3DYGA

T. brucei farnesyl diphosphate synthase complexed with bisphosphonate bph-461
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
367
structure length
358
Chain Sequence
MPMQMFMQVYDEIQMFLLEELELKFDMDPNRVRYLRKMMDTTCLGGKYNRGLTVIDVAESLLSLDGARRKRVLHDACVCGWMIEFLQAHYLVEDDIMDNSVTRRGKPCWYRHPDVTVQCAINDGLLLKSWTHMMAMHFFADRPFLQDLLCRFNRVDYTTAVGQLYDVTSMFDSNKLDPDVSQPTTTDFAEFTLSNYKRIVKYKTAYYTYLLPLVMGLIVSEALPTVDMGVTEELAMLMGEYFQVQDDVMDCFTPPERLGKVGTDIQDAKCSWLAVTFLAKASSAQVAEFKANYGSGDSEKVATVRRLYEEADLQGDYVAYEAAVAEQVKELIEKLRLCSPGFAASVETLWGKTYKRQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords FARNESYL PYROPHOSPHATE SYNTHASE
publication title Lipophilic bisphosphonates as dual farnesyl/geranylgeranyl diphosphate synthase inhibitors: an X-ray and NMR investigation.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 143
structure length 358
sequence length 367
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2008-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3dygA00
3WCMA 3P41A 3WCCA 1UBWA 4H5DF 3G4FA 3LOMA 5DJPF 3Q1OA 1N1ZA 5JV1F 5AYPA 3B7LA 4LPHF 2J1OA 4OGUA 3RYWA 4L2XF 3LGZB 3AQCB 4QPFA 3PDEA 4KVDA 5DHIA 5HNAA 3LZ9A 3ICMA 3OABA 5HN8A 5DJRF 4NKFA 2I19A 4KK2A 2E8XA 5IVGA 5JA0F 3WJKA 1VG2A 1WL0A 4NFKF 3LGKA 2Z78A 2E8TA 2E90A 4RYPA 1WL3A 1UBVA 5B0JA 5ILKA 3ADZA 3LEEA 4JYXA 4EA2A 4ZQ8A 3MAVA 5EROA 3VJAA 4LXWA 4XQSF 3LG5A 3IBAA 2F92F 3N3DA 5DIQF 3ICKA 4JVJF 3BNYA 3V1XA 3NRIA 1UBXA 5B03A 2ZCQA 3NPKA 1YYQA 5DGMF 2F94F 4DI5A 3DYFA 4EA1A 3WSBA 3QKCA 3KRAA 4LPGF 4KUXA 3WCFA 5IL8A 3WCEA 3WCGA 4RNQA 1UBYA 5IKHA 1N20A 2Z4ZA 5ILZA 2PS7A 3ACXA 2E8VA 1HXAA 3PYAA 5JV0F 4MC8A 3APZA 4LZ3A 4EA0A 2VF6A 4GAXA 1RQIA 2Z4XA 1HX9A 5IKAA 3RMGA 1KIZA 4H5CF 2AZLA 2Z7IA 4KFAA 3TFPA 5ILIA 3ACWA 5ER8A 2H8OA 1V4HA 3ZMBA 2EWGA 3KROB 3WCHA 5B01A 2DH4A 3LSNA 3Q2QA 3WCJA 3AQ0A 4XQRF 3S4JA 5I1UA 4UMJA 5AFXA 5ILYA 5H9DA 2FTZA 2O1OA 3OYRA 5IK6A 3KRPA 4NKEA 3N49F 5DHKA 5JUZF 3BNXA 5E8LA 3WCDA 4DWGA 1WKZA 3Q30A 5DW7A 4E1EA 3OABB 2OPMA 4KQ5A 5DGSF 5JV2F 4DHDA 3LDWA 5DZ2A 1YYRA 5CG5A 4LOBA 5IMIA 5C05A 2Z4YA 3LJIA 3KRCA 1VG3A 3WE9A 1ZW5A 4GP1A 3N6KF 3W7FA 4JZXA 5HN7A 1V4KA 5ERMA 1N22A 3M9UA 3KB9A 3LMDA 1JFAA 3NPRA 2E92A 2OPNA 2Q58A 1VG7A 1YV5A 1YHMA 5IK9A 4GA3A 3SDRA 4KQUA 3N0GA 3M01A 5B0IA 3ZOUA 3KBKA 1V4JA 2F8ZF 3KRAB 4JXYA 5EATA 4F6XA 1JFGA 4LA6A 3N0FA 4RXEA 3WEKA 4KWDA 3VJ9A 4E9ZA 2F8CF 4OKMA 5B02A 5ERNA 3P8LA 3CP6A 3M0GA 1VG4A 3OACA 3ASXA 1HXGA 3PKOA 5A0KA 5B0MA 2AEKA 1N23A 2ZCSA 3CKEA 3V1VA 4DZWA 3N5JF 2F89F 4LZ0A 3RBMA 4LA5A 3Q2ZA 5E8KA 2QISA 2E8WA 3KRFA 3WEIA 1DGPA 1VG6A 2PS8A 4LFVF 4KKMA 5AHUB 2F7MF 3ZL6A 3VJDA 3P5RA 3KRPB 2J1PA 2RAHA 2Z52A 4F6VA 4JZBA 3LK5A 1YJ4A 4N9UA 4OMHA 5EAUA 5B0KA 3QQVA 4HD1A 3UCAA 1FPSA 1PS1A 3ICNA 3N3LF 4RXCA 2OGDA 2Z7HA 2ZCRA 2Z50A 1N21A 3WC9A 5ILJA 1YHLA 5IMPA 3KRCB 4WK5A 4DWBA 3MZVA 2ZEUA 1RTRA 3WCBA 3SDTA 4LZCA 4KQSA 