3KRAB

Mint heterotetrameric geranyl pyrophosphate synthase in complex with magnesium
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
259
structure length
259
Chain Sequence
MQPYWAAIEADIERYLKKSITIRPPETVFGPMHHLTFAAPATAASTLCLAACELVGGDRSQAMAAAAAIHLVHAAAYVHEHLPLTDGSRPVSKPAIQHKYGPNVELLTGDGIVPFGFELLAGSVDPARTDDPDRILRVIIEISRAGGPEGMISGLHREEEIVDGNTSLDFIEYVCKKKYGEMHACGAACGAILGGAAEEEIQKLRNFGLYQGTLRGMMEMKNSHQLIDENIIGKLKELALEELGGFHGKNAELMSSLVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyl diphosphate synthase large subunit
publication title Structure of a heterotetrameric geranyl pyrophosphate synthase from mint (Mentha piperita) reveals intersubunit regulation
pubmed doi rcsb
source organism Mentha x piperita
total genus 99
structure length 259
sequence length 259
chains with identical sequence C
ec nomenclature ec 2.5.1.1: Dimethylallyltranstransferase.
pdb deposition date 2009-11-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3kraB00
5E8LA 4LUUA 3WCEA 4LXWA 5A0KA 2ZY1A 3Q2QA 3ACWA 5CG6A 3N3LF 5IKAA 3M9UA 3WEJA 4LZCA 5ILDA 3WC9A 1HX9A 3AQBB 5DGSF 5HN7A 2ZCOA 4LIXA 5A0JA 3KRPA 4DHDA 3LG5A 3WCMA 5IMIA 2E8WA 2Z4XA 5IN8A 4H5EF 2E94A 5DW7A 2OPNA 4LA5A 4E1EA 1EZFA 4XQTF 4KWDA 4RNQA 1YJ4A 5EAUA 3V1XA 3APZA 3WCHA 5IVGA 3PYAA 3TFNA 2F8CF 3ICMA 3WEGA 4LFGA 3LDWA 3N5JF 3WSAA 2ZCQA 4F6VA 1HM4A 3AQ0A 4JVJF 3OACB 3DYFA 3AE0A 5B0MA 1N1ZA 4EA0A 2E8VA 1HXGA 3Q2ZA 4HD1A 5B01A 5B00A 3P8LA 3EZ3A 5ILKA 3KROA 3PDEA 1WL0A 4NKFA 4LTVA 5DHIA 3KRAB 2E4OA 2PS6A 3N46F 2Z50A 3KBKA 3N5HF 3VJAA 1V4JA 3WCFA 4RXDA 3N45F 5AYPA 3CC9A 2F92F 3N6KF 1KIYA 3LGKA 1V4IA 2F7MF 5DIQF 3N0GA 5B0JA 5AFXA 3WSBA 3CP6A 2PS8A 2Q58A 3SDRA 3WEKA 5HNAA 2F8ZF 3KRCA 1UBVA 4LOBA 4RXEA 1HXAA 1HXCA 2FORA 1WL3A 1DGPA 3OABA 4N9UA 3SDTA 3NPKA 3LJIA 2Z4YA 1ZW5A 5IK6A 4DXJA 3S9VA 3OYRA 3ADZA 5ILZA 4P0WA 2E8XA 5AHUB 4NUAA 1V4KA 3WJOA 3V66A 3WEFA 5I1UA 3N49F 1WKZA 3G4FA 5HN8A 4RYPA 4DWBA 4F62A 3N0FA 1UBXA 2P1CA 5DZ2A 5E8HA 4H5CF 4LA6A 2ONGA 5JV1F 1VG4A 3G4DA 1WL1A 3NF2A 4UMJA 2J1PA 1UBYA 3WCBA 2PS4A 5IKHA 5JA0F 5IK9A 2E93A 4H5DF 2I19A 1HM7A 2Z4ZA 2O1OA 2OA6A 4K10A 4KQ5A 5H9DA 2Z78A 5C05A 1WL2A 3QQVA 3LMDA 3LLWA 2F9KF 4OGUA 1V4HA 3DYGA 3VJDA 3EGTA 5DJPF 3WJKA 4E9ZA 3P8RA 4QPFA 3CKEA 4NFIF 4LZ0A 3ACYA 1VG2A 3VJ9A 3KRFB 3TFPA 3N3DA 3LZ9A 3EFQA 4GA3A 5JV0F 2Z7IA 3IBAA 4PVYF 4XQRF 2PS7A 1YHLA 3TFVA 5IMNA 3WEHA 5ILIA 3P5PA 3ACXA 1YYSA 4KUXA 1N21A 4KVIA 4NKEA 2DH4A 5ERNA 3OACA 3NPRA 3WEIA 4WK5A 2Q9YA 3PH7A 4LLTA 5ILYA 5B0IA 5B0KA 1N22A 4RXCA 3UCAA 3WE9A 3WCDA 4NFKF 4ZQ8A 1V4EA 1YYTA 2AZKA 3M00A 3LGZB 3RBMA 3ZL6A 3KRAA 2Z7HA 2E92A 5JV2F 4N1ZF 4E9UA 5ERMA 3QKCA 5DJRF 1N20A 3WCGA 3Q30A 2EWGA 5ILHA 3SDQA 3DYHA 5EATA 5IM1A 2AEKA 5KSXF 2J1OA 4JXYA 4DWGA 1JFAA 4JZBA 1RQIA 3V1VA 4EA2A 4FJQA 4OMGA 3RMGA 2F94F 2J5CA 3MZVA 3PKOA 3WCJA 4OKZA 4MC3A 2Z52A 5B03A 3WJNA 5ER8A 4Q23A 5EROA 5DJVF 