 A;  4LZC A;  2E8U A;  3KBK A;  1VG7 A;  1HXA A;  5ILZ A;  2DH4 A;  4RXC A;  4F6X A;  3WJO A;  5A0K A;  4NFJ F;  3RYE A;  2AZK A;  3WCF A;  2PS7 A;  4LXW A;  3G4F A;  4JVJ F;  3Q1O A;  2Z50 A;  1YYT A;  3KRC B;  2ONH A;  3LZ9 A;  1WL0 A;  3ICZ A;  2F8C F;  2QIS A;  3UCA A;  4RXA A;  3ZMC A;  2F9K F;  4GP1 A;  4KUX A;  2ZEV A;  3AQB B;  2VF6 A;  2E4O A;  4JZB A;  3S4J A;  3P5R A;  4F62 A;  4JYX A;  1WL1 A;  3CC9 A;  3PYB A;  3LLW A;  5IN8 A;  4LZ3 A;  3V1V A;  1UBW A;  3M9U A;  3EGT A;  2O1O A;  5DJP F;  3WEF A;  4H5D F;  3WCL A;  3WCH A;  5ILJ A;  5DW7 A;  1V4K A;  4GP2 A;  5ERM A;  3N6K F;  3ADZ A;  5JV0 F;  3NRI A;  5E8L A;  1V4J A;  3NPR A;  4UMJ A;  5IVG A;  4H5E F;  5B03 A;  4KK2 A;  4JZX A;  4P0X A;  4N9U A;  5B0M A;  3N5H F;  4N1Z F;  5E8H A;  4EA0 A;  2E8X A;  3WC9 A;  2AET A;  3SDU A;  3ID0 A;  4LFG A;  2F7M F;  3OAC A;  5H9D A;  3WEH A;  3V66 A;  2J1P A;  3WSA A;  4EA1 A;  4LTV A;  4L2X F;  2Q58 A;  3N3L F;  5JV2 F;  3ACW A;  2F92 F;  4HD1 A;  5EAT A;  2E95 A;  1HX9 A;  4OKZ A;  2Z4Y A;  4XQR F;  1V4I A;  4LLS A;  1N20 A;  1WL3 A;  2PS6 A;  3WSB A;  3LDW A;  3TS7 A;  5IMN A;  3Q30 A;  4LFE A;  3IBA A;  5IK0 A;  4JXY A;  4NUA A;  3N3D A;  3V1X A;  4KPJ A;  1YYQ A;  3LOM A;  2J5C A;  3QKC A;  5AHU B;  3AQC B;  3M01 A;  4FP4 A;  3TFV A;  4KVD A;  4MC8 A;  5B02 A;  4P0V A;  5HN9 A;  3LMD A;  3NF2 A;  3WCB A;  3RMG A;  1PS1 A;  1RQI A;  3LG5 A;  5DZ2 A;  1V4E A;  3ZOU A;  3B7L A;  3N5J F;  1DI1 A;  4LIX A;  2Q9Z A;  1N1Z A;  5I1U A;  2OPM A;  3ICM A;  3TFN A;  2ONG A;  3KRO A;  2E91 A;  4E9U A;  5IL3 A;  3G4D A;  1YQ7 A;  5ILK A;  3P5P A;  1UBX A;  2Z52 A;  3WEI A;  5JUZ F;  3VJ8 A;  2FTZ A;  3EZ3 A;  5CG6 A;  2PS5 A;  2E8T A;  3VJC A;  3KRP A;  1RQJ A;  4NKF A;  2J1O A;  3DYG A;  4DI5 A;  3KRF B;  4LZ0 A;  2F8Z F;  3OAC B;  4KQ5 A;  3DYH A;  4NKE A;  4MC3 A;  2Q80 A;  3WEK A;  3P8L A;  2E92 A;  4KWD A;  4RNQ A;  2OA6 A;  4ZQ8 A;  5CG5 A;  5AEL A;  5AYP A;  3ICK A;  3WJK A;  1HM7 A;  5IMI A;  5B0J A;  2FOR A;  3KRA B;  3PKO A;  3APZ A;  3LSN A;  5A0J A;  2E93 A;  3VJE A;  3WCG A;  1YYR A;  2AZJ A;  3Q2Q A;  4WK5 A;  3SDQ A;  2ZY1 A;  3M0G A;  2Z4X A;  5B0L A;  5DHK