4MC3A 3VJCA 3EZ3A 5IL3A 2E8UA 2J5CA 2P1CA 3DYGA 2Q9ZA 3DYHA 4OKZA 1WL1A 3VJ8A 2FORA 4LFGA 4NFJF 3VJEA 5DGNF 4DEMF 4PVXF 4KVWA 3SDQA 3TFVA 3WEHA 1V4EA 1N1BA 5E8HA 4NFIF 1YYUA 4P0VA 2ONGA 3ICZA 4E9UA 3LLWA 4QXSF 5KSXF 3M00A 4H5EF 3OACB 2AELA 5EASA 5HN9A 1KIYA 3AQBB 4Q23A 2OA6A 3WEFA 2Q9YA 2ZCOA 3SAEA 5IK0A 3N1WF 3WEJA 1YHKA 3WCIA 3KRFB 3WCAA 3WCLA 2Q80A 5AELA 1WL2A 3ID0A 3TC1A 2Z4WA 3EFQA 4KVYA 1HM7A 5ILHA 3NF2A 4P0XA 3TFNA 3WSAA 1YQ7A 4NG6A 1N24A 4KPDA 4NUAA 3PH7A 1YYSA 5CG6A 3N45F 1WY0A 4LFEA 2E94A 3WJOA 1V4IA 2E91A 4F62A 3PYBA 3P5PA 1EZFA 3P8RA 4FP4A 5ILDA 3CC9A 4MC0A 3VJBA 4P0WA 3N1VF 5IMNA 1YYTA 2E4OA 1DI1A 2PS5A 3G4DA 4K10A 2AZJA 3SDVA 3LVSA 4OMGA 3N5HF 2AETA 4LLSA 4GP2A 3RYEA 4DXJA 5B00A 2E93A 5A0JA 3ZMCA 3V66A 2PS4A 4LIXA 3N46F 1HXCA 3TS7A 4KVIA 2ZEVA 1WMWA 5B0LA 1HM4A 4JXNA 2E95A 2F9KF 4FJQA 3WEGA 5DJVF 4PVYF 1RQJA 5IN8A 3WJNA 3AE0A 4KPJA 3M02A 2PS6A 2Z4VA 3ZCDA 2ZY1A 4RXDA 3ACYA 3S9VA 5A0IA 3IPIA 4LTVA 3EGTA 2ONHA 4XQTF 4LUUA 5IM1A 2AZKA 4RXAA 3SDUA 4N1ZF 4LLTA 4LTZA 3KROA
chains in the Genus database with same CATH superfamily
3WCMA 3P41A 3WCCA 1UBWA 4H5DF 3G4FA 3LOMA 5DJPF 3Q1OA 1N1ZA 5JV1F 5AYPA 3B7LA 4LPHF 2J1OA 4OGUA 3RYWA 4L2XF 3LGZB 3AQCB 4QPFA 3PDEA 4KVDA 5DHIA 5HNAA 3LZ9A 3ICMA 3OABA 5HN8A 5DJRF 4NKFA 2I19A 4KK2A 2E8XA 5IVGA 5JA0F 3WJKA 1VG2A 1WL0A 4NFKF 3LGKA 2Z78A 2E8TA 2E90A 4RYPA 1WL3A 1UBVA 5B0JA 5ILKA 3ADZA 3LEEA 4JYXA 4EA2A 4ZQ8A 3MAVA 5EROA 3VJAA 4LXWA 4XQSF 3LG5A 3IBAA 2F92F 3N3DA 5DIQF 3ICKA 4JVJF 3BNYA 3V1XA 3NRIA 1UBXA 5B03A 2ZCQA 3NPKA 1YYQA 5DGMF 2F94F 4DI5A 3DYFA 4EA1A 3WSBA 3QKCA 3KRAA 4LPGF 4KUXA 3WCFA 5IL8A 3WCEA 3WCGA 4RNQA 1UBYA 5IKHA 1N20A 2Z4ZA 5ILZA 2PS7A 3ACXA 2E8VA 1HXAA 3PYAA 5JV0F 4MC8A 3APZA 4LZ3A 4EA0A 2VF6A 4GAXA 1RQIA 2Z4XA 1HX9A 5IKAA 3RMGA 1KIZA 4H5CF 2AZLA 2Z7IA 4KFAA 3TFPA 5ILIA 3ACWA 5ER8A 2H8OA 1V4HA 3ZMBA 2EWGA 3KROB 3WCHA 5B01A 2DH4A 3LSNA 3Q2QA 3WCJA 3AQ0A 4XQRF 3S4JA 5I1UA 4UMJA 5AFXA 5ILYA 5H9DA 2FTZA 2O1OA 3OYRA 5IK6A 3KRPA 4NKEA 3N49F 5DHKA 5JUZF 3BNXA 5E8LA 3WCDA 4DWGA 1WKZA 3Q30A 5DW7A 4E1EA 3OABB 2OPMA 4KQ5A 5DGSF 5JV2F 4DHDA 3LDWA 5DZ2A 1YYRA 5CG5A 4LOBA 5IMIA 5C05A 2Z4YA 3LJIA 3KRCA 1VG3A 3WE9A 1ZW5A 4GP1A 3N6KF 3W7FA 4JZXA 5HN7A 1V4KA 5ERMA 1N22A 3M9UA 3KB9A 3LMDA 1JFAA 3NPRA 2E92A 2OPNA 2Q58A 1VG7A 1YV5A 1YHMA 5IK9A 4GA3A 3SDRA 4KQUA 3N0GA 3M01A 5B0IA 3ZOUA 3KBKA 1V4JA 2F8ZF 3KRAB 4JXYA 5EATA 4F6XA 1JFGA 4LA6A 3N0FA 4RXEA 3WEKA 4KWDA 3VJ9A 4E9ZA 2F8CF 4OKMA 5B02A 5ERNA 3P8LA 3CP6A 3M0GA 1VG4A 3OACA 3ASXA 1HXGA 3PKOA 5A0KA 5B0MA 2AEKA 1N23A 2ZCSA 3CKEA 3V1VA 4DZWA 3N5JF 2F89F 4LZ0A 3RBMA 4LA5A 3Q2ZA 5E8KA 2QISA 2E8WA 3KRFA 3WEIA 1DGPA 1VG6A 2PS8A 4LFVF 4KKMA 5AHUB 2F7MF 3ZL6A 3VJDA 3P5RA 3KRPB 2J1PA 2RAHA 2Z52A 4F6VA 4JZBA 3LK5A 1YJ4A 4N9UA 4OMHA 5EAUA 5B0KA 3QQVA 4HD1A 3UCAA 1FPSA 1PS1A 3ICNA 3N3LF 4RXCA 2OGDA 2Z7HA 2ZCRA 2Z50A 1N21A 3WC9A 5ILJA 1YHLA 