5A0IA 4KVYA 3W7FA 2Z4WA 4P0XA 4OMHA 2ONHA 3KRPB 2E95A 1YHMA 3P41A 2AELA 4RXAA 3KB9A 4GP2A 4KFAA 5ILJA 3ZOUA 3VJCA 3SDVA 4PVXF 1JFGA 1KIZA 3MAVA 3ICZA 2QISA 4LLSA 4LFVF 3LEEA 1RTRA 3ID0A 1YYUA 4LPGF 4NFJF 2AETA 3S4JA 4KQSA 2AZJA 1PS1A 4KPDA 2OPMA 3ASXA 4P0VA 3M01A 2E8UA 4JYXA 4GAXA 2F89F 1VG7A 2Z4VA 3ICNA 2Q9ZA 1N23A 4DEMF 3M02A 1YYQA 4KVDA 3RYEA 3KROB 3LK5A 4LZ3A 3TC1A 5DHKA 3BNXA 5EASA 4F6XA 3VJEA 1DI1A 3VJ8A 4KK2A 1VG3A 3IPIA 3WCCA 5IK0A 2Q80A 1WMWA 4KQUA 4XQSF 2AZLA 5HN9A 1WY0A 5IL8A 5JUZF 4GP1A 3WCLA 2E91A 1RQJA 5DGNF 3PYBA 4MC0A 4OKMA 3KRFA 4JXNA 2ZCSA 3ZMBA 3VJBA 4QXSF 1YHKA 2E8TA 3KRCB 5IMPA 3ICKA 3TS7A 3LSNA 1N1BA 2ZCRA 1YYRA 4LTZA 5AELA 1YV5A 2FTZA 4DZWA 3OABB 3Q1OA 1YQ7A 1N24A 4EA1A 5IL3A 4L2XF 3P5RA 3N1WF 2E90A 1FPSA 3BNYA 2RAHA 3SAEA 4DI5A 2H8OA 4KVWA 3N1VF 4MC8A 5B0LA 3WCIA 3ZCDA 4LPHF 3B7LA 3M0GA 1UBWA 3RYWA 4NG6A 5DGMF 5B02A 2OGDA 4KPJA 4LFEA 3LVSA 2ZEUA 3LOMA 3NRIA 1VG6A 4KKMA 4FP4A 3SDUA 5CG5A 5E8KA 2PS5A 4JZXA 3ZMCA 2VF6A 2ZEVA 3WCAA 3AQCB
chains in the Genus database with same CATH superfamily
5E8LA 4LUUA 3WCEA 4LXWA 5A0KA 2ZY1A 3Q2QA 3ACWA 5CG6A 3N3LF 5IKAA 3M9UA 3WEJA 4LZCA 5ILDA 3WC9A 1HX9A 3AQBB 5DGSF 5HN7A 2ZCOA 4LIXA 5A0JA 3KRPA 4DHDA 3LG5A 3WCMA 5IMIA 2E8WA 2Z4XA 5IN8A 4H5EF 2E94A 5DW7A 2OPNA 4LA5A 4E1EA 1EZFA 4XQTF 4KWDA 4RNQA 1YJ4A 5EAUA 3V1XA 3APZA 3WCHA 5IVGA 3PYAA 3TFNA 2F8CF 3ICMA 3WEGA 4LFGA 3LDWA 3N5JF 3WSAA 2ZCQA 4F6VA 1HM4A 3AQ0A 4JVJF 3OACB 3DYFA 3AE0A 5B0MA 1N1ZA 4EA0A 2E8VA 1HXGA 3Q2ZA 4HD1A 5B01A 5B00A 3P8LA 3EZ3A 5ILKA 3KROA 3PDEA 1WL0A 4NKFA 4LTVA 5DHIA 3KRAB 2E4OA 2PS6A 3N46F 2Z50A 3KBKA 3N5HF 3VJAA 1V4JA 3WCFA 4RXDA 3N45F 5AYPA 3CC9A 2F92F 3N6KF 1KIYA 3LGKA 1V4IA 2F7MF 5DIQF 3N0GA 5B0JA 5AFXA 3WSBA 3CP6A 2PS8A 2Q58A 3SDRA 3WEKA 5HNAA 2F8ZF 3KRCA 1UBVA 4LOBA 4RXEA 1HXAA 1HXCA 2FORA 1WL3A 1DGPA 3OABA 4N9UA 3SDTA 3NPKA 3LJIA 2Z4YA 1ZW5A 5IK6A 4DXJA 3S9VA 3OYRA 3ADZA 5ILZA 4P0WA 2E8XA 5AHUB 4NUAA 1V4KA 3WJOA 3V66A 3WEFA 5I1UA 3N49F 1WKZA 3G4FA 5HN8A 4RYPA 4DWBA 4F62A 3N0FA 1UBXA 2P1CA 5DZ2A 5E8HA 4H5CF 4LA6A 2ONGA 5JV1F 1VG4A 3G4DA 1WL1A 3NF2A 4UMJA 2J1PA 1UBYA 3WCBA 2PS4A 5IKHA 5JA0F 5IK9A 2E93A 4H5DF 2I19A 1HM7A 2Z4ZA 2O1OA 2OA6A 4K10A 4KQ5A 5H9DA 2Z78A 5C05A 1WL2A 3QQVA 3LMDA 3LLWA 2F9KF 4OGUA 1V4HA 3DYGA 3VJDA 3EGTA 5DJPF 3WJKA 4E9ZA 3P8RA 4QPFA 3CKEA 4NFIF 4LZ0A 3ACYA 1VG2A 3VJ9A 3KRFB 3TFPA 3N3DA 3LZ9A 3EFQA 4GA3A 5JV0F 2Z7IA 3IBAA 4PVYF 4XQRF 2PS7A 1YHLA 3TFVA 5IMNA 3WEHA 5ILIA 3P5PA 3ACXA 1YYSA 4KUXA 1N21A 4KVIA 4NKEA 2DH4A 5ERNA 3OACA 3NPRA 3WEIA 4WK5A 2Q9YA 3PH7A 4LLTA 5ILYA 5B0IA 5B0KA 1N22A 4RXCA 3UCAA 3WE9A 3WCDA 4NFKF 4ZQ8A 1V4EA 1YYTA 2AZKA 3M00A 3LGZB 3RBMA 3ZL6A 3KRAA 2Z7HA 2E92A 5JV2F 4N1ZF 4E9UA 5ERMA 3QKCA 5DJRF 1N20A 3WCGA 3Q30A 2EWGA 5ILHA 3SDQA 3DYHA 5EATA 5IM1A 2AEKA 5KSXF 2J1OA 4JXYA 4DWGA 1JFAA 4JZBA 1RQIA 3V1VA 4EA2A 4FJQA 4OMGA 3RMGA 2F94F 2J5CA 