A;  3WE9 A;  1RTR A;  3Q2Z A;  4LUU A;  5ILH A;  2ZCS A;  4LA6 A;  4OMH A;  3P8R A;  5HN7 A;  5IL8 A;  3S9V A;  5DGM F;  3WCA A;  4QPF A;  1DGP A;  3LVS A;  5HNA A;  3NPK A;  2AEK A;  3M00 A;  3N0G A;  3CKE A;  4MC0 A;  4JXN A;  2ZEU A;  3WCI A;  3N1W F;  2E8V A;  3BNY A;  5KSX F;  2Z7I A;  4GAX A;  5EAU A;  1N23 A;  1FPS A;  2E94 A;  4K10 A;  3ACX A;  3KRO B;  4XQT F;  3SDT A;  1VG3 A;  3LGZ B;  2E8W A;  5E8K A;  4LPG F;  5ILY A;  5DGN F;  1WMW A;  1YJ4 A;  1YYU A;  3PDE A;  4LLT A;  5B0K A;  3SDR A;  4DEM F;  5IKA A;  3CP6 A;  3VJ9 A;  3KRP B;  1YHM A;  5C05 A;  3WCC A;  3OAB A;  3AE0 A;  1UBY A;  4NFI F;  5A0I A;  4NFK F;  4OMG A;  3N46 F;  5DHI A;  1WKZ A;  5ILI A;  3PYA A;  3AQ0 A;  4FJQ A;  2ZCR A;  4Q23 A;  4E9Z A;  4LA5 A;  3ICN A;  5DJV F;  3ACY A;  3M02 A;  4DWG A;  4LFV F;  5ERN A;  3DYF A;  5DGS F;  4KVI A;  4DZW A;  4DXJ A;  5IM1 A;  5IMP A;  5DIQ F;  5EAS A;  1YV5 A;  4EA2 A;  4DHD A;  2ZCQ A;  3LGK A;  1JFG A;  4KVY A;  5DJR F;  3WCJ A;  4LPH F;  1KIZ A;  4NG6 A;  2F94 F;  4E1E A;  2Z7H A;  3WEG A;  3EFQ A;  4KQS A;  2F89 F;  1N22 A;  1HXG A;  2H8O A;  1WL2 A;  2I19 A;  3WJN A;  3PH7 A;  5ILD A;  4KVW A;  2AZL A;  4KQU A;  3ZMB A;  1ZW5 A;  5JV1 F;  5B00 A;  2Z4V A;  5IK6 A;  3IPI A;  3SDV A;  5IK9 A;  2OGD A;  5AFX A;  1N1B A;  2Z78 A;  1YHL A;  3TC1 A;  3SAE A;  3LK5 A;  4KKM A;  2EWG A;  4OGU A;  3KRC A;  3WCE A;  3N49 F;  4KFA A;  3MZV A;  2E90 A;  1JFA A;  2OPN A;  3N45 F;  4PVY F;  3VJB A;  4P0W A;  1HM4 A;  4H5C F;  3ZL6 A;  3OAB B;  1N24 A;  5B0I A;  4RYP A;  3N1V F;  3BNX A;  2PS4 A;  1YHK A;  4LTZ A;  2ZCO A;  3KRF A;  3VJD A;  3VJA A;  4QXS F;  4F6V A;  1V4H A;  3ASX A;  1UBV A;  5JA0 F;  2RAH A;  5HN8 A;  4LOB A;  2AEL A;  3KB9 A;  1HXC A;  3WEJ A;  3LEE A;  4RXD A;  1VG6 A;  3LJI A;  3WCD A;  5B01 A;  1YYS A;  4KPD A;  4XQS F;  3ZCD A;  1WY0 A;  5ER8 A;  3KRA A;  2Z4Z A;  3RYW A;  1VG4 A;  2PS8 A;  3N0F A;  3W7F A;  5ERO A;  2Z4W A;  3P41 A;  1EZF A;  4RXE A;  2Q9Y A;  3OYR A;  4OKM A;  3QQV A;  3RBM A;  4GA3 A;  1N21 A;  1KIY A;  3MAV A;  3TFP A;  4DWB A;  3WCM A;  2P1C A;  4PVX F;  5IKH A; 
#chains in the Genus database with same CATH homology