5IMPA 3KRCB 4WK5A 4DWBA 3MZVA 2ZEUA 1RTRA 3WCBA 3SDTA 4LZCA 4KQSA 4MC3A 3VJCA 3EZ3A 5IL3A 2E8UA 2J5CA 2P1CA 3DYGA 2Q9ZA 3DYHA 4OKZA 1WL1A 3VJ8A 2FORA 4LFGA 4NFJF 3VJEA 5DGNF 4DEMF 4PVXF 4KVWA 3SDQA 3TFVA 3WEHA 1V4EA 1N1BA 5E8HA 4NFIF 1YYUA 4P0VA 2ONGA 3ICZA 4E9UA 3LLWA 4QXSF 5KSXF 3M00A 4H5EF 3OACB 2AELA 5EASA 5HN9A 1KIYA 3AQBB 4Q23A 2OA6A 3WEFA 2Q9YA 2ZCOA 3SAEA 5IK0A 3N1WF 3WEJA 1YHKA 3WCIA 3KRFB 3WCAA 3WCLA 2Q80A 5AELA 1WL2A 3ID0A 3TC1A 2Z4WA 3EFQA 4KVYA 1HM7A 5ILHA 3NF2A 4P0XA 3TFNA 3WSAA 1YQ7A 4NG6A 1N24A 4KPDA 4NUAA 3PH7A 1YYSA 5CG6A 3N45F 1WY0A 4LFEA 2E94A 3WJOA 1V4IA 2E91A 4F62A 3PYBA 3P5PA 1EZFA 3P8RA 4FP4A 5ILDA 3CC9A 4MC0A 3VJBA 4P0WA 3N1VF 5IMNA 1YYTA 2E4OA 1DI1A 2PS5A 3G4DA 4K10A 2AZJA 3SDVA 3LVSA 4OMGA 3N5HF 2AETA 4LLSA 4GP2A 3RYEA 4DXJA 5B00A 2E93A 5A0JA 3ZMCA 3V66A 2PS4A 4LIXA 3N46F 1HXCA 3TS7A 4KVIA 2ZEVA 1WMWA 5B0LA 1HM4A 4JXNA 2E95A 2F9KF 4FJQA 3WEGA 5DJVF 4PVYF 1RQJA 5IN8A 3WJNA 3AE0A 4KPJA 3M02A 2PS6A 2Z4VA 3ZCDA 2ZY1A 4RXDA 3ACYA 3S9VA 5A0IA 3IPIA 4LTVA 3EGTA 2ONHA 4XQTF 4LUUA 5IM1A 2AZKA 4RXAA 3SDUA 4N1ZF 4LLTA 4LTZA 3KROA
chains in the Genus database with same CATH topology
3WCMA 3P41A 3WCCA 1UBWA 4H5DF 3G4FA 3LOMA 5DJPF 3Q1OA 1N1ZA 5JV1F 5AYPA 3B7LA 4LPHF 2J1OA 4OGUA 3RYWA 4L2XF 3LGZB 3AQCB 4QPFA 3PDEA 4KVDA 5DHIA 5HNAA 3LZ9A 3ICMA 3OABA 5HN8A 5DJRF 4NKFA 2I19A 4KK2A 2E8XA 5IVGA 5JA0F 3WJKA 1VG2A 1WL0A 4NFKF 3LGKA 2Z78A 2E8TA 2E90A 4RYPA 1WL3A 1UBVA 5B0JA 5ILKA 3ADZA 3LEEA 4JYXA 4EA2A 4ZQ8A 3MAVA 5EROA 3VJAA 4LXWA 4XQSF 3LG5A 3IBAA 2F92F 3N3DA 5DIQF 3ICKA 4JVJF 3BNYA 3V1XA 3NRIA 1UBXA 5B03A 2ZCQA 3NPKA 1YYQA 5DGMF 2F94F 4DI5A 3DYFA 4EA1A 3WSBA 3QKCA 3KRAA 4LPGF 4KUXA 3WCFA 5IL8A 3WCEA 3WCGA 4RNQA 1UBYA 5IKHA 1N20A 2Z4ZA 5ILZA 2PS7A 3ACXA 2E8VA 1HXAA 3PYAA 5JV0F 4MC8A 3APZA 4LZ3A 4EA0A 2VF6A 4GAXA 1RQIA 2Z4XA 1HX9A 5IKAA 3RMGA 1KIZA 4H5CF 2AZLA 2Z7IA 4KFAA 3TFPA 5ILIA 3ACWA 5ER8A 2H8OA 1V4HA 3ZMBA 2EWGA 3KROB 3WCHA 5B01A 2DH4A 3LSNA 3Q2QA 3WCJA 3AQ0A 4XQRF 3S4JA 5I1UA 4UMJA 5AFXA 5ILYA 5H9DA 2FTZA 2O1OA 3OYRA 5IK6A 3KRPA 4NKEA 3N49F 5DHKA 5JUZF 3BNXA 5E8LA 3WCDA 4DWGA 1WKZA 3Q30A 5DW7A 4E1EA 3OABB 2OPMA 4KQ5A 5DGSF 5JV2F 4DHDA 3LDWA 5DZ2A 1YYRA 5CG5A 4LOBA 5IMIA 5C05A 2Z4YA 3LJIA 3KRCA 1VG3A 3WE9A 1ZW5A 4GP1A 3N6KF 3W7FA 4JZXA 5HN7A 1V4KA 5ERMA 1N22A 3M9UA 3KB9A 3LMDA 1JFAA 3NPRA 2E92A 2OPNA 2Q58A 1VG7A 1YV5A 1YHMA 5IK9A 4GA3A 3SDRA 4KQUA 3N0GA 3M01A 5B0IA 3ZOUA 3KBKA 1V4JA 2F8ZF 3KRAB 4JXYA 5EATA 4F6XA 1JFGA 4LA6A 3N0FA 4RXEA 3WEKA 4KWDA 3VJ9A 4E9ZA 2F8CF 4OKMA 5B02A 5ERNA 3P8LA 3CP6A 3M0GA 1VG4A 3OACA 3ASXA 1HXGA 3PKOA 5A0KA 5B0MA 2AEKA 1N23A 2ZCSA 3CKEA 3V1VA 4DZWA 3N5JF 2F89F 4LZ0A 3RBMA 4LA5A 3Q2ZA 5E8KA 2QISA 2E8WA 3KRFA 3WEIA 1DGPA 1VG6A 2PS8A 4LFVF 4KKMA 5AHUB 2F7MF 3ZL6A 3VJDA 3P5RA 3KRPB 2J1PA 2RAHA 2Z52A 4F6VA 4JZBA 3LK5A 1YJ4A 4N9UA 4OMHA 5EAUA 5B0KA 3QQVA 4HD1A 3UCAA 1FPSA 1PS1A 