3MZVA 3PKOA 3WCJA 4OKZA 4MC3A 2Z52A 5B03A 3WJNA 5ER8A 4Q23A 5EROA 5DJVF 5A0IA 4KVYA 3W7FA 2Z4WA 4P0XA 4OMHA 2ONHA 3KRPB 2E95A 1YHMA 3P41A 2AELA 4RXAA 3KB9A 4GP2A 4KFAA 5ILJA 3ZOUA 3VJCA 3SDVA 4PVXF 1JFGA 1KIZA 3MAVA 3ICZA 2QISA 4LLSA 4LFVF 3LEEA 1RTRA 3ID0A 1YYUA 4LPGF 4NFJF 2AETA 3S4JA 4KQSA 2AZJA 1PS1A 4KPDA 2OPMA 3ASXA 4P0VA 3M01A 2E8UA 4JYXA 4GAXA 2F89F 1VG7A 2Z4VA 3ICNA 2Q9ZA 1N23A 4DEMF 3M02A 1YYQA 4KVDA 3RYEA 3KROB 3LK5A 4LZ3A 3TC1A 5DHKA 3BNXA 5EASA 4F6XA 3VJEA 1DI1A 3VJ8A 4KK2A 1VG3A 3IPIA 3WCCA 5IK0A 2Q80A 1WMWA 4KQUA 4XQSF 2AZLA 5HN9A 1WY0A 5IL8A 5JUZF 4GP1A 3WCLA 2E91A 1RQJA 5DGNF 3PYBA 4MC0A 4OKMA 3KRFA 4JXNA 2ZCSA 3ZMBA 3VJBA 4QXSF 1YHKA 2E8TA 3KRCB 5IMPA 3ICKA 3TS7A 3LSNA 1N1BA 2ZCRA 1YYRA 4LTZA 5AELA 1YV5A 2FTZA 4DZWA 3OABB 3Q1OA 1YQ7A 1N24A 4EA1A 5IL3A 4L2XF 3P5RA 3N1WF 2E90A 1FPSA 3BNYA 2RAHA 3SAEA 4DI5A 2H8OA 4KVWA 3N1VF 4MC8A 5B0LA 3WCIA 3ZCDA 4LPHF 3B7LA 3M0GA 1UBWA 3RYWA 4NG6A 5DGMF 5B02A 2OGDA 4KPJA 4LFEA 3LVSA 2ZEUA 3LOMA 3NRIA 1VG6A 4KKMA 4FP4A 3SDUA 5CG5A 5E8KA 2PS5A 4JZXA 3ZMCA 2VF6A 2ZEVA 3WCAA 3AQCB
chains in the Genus database with same CATH topology
5E8LA 4LUUA 3WCEA 4LXWA 5A0KA 2ZY1A 3Q2QA 3ACWA 5CG6A 3N3LF 5IKAA 3M9UA 3WEJA 4LZCA 5ILDA 3WC9A 1HX9A 3AQBB 5DGSF 5HN7A 2ZCOA 4LIXA 5A0JA 3KRPA 4DHDA 3LG5A 3WCMA 5IMIA 2E8WA 2Z4XA 5IN8A 4H5EF 2E94A 5DW7A 2OPNA 4LA5A 4E1EA 1EZFA 4XQTF 4KWDA 4RNQA 1YJ4A 5EAUA 3V1XA 3APZA 3WCHA 5IVGA 3PYAA 3TFNA 2F8CF 3ICMA 3WEGA 4LFGA 3LDWA 3N5JF 3WSAA 2ZCQA 4F6VA 1HM4A 3AQ0A 4JVJF 3OACB 3DYFA 3AE0A 5B0MA 1N1ZA 4EA0A 2E8VA 1HXGA 3Q2ZA 4HD1A 5B01A 5B00A 3P8LA 3EZ3A 5ILKA 3KROA 3PDEA 1WL0A 4NKFA 4LTVA 5DHIA 3KRAB 2E4OA 2PS6A 3N46F 2Z50A 3KBKA 3N5HF 3VJAA 1V4JA 3WCFA 4RXDA 3N45F 5AYPA 3CC9A 2F92F 3N6KF 1KIYA 3LGKA 1V4IA 2F7MF 5DIQF 3N0GA 5B0JA 5AFXA 3WSBA 3CP6A 2PS8A 2Q58A 3SDRA 3WEKA 5HNAA 2F8ZF 3KRCA 1UBVA 4LOBA 4RXEA 1HXAA 1HXCA 2FORA 1WL3A 1DGPA 3OABA 4N9UA 3SDTA 3NPKA 3LJIA 2Z4YA 1ZW5A 5IK6A 4DXJA 3S9VA 3OYRA 3ADZA 5ILZA 4P0WA 2E8XA 5AHUB 4NUAA 1V4KA 3WJOA 3V66A 3WEFA 5I1UA 3N49F 1WKZA 3G4FA 5HN8A 4RYPA 4DWBA 4F62A 3N0FA 1UBXA 2P1CA 5DZ2A 5E8HA 4H5CF 4LA6A 2ONGA 5JV1F 1VG4A 3G4DA 1WL1A 3NF2A 4UMJA 2J1PA 1UBYA 3WCBA 2PS4A 5IKHA 5JA0F 5IK9A 2E93A 4H5DF 2I19A 1HM7A 2Z4ZA 2O1OA 2OA6A 4K10A 4KQ5A 5H9DA 2Z78A 5C05A 1WL2A 3QQVA 3LMDA 3LLWA 2F9KF 4OGUA 1V4HA 3DYGA 3VJDA 3EGTA 5DJPF 3WJKA 4E9ZA 3P8RA 4QPFA 3CKEA 4NFIF 4LZ0A 3ACYA 1VG2A 3VJ9A 3KRFB 3TFPA 3N3DA 3LZ9A 3EFQA 4GA3A 5JV0F 2Z7IA 3IBAA 4PVYF 4XQRF 2PS7A 1YHLA 3TFVA 5IMNA 3WEHA 5ILIA 3P5PA 3ACXA 1YYSA 4KUXA 1N21A 4KVIA 4NKEA 2DH4A 5ERNA 3OACA 3NPRA 3WEIA 4WK5A 2Q9YA 3PH7A 4LLTA 5ILYA 5B0IA 5B0KA 1N22A 4RXCA 3UCAA 3WE9A 3WCDA 4NFKF 4ZQ8A 1V4EA 1YYTA 2AZKA 3M00A 3LGZB 3RBMA 3ZL6A 3KRAA 2Z7HA 2E92A 5JV2F 4N1ZF 4E9UA 5ERMA 3QKCA 5DJRF 1N20A 3WCGA 3Q30A 2EWGA 5ILHA 3SDQA 3DYHA 5EATA 5IM1A 2AEKA 5KSXF 2J1OA 4JXYA 