 1VG2 A;  4LZC A;  2E8U A;  3KBK A;  1VG7 A;  1HXA A;  5ILZ A;  2DH4 A;  4RXC A;  4F6X A;  3WJO A;  5A0K A;  4NFJ F;  3RYE A;  2AZK A;  3WCF A;  2PS7 A;  4LXW A;  3G4F A;  4JVJ F;  3Q1O A;  2Z50 A;  1YYT A;  3KRC B;  2ONH A;  3LZ9 A;  1WL0 A;  3ICZ A;  2F8C F;  2QIS A;  3UCA A;  4RXA A;  3ZMC A;  2F9K F;  4GP1 A;  4KUX A;  2ZEV A;  3AQB B;  2VF6 A;  2E4O A;  4JZB A;  3S4J A;  3P5R A;  4F62 A;  4JYX A;  1WL1 A;  3CC9 A;  3PYB A;  3LLW A;  5IN8 A;  4LZ3 A;  3V1V A;  1UBW A;  3M9U A;  3EGT A;  2O1O A;  5DJP F;  3WEF A;  4H5D F;  3WCL A;  3WCH A;  5ILJ A;  5DW7 A;  1V4K A;  4GP2 A;  5ERM A;  3N6K F;  3ADZ A;  5JV0 F;  3NRI A;  5E8L A;  1V4J A;  3NPR A;  4UMJ A;  5IVG A;  4H5E F;  5B03 A;  4KK2 A;  4JZX A;  4P0X A;  4N9U A;  5B0M A;  3N5H F;  4N1Z F;  5E8H A;  4EA0 A;  2E8X A;  3WC9 A;  2AET A;  3SDU A;  3ID0 A;  4LFG A;  2F7M F;  3OAC A;  5H9D A;  3WEH A;  3V66 A;  2J1P A;  3WSA A;  4EA1 A;  4LTV A;  4L2X F;  2Q58 A;  3N3L F;  5JV2 F;  3ACW A;  2F92 F;  4HD1 A;  5EAT A;  2E95 A;  1HX9 A;  4OKZ A;  2Z4Y A;  4XQR F;  1V4I A;  4LLS A;  1N20 A;  1WL3 A;  2PS6 A;  3WSB A;  3LDW A;  3TS7 A;  5IMN A;  3Q30 A;  4LFE A;  3IBA A;  5IK0 A;  4JXY A;  4NUA A;  3N3D A;  3V1X A;  4KPJ A;  1YYQ A;  3LOM A;  2J5C A;  3QKC A;  5AHU B;  3AQC B;  3M01 A;  4FP4 A;  3TFV A;  4KVD A;  4MC8 A;  5B02 A;  4P0V A;  5HN9 A;  3LMD A;  3NF2 A;  3WCB A;  3RMG A;  1PS1 A;  1RQI A;  3LG5 A;  5DZ2 A;  1V4E A;  3ZOU A;  3B7L A;  3N5J F;  1DI1 A;  4LIX A;  2Q9Z A;  1N1Z A;  5I1U A;  2OPM A;  3ICM A;  3TFN A;  2ONG A;  3KRO A;  2E91 A;  4E9U A;  5IL3 A;  3G4D A;  1YQ7 A;  5ILK A;  3P5P A;  1UBX A;  2Z52 A;  3WEI A;  5JUZ F;  3VJ8 A;  2FTZ A;  3EZ3 A;  5CG6 A;  2PS5 A;  2E8T A;  3VJC A;  3KRP A;  1RQJ A;  4NKF A;  2J1O A;  3DYG A;  4DI5 A;  3KRF B;  4LZ0 A;  2F8Z F;  3OAC B;  4KQ5 A;  3DYH A;  4NKE A;  4MC3 A;  2Q80 A;  3WEK A;  3P8L A;  2E92 A;  4KWD A;  4RNQ A;  2OA6 A;  4ZQ8 A;  5CG5 A;  5AEL A;  5AYP A;  3ICK A;  3WJK A;  1HM7 A;  5IMI A;  5B0J A;  2FOR A;  3KRA B;  3PKO A;  3APZ A;  3LSN A;  5A0J A;  2E93 A;  3VJE A;  3WCG A;  1YYR A;  2AZJ A;  3Q2Q A;  4WK5 A;  3SDQ A;  2ZY1 A;  3M0G A;  2Z4X A;  5B0L A;  