3ICNA 3N3LF 4RXCA 2OGDA 2Z7HA 2ZCRA 2Z50A 1N21A 3WC9A 5ILJA 1YHLA 5IMPA 3KRCB 4WK5A 4DWBA 3MZVA 2ZEUA 1RTRA 3WCBA 3SDTA 4LZCA 4KQSA 4MC3A 3VJCA 3EZ3A 5IL3A 2E8UA 2J5CA 2P1CA 3DYGA 2Q9ZA 3DYHA 4OKZA 1WL1A 3VJ8A 2FORA 4LFGA 4NFJF 3VJEA 5DGNF 4DEMF 4PVXF 4KVWA 3SDQA 3TFVA 3WEHA 1V4EA 1N1BA 5E8HA 4NFIF 1YYUA 4P0VA 2ONGA 3ICZA 4E9UA 3LLWA 4QXSF 5KSXF 3M00A 4H5EF 3OACB 2AELA 5EASA 5HN9A 1KIYA 3AQBB 4Q23A 2OA6A 3WEFA 2Q9YA 2ZCOA 3SAEA 5IK0A 3N1WF 3WEJA 1YHKA 3WCIA 3KRFB 3WCAA 3WCLA 2Q80A 5AELA 1WL2A 3ID0A 3TC1A 2Z4WA 3EFQA 4KVYA 1HM7A 5ILHA 3NF2A 4P0XA 3TFNA 3WSAA 1YQ7A 4NG6A 1N24A 4KPDA 4NUAA 3PH7A 1YYSA 5CG6A 3N45F 1WY0A 4LFEA 2E94A 3WJOA 1V4IA 2E91A 4F62A 3PYBA 3P5PA 1EZFA 3P8RA 4FP4A 5ILDA 3CC9A 4MC0A 3VJBA 4P0WA 3N1VF 5IMNA 1YYTA 2E4OA 1DI1A 2PS5A 3G4DA 4K10A 2AZJA 3SDVA 3LVSA 4OMGA 3N5HF 2AETA 4LLSA 4GP2A 3RYEA 4DXJA 5B00A 2E93A 5A0JA 3ZMCA 3V66A 2PS4A 4LIXA 3N46F 1HXCA 3TS7A 4KVIA 2ZEVA 1WMWA 5B0LA 1HM4A 4JXNA 2E95A 2F9KF 4FJQA 3WEGA 5DJVF 4PVYF 1RQJA 5IN8A 3WJNA 3AE0A 4KPJA 3M02A 2PS6A 2Z4VA 3ZCDA 2ZY1A 4RXDA 3ACYA 3S9VA 5A0IA 3IPIA 4LTVA 3EGTA 2ONHA 4XQTF 4LUUA 5IM1A 2AZKA 4RXAA 3SDUA 4N1ZF 4LLTA 4LTZA 3KROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCM A;  3P41 A;  3WCC A;  1UBW A;  4H5D F;  3G4F A;  3LOM A;  5DJP F;  3Q1O A;  1N1Z A;  5JV1 F;  5AYP A;  3B7L A;  4LPH F;  2J1O A;  4OGU A;  3RYW A;  4L2X F;  3LGZ B;  3AQC B;  4QPF A;  3PDE A;  4KVD A;  5DHI A;  5HNA A;  3LZ9 A;  3ICM A;  3OAB A;  5HN8 A;  5DJR F;  4NKF A;  2I19 A;  4KK2 A;  2E8X A;  5IVG A;  5JA0 F;  3WJK A;  1VG2 A;  1WL0 A;  4NFK F;  3LGK A;  2Z78 A;  2E8T A;  2E90 A;  4RYP A;  1WL3 A;  1UBV A;  5B0J A;  5ILK A;  3ADZ A;  3LEE A;  4JYX A;  4EA2 A;  4ZQ8 A;  3MAV A;  5ERO A;  3VJA A;  4LXW A;  4XQS F;  3LG5 A;  3IBA A;  2F92 F;  3N3D A;  5DIQ F;  3ICK A;  4JVJ F;  3BNY A;  3V1X A;  3NRI A;  1UBX A;  5B03 A;  2ZCQ A;  3NPK A;  1YYQ A;  5DGM F;  2F94 F;  4DI5 A;  3DYF A;  4EA1 A;  3WSB A;  3QKC A;  3KRA A;  4LPG F;  4KUX A;  3WCF A;  5IL8 A;  3WCE A;  3WCG A;  4RNQ A;  1UBY A;  5IKH A;  1N20 A;  2Z4Z A;  5ILZ A;  2PS7 A;  3ACX A;  2E8V A;  1HXA A;  3PYA A;  5JV0 F;  4MC8 A;  3APZ A;  4LZ3 A;  4EA0 A;  2VF6 A;  4GAX A;  1RQI A;  2Z4X A;  1HX9 A;  5IKA A;  3RMG A;  1KIZ A;  4H5C F;  2AZL A;  2Z7I A;  4KFA A;  3TFP A;  5ILI A;  3ACW A;  5ER8 A;  2H8O A;  1V4H A;  3ZMB A;  2EWG A;  3KRO B;  3WCH A;  5B01 A;  2DH4 A;  3LSN A;  3Q2Q A;  3WCJ A;  3AQ0 A;  4XQR F;  3S4J A;  5I1U A;  4UMJ A;  5AFX A;  5ILY A;  5H9D A;  2FTZ A;  2O1O A;  3OYR A;  5IK6 A;  3KRP A;  4NKE A;  3N49 F;  5DHK A;  5JUZ F;  3BNX A;  5E8L A;  3WCD A;  4DWG A;  1WKZ A;  3Q30 A;  5DW7 A;  4E1E A;  3OAB B;  2OPM A;  4KQ5 A;  5DGS F;  5JV2 F;  4DHD A;  3LDW A;  5DZ2 A;  1YYR A;  5CG5 A;  4LOB A;  5IMI A;  5C05 A;  2Z4Y A;  3LJI A;  3KRC A;  1VG3 A;  3WE9 A;  1ZW5 A;  4GP1 A;  3N6K F;  