4DWGA 1JFAA 4JZBA 1RQIA 3V1VA 4EA2A 4FJQA 4OMGA 3RMGA 2F94F 2J5CA 3MZVA 3PKOA 3WCJA 4OKZA 4MC3A 2Z52A 5B03A 3WJNA 5ER8A 4Q23A 5EROA 5DJVF 5A0IA 4KVYA 3W7FA 2Z4WA 4P0XA 4OMHA 2ONHA 3KRPB 2E95A 1YHMA 3P41A 2AELA 4RXAA 3KB9A 4GP2A 4KFAA 5ILJA 3ZOUA 3VJCA 3SDVA 4PVXF 1JFGA 1KIZA 3MAVA 3ICZA 2QISA 4LLSA 4LFVF 3LEEA 1RTRA 3ID0A 1YYUA 4LPGF 4NFJF 2AETA 3S4JA 4KQSA 2AZJA 1PS1A 4KPDA 2OPMA 3ASXA 4P0VA 3M01A 2E8UA 4JYXA 4GAXA 2F89F 1VG7A 2Z4VA 3ICNA 2Q9ZA 1N23A 4DEMF 3M02A 1YYQA 4KVDA 3RYEA 3KROB 3LK5A 4LZ3A 3TC1A 5DHKA 3BNXA 5EASA 4F6XA 3VJEA 1DI1A 3VJ8A 4KK2A 1VG3A 3IPIA 3WCCA 5IK0A 2Q80A 1WMWA 4KQUA 4XQSF 2AZLA 5HN9A 1WY0A 5IL8A 5JUZF 4GP1A 3WCLA 2E91A 1RQJA 5DGNF 3PYBA 4MC0A 4OKMA 3KRFA 4JXNA 2ZCSA 3ZMBA 3VJBA 4QXSF 1YHKA 2E8TA 3KRCB 5IMPA 3ICKA 3TS7A 3LSNA 1N1BA 2ZCRA 1YYRA 4LTZA 5AELA 1YV5A 2FTZA 4DZWA 3OABB 3Q1OA 1YQ7A 1N24A 4EA1A 5IL3A 4L2XF 3P5RA 3N1WF 2E90A 1FPSA 3BNYA 2RAHA 3SAEA 4DI5A 2H8OA 4KVWA 3N1VF 4MC8A 5B0LA 3WCIA 3ZCDA 4LPHF 3B7LA 3M0GA 1UBWA 3RYWA 4NG6A 5DGMF 5B02A 2OGDA 4KPJA 4LFEA 3LVSA 2ZEUA 3LOMA 3NRIA 1VG6A 4KKMA 4FP4A 3SDUA 5CG5A 5E8KA 2PS5A 4JZXA 3ZMCA 2VF6A 2ZEVA 3WCAA 3AQCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E8L A;  4LUU A;  3WCE A;  4LXW A;  5A0K A;  2ZY1 A;  3Q2Q A;  3ACW A;  5CG6 A;  3N3L F;  5IKA A;  3M9U A;  3WEJ A;  4LZC A;  5ILD A;  3WC9 A;  1HX9 A;  3AQB B;  5DGS F;  5HN7 A;  2ZCO A;  4LIX A;  5A0J A;  3KRP A;  4DHD A;  3LG5 A;  3WCM A;  5IMI A;  2E8W A;  2Z4X A;  5IN8 A;  4H5E F;  2E94 A;  5DW7 A;  2OPN A;  4LA5 A;  4E1E A;  1EZF A;  4XQT F;  4KWD A;  4RNQ A;  1YJ4 A;  5EAU A;  3V1X A;  3APZ A;  3WCH A;  5IVG A;  3PYA A;  3TFN A;  2F8C F;  3ICM A;  3WEG A;  4LFG A;  3LDW A;  3N5J F;  3WSA A;  2ZCQ A;  4F6V A;  1HM4 A;  3AQ0 A;  4JVJ F;  3OAC B;  3DYF A;  3AE0 A;  5B0M A;  1N1Z A;  4EA0 A;  2E8V A;  1HXG A;  3Q2Z A;  4HD1 A;  5B01 A;  5B00 A;  3P8L A;  3EZ3 A;  5ILK A;  3KRO A;  3PDE A;  1WL0 A;  4NKF A;  4LTV A;  5DHI A;  3KRA B;  2E4O A;  2PS6 A;  3N46 F;  2Z50 A;  3KBK A;  3N5H F;  3VJA A;  1V4J A;  3WCF A;  4RXD A;  3N45 F;  5AYP A;  3CC9 A;  2F92 F;  3N6K F;  1KIY A;  3LGK A;  1V4I A;  2F7M F;  5DIQ F;  3N0G A;  5B0J A;  5AFX A;  3WSB A;  3CP6 A;  2PS8 A;  2Q58 A;  3SDR A;  3WEK A;  5HNA A;  2F8Z F;  3KRC A;  1UBV A;  4LOB A;  4RXE A;  1HXA A;  1HXC A;  2FOR A;  1WL3 A;  1DGP A;  3OAB A;  4N9U A;  3SDT A;  3NPK A;  3LJI A;  2Z4Y A;  1ZW5 A;  5IK6 A;  4DXJ A;  3S9V A;  3OYR A;  3ADZ A;  5ILZ A;  4P0W A;  2E8X A;  5AHU B;  4NUA A;  1V4K A;  3WJO A;  3V66 A;  3WEF A;  5I1U A;  3N49 F;  1WKZ A;  3G4F A;  5HN8 A;  4RYP A;  4DWB A;  4F62 A;  3N0F A;  1UBX A;  2P1C A;  5DZ2 A;  5E8H A;  4H5C F;  4LA6 A;  2ONG A;  5JV1 F;  1VG4 A;  3G4D A;  1WL1 A;  3NF2 A;  4UMJ A;  2J1P A;  1UBY A;  3WCB A;  2PS4 A;  5IKH A;  5JA0 F;  5IK9 A;  2E93 A;  4H5D F;  2I19 A;  1HM7 A;  2Z4Z A;  2O1O