5DHK A;  3WE9 A;  1RTR A;  3Q2Z A;  4LUU A;  5ILH A;  2ZCS A;  4LA6 A;  4OMH A;  3P8R A;  5HN7 A;  5IL8 A;  3S9V A;  5DGM F;  3WCA A;  4QPF A;  1DGP A;  3LVS A;  5HNA A;  3NPK A;  2AEK A;  3M00 A;  3N0G A;  3CKE A;  4MC0 A;  4JXN A;  2ZEU A;  3WCI A;  3N1W F;  2E8V A;  3BNY A;  5KSX F;  2Z7I A;  4GAX A;  5EAU A;  1N23 A;  1FPS A;  2E94 A;  4K10 A;  3ACX A;  3KRO B;  4XQT F;  3SDT A;  1VG3 A;  3LGZ B;  2E8W A;  5E8K A;  4LPG F;  5ILY A;  5DGN F;  1WMW A;  1YJ4 A;  1YYU A;  3PDE A;  4LLT A;  5B0K A;  3SDR A;  4DEM F;  5IKA A;  3CP6 A;  3VJ9 A;  3KRP B;  1YHM A;  5C05 A;  3WCC A;  3OAB A;  3AE0 A;  1UBY A;  4NFI F;  5A0I A;  4NFK F;  4OMG A;  3N46 F;  5DHI A;  1WKZ A;  5ILI A;  3PYA A;  3AQ0 A;  4FJQ A;  2ZCR A;  4Q23 A;  4E9Z A;  4LA5 A;  3ICN A;  5DJV F;  3ACY A;  3M02 A;  4DWG A;  4LFV F;  5ERN A;  3DYF A;  5DGS F;  4KVI A;  4DZW A;  4DXJ A;  5IM1 A;  5IMP A;  5DIQ F;  5EAS A;  1YV5 A;  4EA2 A;  4DHD A;  2ZCQ A;  3LGK A;  1JFG A;  4KVY A;  5DJR F;  3WCJ A;  4LPH F;  1KIZ A;  4NG6 A;  2F94 F;  4E1E A;  2Z7H A;  3WEG A;  3EFQ A;  4KQS A;  2F89 F;  1N22 A;  1HXG A;  2H8O A;  1WL2 A;  2I19 A;  3WJN A;  3PH7 A;  5ILD A;  4KVW A;  2AZL A;  4KQU A;  3ZMB A;  1ZW5 A;  5JV1 F;  5B00 A;  2Z4V A;  5IK6 A;  3IPI A;  3SDV A;  5IK9 A;  2OGD A;  5AFX A;  1N1B A;  2Z78 A;  1YHL A;  3TC1 A;  3SAE A;  3LK5 A;  4KKM A;  2EWG A;  4OGU A;  3KRC A;  3WCE A;  3N49 F;  4KFA A;  3MZV A;  2E90 A;  1JFA A;  2OPN A;  3N45 F;  4PVY F;  3VJB A;  4P0W A;  1HM4 A;  4H5C F;  3ZL6 A;  3OAB B;  1N24 A;  5B0I A;  4RYP A;  3N1V F;  3BNX A;  2PS4 A;  1YHK A;  4LTZ A;  2ZCO A;  3KRF A;  3VJD A;  3VJA A;  4QXS F;  4F6V A;  1V4H A;  3ASX A;  1UBV A;  5JA0 F;  2RAH A;  5HN8 A;  4LOB A;  2AEL A;  3KB9 A;  1HXC A;  3WEJ A;  3LEE A;  4RXD A;  1VG6 A;  3LJI A;  3WCD A;  5B01 A;  1YYS A;  4KPD A;  4XQS F;  3ZCD A;  1WY0 A;  5ER8 A;  3KRA A;  2Z4Z A;  3RYW A;  1VG4 A;  2PS8 A;  3N0F A;  3W7F A;  5ERO A;  2Z4W A;  3P41 A;  1EZF A;  4RXE A;  2Q9Y A;  3OYR A;  4OKM A;  3QQV A;  3RBM A;  4GA3 A;  1N21 A;  1KIY A;  3MAV A;  3TFP A;  4DWB A;  3WCM A;  2P1C A;  4PVX F;  5IKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...