3W7F A;  4JZX A;  5HN7 A;  1V4K A;  5ERM A;  1N22 A;  3M9U A;  3KB9 A;  3LMD A;  1JFA A;  3NPR A;  2E92 A;  2OPN A;  2Q58 A;  1VG7 A;  1YV5 A;  1YHM A;  5IK9 A;  4GA3 A;  3SDR A;  4KQU A;  3N0G A;  3M01 A;  5B0I A;  3ZOU A;  3KBK A;  1V4J A;  2F8Z F;  3KRA B;  4JXY A;  5EAT A;  4F6X A;  1JFG A;  4LA6 A;  3N0F A;  4RXE A;  3WEK A;  4KWD A;  3VJ9 A;  4E9Z A;  2F8C F;  4OKM A;  5B02 A;  5ERN A;  3P8L A;  3CP6 A;  3M0G A;  1VG4 A;  3OAC A;  3ASX A;  1HXG A;  3PKO A;  5A0K A;  5B0M A;  2AEK A;  1N23 A;  2ZCS A;  3CKE A;  3V1V A;  4DZW A;  3N5J F;  2F89 F;  4LZ0 A;  3RBM A;  4LA5 A;  3Q2Z A;  5E8K A;  2QIS A;  2E8W A;  3KRF A;  3WEI A;  1DGP A;  1VG6 A;  2PS8 A;  4LFV F;  4KKM A;  5AHU B;  2F7M F;  3ZL6 A;  3VJD A;  3P5R A;  3KRP B;  2J1P A;  2RAH A;  2Z52 A;  4F6V A;  4JZB A;  3LK5 A;  1YJ4 A;  4N9U A;  4OMH A;  5EAU A;  5B0K A;  3QQV A;  4HD1 A;  3UCA A;  1FPS A;  1PS1 A;  3ICN A;  3N3L F;  4RXC A;  2OGD A;  2Z7H A;  2ZCR A;  2Z50 A;  1N21 A;  3WC9 A;  5ILJ A;  1YHL A;  5IMP A;  3KRC B;  4WK5 A;  4DWB A;  3MZV A;  2ZEU A;  1RTR A;  3WCB A;  3SDT A;  4LZC A;  4KQS A;  4MC3 A;  3VJC A;  3EZ3 A;  5IL3 A;  2E8U A;  2J5C A;  2P1C A;  3DYG A;  2Q9Z A;  3DYH A;  4OKZ A;  1WL1 A;  3VJ8 A;  2FOR A;  4LFG A;  4NFJ F;  3VJE A;  5DGN F;  4DEM F;  4PVX F;  4KVW A;  3SDQ A;  3TFV A;  3WEH A;  1V4E A;  1N1B A;  5E8H A;  4NFI F;  1YYU A;  4P0V A;  2ONG A;  3ICZ A;  4E9U A;  3LLW A;  4QXS F;  5KSX F;  3M00 A;  4H5E F;  3OAC B;  2AEL A;  5EAS A;  5HN9 A;  1KIY A;  3AQB B;  4Q23 A;  2OA6 A;  3WEF A;  2Q9Y A;  2ZCO A;  3SAE A;  5IK0 A;  3N1W F;  3WEJ A;  1YHK A;  3WCI A;  3KRF B;  3WCA A;  3WCL A;  2Q80 A;  5AEL A;  1WL2 A;  3ID0 A;  3TC1 A;  2Z4W A;  3EFQ A;  4KVY A;  1HM7 A;  5ILH A;  3NF2 A;  4P0X A;  3TFN A;  3WSA A;  1YQ7 A;  4NG6 A;  1N24 A;  4KPD A;  4NUA A;  3PH7 A;  1YYS A;  5CG6 A;  3N45 F;  1WY0 A;  4LFE A;  2E94 A;  3WJO A;  1V4I A;  2E91 A;  4F62 A;  3PYB A;  3P5P A;  1EZF A;  3P8R A;  4FP4 A;  5ILD A;  3CC9 A;  4MC0 A;  3VJB A;  4P0W A;  3N1V F;  5IMN A;  1YYT A;  2E4O A;  1DI1 A;  2PS5 A;  3G4D A;  4K10 A;  2AZJ A;  3SDV A;  3LVS A;  4OMG A;  3N5H F;  2AET A;  4LLS A;  4GP2 A;  3RYE A;  4DXJ A;  5B00 A;  2E93 A;  5A0J A;  3ZMC A;  3V66 A;  2PS4 A;  4LIX A;  3N46 F;  1HXC A;  3TS7 A;  4KVI A;  2ZEV A;  1WMW A;  5B0L A;  1HM4 A;  4JXN A;  2E95 A;  2F9K F;  4FJQ A;  3WEG A;  5DJV F;  4PVY F;  1RQJ A;  5IN8 A;  3WJN A;  3AE0 A;  4KPJ A;  3M02 A;  2PS6 A;  2Z4V A;  3ZCD A;  2ZY1 A;  4RXD A;  3ACY A;  3S9V A;  5A0I A;  3IPI A;  4LTV A;  3EGT A;  2ONH A;  4XQT F;  4LUU A;  5IM1 A;  2AZK A;  4RXA A;  3SDU A;  4N1Z F;  4LLT A;  4LTZ A;  3KRO A; 
#chains in the Genus database with same CATH topology
 3WCM A;  3P41 A;  3WCC A;  1UBW A;  4H5D F;  3G4F A;  3LOM A;  5DJP F;  3Q1O A;  1N1Z A;  5JV1 F;  5AYP A;  3B7L A;  4LPH F;  2J1O A;  4OGU A;  3RYW A;  4L2X F;  3LGZ B;  3AQC B;  4QPF A;  3PDE A;  4KVD A;  5DHI A;  5HNA A;  3LZ9 A;  3ICM A;  3OAB A;  5HN8 A;  5DJR F;  4NKF A;  2I19 A;  4KK2 A;  2E8X A;  5IVG A;  5JA0 F;  3WJK A;  1VG2 A;  1WL0 A;  4NFK F;  3LGK A;  2Z78 A;  2E8T A;  2E90 A;  4RYP A;  1WL3 A;  1UBV A;  5B0J A;  5ILK A;  3ADZ A;  3LEE A;  4JYX A;  4EA2 A;  4ZQ8 A;  3MAV A;  5ERO A;  3VJA A;  4LXW A;  4XQS F;  3LG5 A;  3IBA A;  2F92 F;  3N3D A;  5DIQ F;  3ICK A;  4JVJ F;  3BNY A;  3V1X A;  3NRI A;  1UBX A;  5B03 A;  2ZCQ A;  3NPK A;  1YYQ A;  5DGM F;  2F94 F;  4DI5 A;  3DYF A;  4EA1 A;  3WSB A;  3QKC A;  3KRA A;  4LPG F;  4KUX A;  3WCF A;  5IL8 A;  3WCE A;  3WCG A;  4RNQ A;  1UBY A;  5IKH A;  1N20 A;  2Z4Z A;  5ILZ A;  2PS7 A;  3ACX A;  2E8V A;  1HXA A;  3PYA A;  5JV0 F;  4MC8 A;  3APZ A;  4LZ3 A;  4EA0 A;  2VF6 A;  4GAX A;  1RQI A;  2Z4X A;  1HX9 A;  5IKA A;  3RMG A;  1KIZ A;  4H5C F;  2AZL A;  2Z7I A;  4KFA A;  3TFP A;  5ILI A;  3ACW A;  5ER8 A;  2H8O A;  1V4H A;  3ZMB A;  2EWG A;  3KRO B;  3WCH A;  5B01 A;  2DH4 A;  3LSN A;  3Q2Q A;  3WCJ A;  3AQ0 A;  4XQR F;  3S4J A;  5I1U A;  4UMJ A;  5AFX A;  5ILY A;  5H9D A;  2FTZ A;  2O1O A;  3OYR A;  5IK6 A;  3KRP A;  4NKE A;  3N49 F;  5DHK A;  5JUZ F;  3BNX A;  5E8L A;  3WCD A;  4DWG A;  1WKZ A;  3Q30 A;  5DW7 A;  4E1E A;  3OAB B;  2OPM A;  4KQ5 A;  5DGS F;  5JV2 F;  4DHD A;  3LDW A;  5DZ2 A;  1YYR A;  5CG5 A;  4LOB A;  5IMI A;  5C05 A;  2Z4Y A;  3LJI A;  3KRC A;  1VG3 A;  3WE9 A;  1ZW5 A;  4GP1 A;  3N6K F;  3W7F A;  4JZX A;  5HN7 A;  1V4K A;  5ERM A;  1N22 A;  3M9U A;  3KB9 A;  3LMD A;  1JFA A;  3NPR A;  2E92 A;  2OPN A;  2Q58 A;  1VG7 A;  1YV5 A;  1YHM A;  5IK9 A;  4GA3 A;  3SDR A;  4KQU A;  3N0G A;  3M01 A;  5B0I A;  3ZOU A;  3KBK A;  1V4J A;  2F8Z F;  3KRA B;  4JXY A;  5EAT A;  4F6X A;  1JFG A;  4LA6 A;  3N0F A;  4RXE A;  3WEK A;  4KWD A;  3VJ9 A;  4E9Z A;  2F8C F;  4OKM A;  5B02 A;  5ERN A;  3P8L A;  3CP6 A;  3M0G A;  1VG4 A;  3OAC A;  3ASX A;  1HXG A;  3PKO A;  5A0K A;  5B0M A;  2AEK A;  1N23 A;  2ZCS A;  3CKE A;  3V1V A;  4DZW A;  3N5J F;  2F89 F;  4LZ0 A;  3RBM A;  4LA5 A;  3Q2Z A;  5E8K A;  2QIS A;  2E8W A;  3KRF A;  3WEI A;  1DGP A;  1VG6 A;  2PS8 A;  4LFV F;  4KKM A;  5AHU B;  2F7M F;  3ZL6 A;  3VJD A;  3P5R A;  3KRP B;  2J1P A;  2RAH A;  2Z52 A;  4F6V A;  4JZB A;  3LK5 A;  1YJ4 A;  4N9U A;  4OMH A;  5EAU A;  5B0K A;  3QQV A;  4HD1 A;  3UCA A;  1FPS A;  1PS1 A;  3ICN A;  3N3L F;  4RXC A;  2OGD A;  2Z7H A;  2ZCR A;  2Z50 A;  1N21 A;  3WC9 A;  5ILJ A;  1YHL A;  5IMP A;  3KRC B;  4WK5 A;  4DWB A;  3MZV A;  2ZEU A;  1RTR A;  3WCB A;  3SDT A;  4LZC A;  4KQS A;  4MC3 A;  3VJC A;  3EZ3 A;  5IL3 A;  2E8U A;  2J5C A;  2P1C A;  3DYG A;  2Q9Z A;  3DYH A;  4OKZ A;  1WL1 A;  3VJ8 A;  2FOR A;  4LFG A;  4NFJ F;  3VJE A;  5DGN F;  4DEM F;  4PVX F;  4KVW A;  3SDQ A;  3TFV A;  3WEH A;  1V4E A;  1N1B