A;  2OA6 A;  4K10 A;  4KQ5 A;  5H9D A;  2Z78 A;  5C05 A;  1WL2 A;  3QQV A;  3LMD A;  3LLW A;  2F9K F;  4OGU A;  1V4H A;  3DYG A;  3VJD A;  3EGT A;  5DJP F;  3WJK A;  4E9Z A;  3P8R A;  4QPF A;  3CKE A;  4NFI F;  4LZ0 A;  3ACY A;  1VG2 A;  3VJ9 A;  3KRF B;  3TFP A;  3N3D A;  3LZ9 A;  3EFQ A;  4GA3 A;  5JV0 F;  2Z7I A;  3IBA A;  4PVY F;  4XQR F;  2PS7 A;  1YHL A;  3TFV A;  5IMN A;  3WEH A;  5ILI A;  3P5P A;  3ACX A;  1YYS A;  4KUX A;  1N21 A;  4KVI A;  4NKE A;  2DH4 A;  5ERN A;  3OAC A;  3NPR A;  3WEI A;  4WK5 A;  2Q9Y A;  3PH7 A;  4LLT A;  5ILY A;  5B0I A;  5B0K A;  1N22 A;  4RXC A;  3UCA A;  3WE9 A;  3WCD A;  4NFK F;  4ZQ8 A;  1V4E A;  1YYT A;  2AZK A;  3M00 A;  3LGZ B;  3RBM A;  3ZL6 A;  3KRA A;  2Z7H A;  2E92 A;  5JV2 F;  4N1Z F;  4E9U A;  5ERM A;  3QKC A;  5DJR F;  1N20 A;  3WCG A;  3Q30 A;  2EWG A;  5ILH A;  3SDQ A;  3DYH A;  5EAT A;  5IM1 A;  2AEK A;  5KSX F;  2J1O A;  4JXY A;  4DWG A;  1JFA A;  4JZB A;  1RQI A;  3V1V A;  4EA2 A;  4FJQ A;  4OMG A;  3RMG A;  2F94 F;  2J5C A;  3MZV A;  3PKO A;  3WCJ A;  4OKZ A;  4MC3 A;  2Z52 A;  5B03 A;  3WJN A;  5ER8 A;  4Q23 A;  5ERO A;  5DJV F;  5A0I A;  4KVY A;  3W7F A;  2Z4W A;  4P0X A;  4OMH A;  2ONH A;  3KRP B;  2E95 A;  1YHM A;  3P41 A;  2AEL A;  4RXA A;  3KB9 A;  4GP2 A;  4KFA A;  5ILJ A;  3ZOU A;  3VJC A;  3SDV A;  4PVX F;  1JFG A;  1KIZ A;  3MAV A;  3ICZ A;  2QIS A;  4LLS A;  4LFV F;  3LEE A;  1RTR A;  3ID0 A;  1YYU A;  4LPG F;  4NFJ F;  2AET A;  3S4J A;  4KQS A;  2AZJ A;  1PS1 A;  4KPD A;  2OPM A;  3ASX A;  4P0V A;  3M01 A;  2E8U A;  4JYX A;  4GAX A;  2F89 F;  1VG7 A;  2Z4V A;  3ICN A;  2Q9Z A;  1N23 A;  4DEM F;  3M02 A;  1YYQ A;  4KVD A;  3RYE A;  3KRO B;  3LK5 A;  4LZ3 A;  3TC1 A;  5DHK A;  3BNX A;  5EAS A;  4F6X A;  3VJE A;  1DI1 A;  3VJ8 A;  4KK2 A;  1VG3 A;  3IPI A;  3WCC A;  5IK0 A;  2Q80 A;  1WMW A;  4KQU A;  4XQS F;  2AZL A;  5HN9 A;  1WY0 A;  5IL8 A;  5JUZ F;  4GP1 A;  3WCL A;  2E91 A;  1RQJ A;  5DGN F;  3PYB A;  4MC0 A;  4OKM A;  3KRF A;  4JXN A;  2ZCS A;  3ZMB A;  3VJB A;  4QXS F;  1YHK A;  2E8T A;  3KRC B;  5IMP A;  3ICK A;  3TS7 A;  3LSN A;  1N1B A;  2ZCR A;  1YYR A;  4LTZ A;  5AEL A;  1YV5 A;  2FTZ A;  4DZW A;  3OAB B;  3Q1O A;  1YQ7 A;  1N24 A;  4EA1 A;  5IL3 A;  4L2X F;  3P5R A;  3N1W F;  2E90 A;  1FPS A;  3BNY A;  2RAH A;  3SAE A;  4DI5 A;  2H8O A;  4KVW A;  3N1V F;  4MC8 A;  5B0L A;  3WCI A;  3ZCD A;  4LPH F;  3B7L A;  3M0G A;  1UBW A;  3RYW A;  4NG6 A;  5DGM F;  5B02 A;  2OGD A;  4KPJ A;  4LFE A;  3LVS A;  2ZEU A;  3LOM A;  3NRI A;  1VG6 A;  4KKM A;  4FP4 A;  3SDU A;  5CG5 A;  5E8K A;  2PS5 A;  4JZX A;  3ZMC A;  2VF6 A;  2ZEV A;  3WCA A;  3AQC B; 
#chains in the Genus database with same CATH topology
 5E8L A;  4LUU A;  3WCE A;  4LXW A;  5A0K A;  2ZY1 A;  3Q2Q A;  3ACW A;  5CG6 A;  3N3L F;  5IKA A;  3M9U A;  3WEJ A;  4LZC A;  5ILD A;  3WC9 A;  1HX9 A;  3AQB B;  5DGS F;  5HN7 A;  2ZCO A;  4LIX A;  5A0J A;  3KRP A;  4DHD A;  3LG5 A;  3WCM A;  5IMI A;  2E8W A;  2Z4X A;  5IN8 A;  4H5E F;  2E94 A;  5DW7 A;  2OPN A;  4LA5 A;  4E1E A;  1EZF A;  4XQT F;  4KWD A;  4RNQ A;  1YJ4 A;  5EAU A;  3V1X A;  3APZ A;  3WCH A;  5IVG A;  3PYA A;  3TFN A;  2F8C F;  3ICM A;  3WEG A;  4LFG A;  3LDW A;  3N5J F;  3WSA A;  2ZCQ A;  4F6V A;  1HM4 A;  3AQ0 A;  4JVJ F;  3OAC B;  3DYF A;  3AE0 A;  5B0M A;  1N1Z A;  4EA0 A;  2E8V A;  1HXG A;  3Q2Z A;  4HD1 A;  5B01 A;  5B00 A;  3P8L A;  3EZ3 A;  5ILK A;  3KRO A;  3PDE A;  1WL0 A;  4NKF A;  4LTV A;  5DHI A;  3KRA B;  2E4O A;  2PS6 A;  3N46 F;  2Z50 A;  3KBK A;  3N5H F;  3VJA A;  1V4J A;  3WCF A;  4RXD A;  3N45 F;  5AYP A;  3CC9 A;  2F92 F;  3N6K F;  1KIY A;  3LGK A;  1V4I A;  2F7M F;  5DIQ F;  3N0G A;  5B0J A;  5AFX A;  3WSB A;  3CP6 A;  2PS8 A;  2Q58 A;  3SDR A;  3WEK A;  5HNA A;  2F8Z F;  3KRC A;  1UBV A;  4LOB A;  4RXE A;  1HXA A;  1HXC A;  2FOR A;  1WL3 A;  1DGP A;  3OAB A;  4N9U A;  3SDT A;  3NPK A;  3LJI A;  2Z4Y A;  1ZW5 A;  5IK6 A;  4DXJ A;  3S9V A;  3OYR A;  3ADZ A;  5ILZ A;  4P0W A;  2E8X A;  5AHU B;  4NUA A;  1V4K A;  3WJO A;  3V66 A;  3WEF A;  5I1U A;  3N49 F;  1WKZ A;  3G4F A;  5HN8 A;  4RYP A;  4DWB A;  4F62 A;  3N0F A;  1UBX A;  2P1C A;  5DZ2 A;  5E8H A;  4H5C F;  4LA6 A;  2ONG A;  5JV1 F;  1VG4 A;  3G4D A;  1WL1 A;  3NF2 A;  4UMJ A;  2J1P A;  1UBY A;  3WCB A;  2PS4 A;  5IKH A;  5JA0 F;  5IK9 A;  2E93 A;  4H5D F;  2I19 A;  1HM7 A;  2Z4Z A;  2O1O A;  2OA6 A;  4K10 A;  4KQ5 A;  5H9D A;  2Z78 A;  5C05 A;  1WL2 A;  3QQV A;  3LMD A;  3LLW A;  2F9K F;  4OGU A;  1V4H A;  3DYG A;  3VJD A;  3EGT A;  5DJP F;  3WJK A;  4E9Z A;  3P8R A;  4QPF A;  3CKE A;  4NFI F;  4LZ0 A;  3ACY A;  1VG2 A;  3VJ9 A;  3KRF B;  3TFP A;  3N3D A;  3LZ9 A;  3EFQ A;  4GA3 A;  5JV0 F;  2Z7I A;  3IBA A;  4PVY F;  4XQR F;  2PS7 A;  1YHL A;  3TFV A;  5IMN A;  3WEH A;  5ILI A;  3P5P A;  3ACX A;  1YYS A;  4KUX A;  1N21 A;  4KVI A;  4NKE A;  2DH4 A;  5ERN A;  3OAC A;  3NPR A;  3WEI A;  4WK5 A;  2Q9Y A;  3PH7 A;  4LLT A;  5ILY A;  5B0I A;  5B0K A;  1N22 A;  4RXC A;  3UCA A;  3WE9 A;  3WCD A;  4NFK F;  4ZQ8 A;  1V4E A;  1YYT A;  2AZK A;  3M00 A;  3LGZ B;  3RBM A;  3ZL6 A;  3KRA A;  2Z7H A;  2E92 A;  5JV2 F;  4N1Z F;  4E9U A;  5ERM A;  3QKC A;  5DJR F;  1N20 A;  3WCG A;  3Q30 A;  2EWG A;  5ILH A;  3SDQ A;  3DYH A;  5EAT A;  5IM1 A;  2AEK A;  5KSX F;  2J1O A;  4JXY A;  4DWG A;  1JFA A;  4JZB A;  1RQI A;  3V1V A;  4EA2 A;  4FJQ A;  4OMG A;  3RMG A;  2F94 F;  2J5C A;  3MZV A;  3PKO A;  3WCJ A;  4OKZ A;  4MC3 A;  2Z52 A;  5B03 A;  3WJN A;  5ER8 A;  4Q23 A;  5ERO A;  5DJV F;  5A0I A;  4KVY A;  3W7F A;  2Z4W A;  4P0X A;  4OMH A;  2ONH A;  3KRP B;  2E95 A;  1YHM A;  3P41 A;  2AEL A;  4RXA A;  3KB9 A;  4GP2 A;  4KFA A;  5ILJ A;  3ZOU A;  3VJC A;  3SDV A;  4PVX F;  1JFG A;  1KIZ A;  3MAV A;  3ICZ A;  2QIS A;  4LLS A;  4LFV F;  3LEE A;  1RTR A;  3ID0 A;  1YYU A;  4LPG F;  4NFJ F;  2AET A;  3S4J A;  4KQS A;  2AZJ A;  1PS1 A;  4KPD A;  2OPM A;  3ASX A;  4P0V A;  3M01 A;  2E8U A;  4JYX A;  4GAX A;  2F89 F;  1VG7 A;  2Z4V A;  3ICN A;  2Q9Z A;  1N23 A;  4DEM F;  3M02 A;  1YYQ A;  4KVD A;  3RYE A;  3KRO B;  3LK5 A;  4LZ3 A;  3TC1 A;  5DHK A;  3BNX A;  5EAS A;  4F6X A;  3VJE A;  1DI1 A;  3VJ8 A;  4KK2 A;  1VG3 A;  3IPI A;  3WCC A;  5IK0 A;  2Q80 A;  1WMW A;  4KQU A;  4XQS F;  2AZL A;  5HN9 A;  1WY0 A;  5IL8 A;  5JUZ F;  4GP1 A;  3WCL A;  2E91 A;  1RQJ A;  5DGN F;  3PYB A;  4MC0 A;  4OKM A;  3KRF A;  4JXN A;  2ZCS A;  3ZMB A;  3VJB A;  4QXS F;  1YHK A;  2E8T A;  3KRC B;  5IMP A;  3ICK A;  3TS7 A;  3LSN A;  1N1B A;  2ZCR A;  1YYR A;  4LTZ A;  5AEL A;  1YV5 A;  2FTZ A;  4DZW A;  3OAB B;  3Q1O A;  1YQ7 A;  1N24 A;  4EA1 A;  5IL3 A;  4L2X F;  3P5R A;  3N1W F;  2E90 A;  1FPS A;  3BNY A;  2RAH A;  3SAE A;  4DI5 A;  2H8O A;  4KVW A;  3N1V F;  4MC8 A;  5B0L A;  3WCI A;  3ZCD A;  4LPH F;  3B7L A;  3M0G A;  1UBW A;  3RYW A;  4NG6 A;  5DGM F;  5B02 A;  2OGD A;  4KPJ A;  4LFE A;  3LVS A;  2ZEU A;  3LOM A;  3NRI A;  1VG6 A;  4KKM A;  4FP4 A;  3SDU A;  5CG5 A;  5E8K A;  2PS5 A;  4JZX A;  3ZMC A;  2VF6 A;  2ZEV A;  3WCA A;  3AQC B; 
#chains in the Genus database with same CATH homology
 5E8L A;  4LUU A;  3WCE A;  4LXW A;  5A0K A;  2ZY1 A;  3Q2Q A;  3ACW A;  5CG6 A;  3N3L F;  5IKA A;  3M9U A;  3WEJ A;  4LZC A;  5ILD A;  3WC9 A;  1HX9 A;  3AQB B;  5DGS F;  5HN7 A;  2ZCO A;  4LIX A;  5A0J A;  3KRP A;  4DHD A;  3LG5 A;  3WCM A;  5IMI A;  2E8W A;  2Z4X A;  5IN8 A;  4H5E F;  2E94 A;  5DW7 A;  2OPN A;  4LA5 A;  4E1E A;  1EZF A;  4XQT F;  4KWD A;  4RNQ A;  1YJ4 A;  5EAU A;  3V1X A;  3APZ A;  3WCH A;  5IVG A;  3PYA A;  3TFN A;  2F8C F;  3ICM A;  3WEG A;  4LFG A;  3LDW A;  3N5J F;  3WSA A;  2ZCQ A;  4F6V A;  1HM4 A;  3AQ0 A;  4JVJ F;  3OAC B;  3DYF A;  3AE0 A;  5B0M A;  1N1Z A;  4EA0 A;  2E8V A;  1HXG A;  3Q2Z A;  4HD1 A;  5B01 A;  5B00 A;  3P8L A;  3EZ3 A;  5ILK A;  3KRO A;  3PDE A;  1WL0 A;  4NKF A;  4LTV A;  5DHI A;  3KRA B;  2E4O A;  2PS6 A;  3N46 F;  2Z50 A;  3KBK A;  3N5H F;  3VJA A;  1V4J A;  3WCF A;  4RXD A;  3N45 F;  5AYP A;  3CC9 A;  2F92 F;  3N6K F;  1KIY A;  3LGK A;  1V4I A;  2F7M F;  5DIQ F;  3N0G A;  5B0J A;  5AFX A;  3WSB A;  3CP6 A;  2PS8 A;  2Q58 A;  3SDR A;  3WEK A;  5HNA A;  2F8Z F;  3KRC A;  1UBV A;  4LOB A;  4RXE A;  1HXA A;  1HXC A;  2FOR A;  1WL3 A;  1DGP A;  3OAB A;  4N9U A;  3SDT A;  3NPK A;  3LJI A;  2Z4Y A;  1ZW5 A;  5IK6 A;  4DXJ A;  3S9V A;  3OYR A;  3ADZ A;  5ILZ A;  4P0W A;  2E8X A;  5AHU B;  4NUA A;  1V4K A;  3WJO A;  3V66 A;  3WEF A;  5I1U A;  3N49 F;  1WKZ A;  3G4F A;  5HN8 A;  4RYP A;  4DWB A;  4F62 A;  3N0F A;  1UBX A;  2P1C A;  5DZ2 A;  5E8H A;  4H5C F;  4LA6 A;  2ONG A;  5JV1 F;  1VG4 