A;  5E8H A;  4NFI F;  1YYU A;  4P0V A;  2ONG A;  3ICZ A;  4E9U A;  3LLW A;  4QXS F;  5KSX F;  3M00 A;  4H5E F;  3OAC B;  2AEL A;  5EAS A;  5HN9 A;  1KIY A;  3AQB B;  4Q23 A;  2OA6 A;  3WEF A;  2Q9Y A;  2ZCO A;  3SAE A;  5IK0 A;  3N1W F;  3WEJ A;  1YHK A;  3WCI A;  3KRF B;  3WCA A;  3WCL A;  2Q80 A;  5AEL A;  1WL2 A;  3ID0 A;  3TC1 A;  2Z4W A;  3EFQ A;  4KVY A;  1HM7 A;  5ILH A;  3NF2 A;  4P0X A;  3TFN A;  3WSA A;  1YQ7 A;  4NG6 A;  1N24 A;  4KPD A;  4NUA A;  3PH7 A;  1YYS A;  5CG6 A;  3N45 F;  1WY0 A;  4LFE A;  2E94 A;  3WJO A;  1V4I A;  2E91 A;  4F62 A;  3PYB A;  3P5P A;  1EZF A;  3P8R A;  4FP4 A;  5ILD A;  3CC9 A;  4MC0 A;  3VJB A;  4P0W A;  3N1V F;  5IMN A;  1YYT A;  2E4O A;  1DI1 A;  2PS5 A;  3G4D A;  4K10 A;  2AZJ A;  3SDV A;  3LVS A;  4OMG A;  3N5H F;  2AET A;  4LLS A;  4GP2 A;  3RYE A;  4DXJ A;  5B00 A;  2E93 A;  5A0J A;  3ZMC A;  3V66 A;  2PS4 A;  4LIX A;  3N46 F;  1HXC A;  3TS7 A;  4KVI A;  2ZEV A;  1WMW A;  5B0L A;  1HM4 A;  4JXN A;  2E95 A;  2F9K F;  4FJQ A;  3WEG A;  5DJV F;  4PVY F;  1RQJ A;  5IN8 A;  3WJN A;  3AE0 A;  4KPJ A;  3M02 A;  2PS6 A;  2Z4V A;  3ZCD A;  2ZY1 A;  4RXD A;  3ACY A;  3S9V A;  5A0I A;  3IPI A;  4LTV A;  3EGT A;  2ONH A;  4XQT F;  4LUU A;  5IM1 A;  2AZK A;  4RXA A;  3SDU A;  4N1Z F;  4LLT A;  4LTZ A;  3KRO A; 
#chains in the Genus database with same CATH homology
 3WCM A;  3P41 A;  3WCC A;  1UBW A;  4H5D F;  3G4F A;  3LOM A;  5DJP F;  3Q1O A;  1N1Z A;  5JV1 F;  5AYP A;  3B7L A;  4LPH F;  2J1O A;  4OGU A;  3RYW A;  4L2X F;  3LGZ B;  3AQC B;  4QPF A;  3PDE A;  4KVD A;  5DHI A;  5HNA A;  3LZ9 A;  3ICM A;  3OAB A;  5HN8 A;  5DJR F;  4NKF A;  2I19 A;  4KK2 A;  2E8X A;  5IVG A;  5JA0 F;  3WJK A;  1VG2 A;  1WL0 A;  4NFK F;  3LGK A;  2Z78 A;  2E8T A;  2E90 A;  4RYP A;  1WL3 A;  1UBV A;  5B0J A;  5ILK A;  3ADZ A;  3LEE A;  4JYX A;  4EA2 A;  4ZQ8 A;  3MAV A;  5ERO A;  3VJA A;  4LXW A;  4XQS F;  3LG5 A;  3IBA A;  2F92 F;  3N3D A;  5DIQ F;  3ICK A;  4JVJ F;  3BNY A;  3V1X A;  3NRI A;  1UBX A;  5B03 A;  2ZCQ A;  3NPK A;  1YYQ A;  5DGM F;  2F94 F;  4DI5 A;  3DYF A;  4EA1 A;  3WSB A;  3QKC A;  3KRA A;  4LPG F;  4KUX A;  3WCF A;  5IL8 A;  3WCE A;  3WCG A;  4RNQ A;  1UBY A;  5IKH A;  1N20 A;  2Z4Z A;  5ILZ A;  2PS7 A;  3ACX A;  2E8V A;  1HXA A;  3PYA A;  5JV0 F;  4MC8 A;  3APZ A;  4LZ3 A;  4EA0 A;  2VF6 A;  4GAX A;  1RQI A;  2Z4X A;  1HX9 A;  5IKA A;  3RMG A;  1KIZ A;  4H5C F;  2AZL A;  2Z7I A;  4KFA A;  3TFP A;  5ILI A;  3ACW A;  5ER8 A;  2H8O A;  1V4H A;  3ZMB A;  2EWG A;  3KRO B;  3WCH A;  5B01 A;  2DH4 A;  3LSN A;  3Q2Q A;  3WCJ A;  3AQ0 A;  4XQR F;  3S4J A;  5I1U A;  4UMJ A;  5AFX A;  5ILY A;  5H9D A;  2FTZ A;  2O1O A;  3OYR A;  5IK6 A;  3KRP A;  4NKE A;  3N49 F;  5DHK A;  5JUZ F;  3BNX A;  5E8L A;  3WCD A;  4DWG A;  1WKZ A;  3Q30 A;  5DW7 A;  4E1E A;  3OAB B;  2OPM A;  4KQ5 A;  5DGS F;  5JV2 F;  