A;  3G4D A;  1WL1 A;  3NF2 A;  4UMJ A;  2J1P A;  1UBY A;  3WCB A;  2PS4 A;  5IKH A;  5JA0 F;  5IK9 A;  2E93 A;  4H5D F;  2I19 A;  1HM7 A;  2Z4Z A;  2O1O A;  2OA6 A;  4K10 A;  4KQ5 A;  5H9D A;  2Z78 A;  5C05 A;  1WL2 A;  3QQV A;  3LMD A;  3LLW A;  2F9K F;  4OGU A;  1V4H A;  3DYG A;  3VJD A;  3EGT A;  5DJP F;  3WJK A;  4E9Z A;  3P8R A;  4QPF A;  3CKE A;  4NFI F;  4LZ0 A;  3ACY A;  1VG2 A;  3VJ9 A;  3KRF B;  3TFP A;  3N3D A;  3LZ9 A;  3EFQ A;  4GA3 A;  5JV0 F;  2Z7I A;  3IBA A;  4PVY F;  4XQR F;  2PS7 A;  1YHL A;  3TFV A;  5IMN A;  3WEH A;  5ILI A;  3P5P A;  3ACX A;  1YYS A;  4KUX A;  1N21 A;  4KVI A;  4NKE A;  2DH4 A;  5ERN A;  3OAC A;  3NPR A;  3WEI A;  4WK5 A;  2Q9Y A;  3PH7 A;  4LLT A;  5ILY A;  5B0I A;  5B0K A;  1N22 A;  4RXC A;  3UCA A;  3WE9 A;  3WCD A;  4NFK F;  4ZQ8 A;  1V4E A;  1YYT A;  2AZK A;  3M00 A;  3LGZ B;  3RBM A;  3ZL6 A;  3KRA A;  2Z7H A;  2E92 A;  5JV2 F;  4N1Z F;  4E9U A;  5ERM A;  3QKC A;  5DJR F;  1N20 A;  3WCG A;  3Q30 A;  2EWG A;  5ILH A;  3SDQ A;  3DYH A;  5EAT A;  5IM1 A;  2AEK A;  5KSX F;  2J1O A;  4JXY A;  4DWG A;  1JFA A;  4JZB A;  1RQI A;  3V1V A;  4EA2 A;  4FJQ A;  4OMG A;  3RMG A;  2F94 F;  2J5C A;  3MZV A;  3PKO A;  3WCJ A;  4OKZ A;  4MC3 A;  2Z52 A;  5B03 A;  3WJN A;  5ER8 A;  4Q23 A;  5ERO A;  5DJV F;  5A0I A;  4KVY A;  3W7F A;  2Z4W A;  4P0X A;  4OMH A;  2ONH A;  3KRP B;  2E95 A;  1YHM A;  3P41 A;  2AEL A;  4RXA A;  3KB9 A;  4GP2 A;  4KFA A;  5ILJ A;  3ZOU A;  3VJC A;  3SDV A;  4PVX F;  1JFG A;  1KIZ A;  3MAV A;  3ICZ A;  2QIS A;  4LLS A;  4LFV F;  3LEE A;  1RTR A;  3ID0 A;  1YYU A;  4LPG F;  4NFJ F;  2AET A;  3S4J A;  4KQS A;  2AZJ A;  1PS1 A;  4KPD A;  2OPM A;  3ASX A;  4P0V A;  3M01 A;  2E8U A;  4JYX A;  4GAX A;  2F89 F;  1VG7 A;  2Z4V A;  3ICN A;  2Q9Z A;  1N23 A;  4DEM F;  3M02 A;  1YYQ A;  4KVD A;  3RYE A;  3KRO B;  3LK5 A;  4LZ3 A;  3TC1 A;  5DHK A;  3BNX A;  5EAS A;  4F6X A;  3VJE A;  1DI1 A;  3VJ8 A;  4KK2 A;  1VG3 A;  3IPI A;  3WCC A;  5IK0 A;  2Q80 A;  1WMW A;  4KQU A;  4XQS F;  2AZL A;  5HN9 A;  1WY0 A;  5IL8 A;  5JUZ F;  4GP1 A;  3WCL A;  2E91 A;  1RQJ A;  5DGN F;  3PYB A;  4MC0 A;  4OKM A;  3KRF A;  4JXN A;  2ZCS A;  3ZMB A;  3VJB A;  4QXS F;  1YHK A;  2E8T A;  3KRC B;  5IMP A;  3ICK A;  3TS7 A;  3LSN A;  1N1B A;  2ZCR A;  1YYR A;  4LTZ A;  5AEL A;  1YV5 A;  2FTZ A;  4DZW A;  3OAB B;  3Q1O A;  1YQ7 A;  1N24 A;  4EA1 A;  5IL3 A;  4L2X F;  3P5R A;  3N1W F;  2E90 A;  1FPS A;  3BNY A;  2RAH A;  3SAE A;  4DI5 A;  2H8O A;  4KVW A;  3N1V F;  4MC8 A;  5B0L A;  3WCI A;  3ZCD A;  4LPH F;  3B7L A;  3M0G A;  1UBW A;  3RYW A;  4NG6 A;  5DGM F;  5B02 A;  2OGD A;  4KPJ A;  4LFE A;  3LVS A;  2ZEU A;  3LOM A;  3NRI A;  1VG6 A;  4KKM A;  4FP4 A;  3SDU A;  5CG5 A;  5E8K A;  2PS5 A;  4JZX A;  3ZMC A;  2VF6 A;  2ZEV A;  3WCA A;  3AQC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...