4DHD A;  3LDW A;  5DZ2 A;  1YYR A;  5CG5 A;  4LOB A;  5IMI A;  5C05 A;  2Z4Y A;  3LJI A;  3KRC A;  1VG3 A;  3WE9 A;  1ZW5 A;  4GP1 A;  3N6K F;  3W7F A;  4JZX A;  5HN7 A;  1V4K A;  5ERM A;  1N22 A;  3M9U A;  3KB9 A;  3LMD A;  1JFA A;  3NPR A;  2E92 A;  2OPN A;  2Q58 A;  1VG7 A;  1YV5 A;  1YHM A;  5IK9 A;  4GA3 A;  3SDR A;  4KQU A;  3N0G A;  3M01 A;  5B0I A;  3ZOU A;  3KBK A;  1V4J A;  2F8Z F;  3KRA B;  4JXY A;  5EAT A;  4F6X A;  1JFG A;  4LA6 A;  3N0F A;  4RXE A;  3WEK A;  4KWD A;  3VJ9 A;  4E9Z A;  2F8C F;  4OKM A;  5B02 A;  5ERN A;  3P8L A;  3CP6 A;  3M0G A;  1VG4 A;  3OAC A;  3ASX A;  1HXG A;  3PKO A;  5A0K A;  5B0M A;  2AEK A;  1N23 A;  2ZCS A;  3CKE A;  3V1V A;  4DZW A;  3N5J F;  2F89 F;  4LZ0 A;  3RBM A;  4LA5 A;  3Q2Z A;  5E8K A;  2QIS A;  2E8W A;  3KRF A;  3WEI A;  1DGP A;  1VG6 A;  2PS8 A;  4LFV F;  4KKM A;  5AHU B;  2F7M F;  3ZL6 A;  3VJD A;  3P5R A;  3KRP B;  2J1P A;  2RAH A;  2Z52 A;  4F6V A;  4JZB A;  3LK5 A;  1YJ4 A;  4N9U A;  4OMH A;  5EAU A;  5B0K A;  3QQV A;  4HD1 A;  3UCA A;  1FPS A;  1PS1 A;  3ICN A;  3N3L F;  4RXC A;  2OGD A;  2Z7H A;  2ZCR A;  2Z50 A;  1N21 A;  3WC9 A;  5ILJ A;  1YHL A;  5IMP A;  3KRC B;  4WK5 A;  4DWB A;  3MZV A;  2ZEU A;  1RTR A;  3WCB A;  3SDT A;  4LZC A;  4KQS A;  4MC3 A;  3VJC A;  3EZ3 A;  5IL3 A;  2E8U A;  2J5C A;  2P1C A;  3DYG A;  2Q9Z A;  3DYH A;  4OKZ A;  1WL1 A;  3VJ8 A;  2FOR A;  4LFG A;  4NFJ F;  3VJE A;  5DGN F;  4DEM F;  4PVX F;  4KVW A;  3SDQ A;  3TFV A;  3WEH A;  1V4E A;  1N1B A;  5E8H A;  4NFI F;  1YYU A;  4P0V A;  2ONG A;  3ICZ A;  4E9U A;  3LLW A;  4QXS F;  5KSX F;  3M00 A;  4H5E F;  3OAC B;  2AEL A;  5EAS A;  5HN9 A;  1KIY A;  3AQB B;  4Q23 A;  2OA6 A;  3WEF A;  2Q9Y A;  2ZCO A;  3SAE A;  5IK0 A;  3N1W F;  3WEJ A;  1YHK A;  3WCI A;  3KRF B;  3WCA A;  3WCL A;  2Q80 A;  5AEL A;  1WL2 A;  3ID0 A;  3TC1 A;  2Z4W A;  3EFQ A;  4KVY A;  1HM7 A;  5ILH A;  3NF2 A;  4P0X A;  3TFN A;  3WSA A;  1YQ7 A;  4NG6 A;  1N24 A;  4KPD A;  4NUA A;  3PH7 A;  1YYS A;  5CG6 A;  3N45 F;  1WY0 A;  4LFE A;  2E94 A;  3WJO A;  1V4I A;  2E91 A;  4F62 A;  3PYB A;  3P5P A;  1EZF A;  3P8R A;  4FP4 A;  5ILD A;  3CC9 A;  4MC0 A;  3VJB A;  4P0W A;  3N1V F;  5IMN A;  1YYT A;  2E4O A;  1DI1 A;  2PS5 A;  3G4D A;  4K10 A;  2AZJ A;  3SDV A;  3LVS A;  4OMG A;  3N5H F;  2AET A;  4LLS A;  4GP2 A;  3RYE A;  4DXJ A;  5B00 A;  2E93 A;  5A0J A;  3ZMC A;  3V66 A;  2PS4 A;  4LIX A;  3N46 F;  1HXC A;  3TS7 A;  4KVI A;  2ZEV A;  1WMW A;  5B0L A;  1HM4 A;  4JXN A;  2E95 A;  2F9K F;  4FJQ A;  3WEG A;  5DJV F;  4PVY F;  1RQJ A;  5IN8 A;  3WJN A;  3AE0 A;  4KPJ A;  3M02 A;  2PS6 A;  2Z4V A;  3ZCD A;  2ZY1 A;  4RXD A;  3ACY A;  3S9V A;  5A0I A;  3IPI A;  4LTV A;  3EGT A;  2ONH A;  4XQT F;  4LUU A;  5IM1 A;  2AZK A;  4RXA A;  3SDU A;  4N1Z F;  4LLT A;  4LTZ A;  3KRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...