5B0LA

Structure of moen5-sso7d fusion protein in complex with beta-nonyl glucoside
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
264
structure length
264
Chain Sequence
DDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
molecule tags Transferase, dna binding protein
total genus 120
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b0lA00
5B00A 3VJBA 1RQJA 4EA1A 3ASXA 1RQIA 2Z50A 3N0FA 3WCFA 3WC9A 2ZCRA 3M01A 4KWDA 3WEGA 3PH7A 3ICMA 1YHLA 3NPKA 3WEIA 4DXJA 4LZCA 4RXAA 5A0IA 5HNAA 3EFQA 3VJ9A 4P0WA 3Q2QA 4GA3A 5AHUB 1YJ4A 2Z4YA 2Z7HA 5IN8A 1VG2A 3N3DA 3EGTA 3DYFA 3ZL6A 4N9UA 4NFKF 1DI1A 5DJPF 3V66A 4QXSF 2J5CA 3ICKA 3WCEA 1WY0A 3KROA 4P0XA 3N5HF 5I1UA 3APZA 1EZFA 4H5DF 5B0MA 3P5PA 5E8LA 1N20A 4JXYA 4LA6A 2EWGA 2Q9ZA 1WKZA 2E95A 2AELA 2Z4VA 4NUAA 5KSXF 2E4OA 3WJOA 3SDQA 2Z52A 5DGSF 4XQSF 2ZY1A 2Q58A 3BNYA 2H8OA 2OA6A 2E90A 4N1ZF 5DW7A 4HD1A 4KQSA 4LZ0A 4JZBA 1DGPA 4RXDA 5JV2F 3N45F 3RYEA 3WCMA 1WL1A 4OKMA 3N1VF 5IKHA 4LPHF 2Z4WA 4EA0A 2O1OA 1HX9A 4NG6A 3N1WF 4H5CF 1RTRA 4H5EF 5IK6A 1PS1A 3WSAA 3WCIA 3ICNA 4LPGF 5ERNA 4MC3A 2ZCSA 3KRAB 5IK9A 4KVIA 5AFXA 3Q30A 5JUZF 3SDRA 3IPIA 5EROA 1V4JA 5IM1A 2F8ZF 2E8XA 4DHDA 4F6VA 1YQ7A 3KRCB 3OABA 5DIQF 3RMGA 5E8KA 3WEKA 5IKAA 3KB9A 2ZEVA 3ZMBA 2OPNA 5EAUA 5DHIA 5JA0F 3N49F 4LFEA 3KRPB 4FJQA 3WCBA 1HXCA 3WEFA 1YYUA 1UBXA 2Q80A 3OACB 2PS6A 3LGZB 1JFGA 1YYSA 3VJEA 3TFVA 2E94A 3PYAA 3NPRA 3LMDA 4KPJA 5ILDA 3NRIA 3PDEA 1WL0A 3QKCA 5C05A 3N5JF 3LOMA 4MC8A 3KRFB 4RXEA 3WJNA 2E8WA 2AZLA 2AZKA 3M9UA 1N24A 2E8VA 4JYXA 3WCAA 4XQRF 3LK5A 5CG5A 2VF6A 3WCLA 3WCHA 5B02A 3SDTA 3N0GA 2F7MF 5JV0F 3KRAA 3CC9A 3ID0A 4F62A 4OMGA 4EA2A 4PVXF 3LG5A 2AEKA 2F89F 2J1OA 2PS5A 3KRCA 2Z7IA 3OYRA 3G4DA 3ACYA 4RNQA 1N21A 1WL2A 4OKZA 1YYRA 4KPDA 3LGKA 1UBYA 5DJRF 3VJAA 2Q9YA 5IL8A 3AQBB 3LDWA 1KIZA 1YHMA 3WSBA 5IMNA 3PKOA 4DEMF 3KBKA 3LVSA 1KIYA 5CG6A 3N6KF 3P5RA 2F8CF 4DI5A 2PS7A 5AELA 4GP2A 2Z4XA 3G4FA 3CP6A 2Z4ZA 1N1ZA 1YYQA 3N3LF 5ILYA 2OGDA 3NF2A 4JVJF 3BNXA 3TFNA 3WCCA 3N46F 1WMWA 5HN9A 5HN8A 5HN7A 3WCJA 4LTVA 3ZMCA 4GP1A 4OMHA 3KROB 5ILJA 2P1CA 3ZOUA 1JFAA 2F92F 1UBVA 2ONGA 5B01A 2QISA 1HXGA 4XQTF 1FPSA 3IBAA 4NFJF 3WCGA 4LLSA 5B03A 3LSNA 2Z78A 3ACXA 4KK2A 4LXWA 3LJIA 3LEEA 4LZ3A 2F9KF 5A0JA 2FTZA 4DZWA 3DYHA 4E9UA 5A0KA 2FORA 4NFIF 3P8RA 3WEHA 3B7LA 4LIXA 3P8LA 1VG6A 3V1XA 5DHKA 5JV1F 4LUUA 2E8TA 5B0JA 4LOBA 4MC0A 5DGNF 1ZW5A 4KVDA 5EASA 3RBMA 5ILIA 3WJKA 5B0KA 5ILKA 3Q1OA 4PVYF 2OPMA 1UBWA 3ZCDA 2ZCOA 3ICZA 3RYWA 3VJ8A 4FP4A 5B0LA 3AQ0A 1V4HA 2E91A 3V1VA 3M00A 5DZ2A 2ONHA 4Q23A 4QPFA 3UCAA 2ZEUA 1HM4A 3QQVA 3OABB 1VG3A 3EZ3A 3S9VA 3W7FA 4NKEA 5ERMA 5ILHA 3SDUA 3M02A 4KVYA 4LFGA 3ADZA 1YYTA 5DGMF 4RYPA 3TFPA 1YHKA 4KQ5A 1VG4A 3KRPA 4GAXA 5IVGA 4JXNA 2RAHA 1V4KA 3OACA 1N22A 3MZVA 4JZXA 2E92A 5H9DA 3P41A 4LA5A 5ILZA 4KVWA 4NKFA 3CKEA 4P0VA 3WE9A 2E93A 4E1EA 3AE0A 5IK0A 2DH4A 2J1PA 1YV5A 5ER8A 3WCDA 4DWBA 5IL3A 3M0GA 2I19A 3LZ9A 4KFAA 4OGUA 3TC1A 3Q2ZA 4KKMA 3PYBA 4E9ZA 3VJCA 5IMPA 2AZJA 3KRFA 3SAEA 4UMJA 4LTZA 5IMIA 1HXAA 1N1BA 4ZQ8A 4L2XF 4KUXA 4F6XA 2F94F 1HM7A 4DWGA 1V4IA 2PS4A 2PS8A 4LFVF 4LLTA 4WK5A 2ZCQA 2AETA 5B0IA 3S4JA 1N23A 5E8HA 1WL3A 4RXCA 5EATA 3TS7A 3MAVA 1V4EA 5DJVF 4K10A 3SDVA 1VG7A 3VJDA 3ACWA 3AQCB 3WEJA 3LLWA 3DYGA 5AYPA 4KQUA 2E8UA
chains in the Genus database with same CATH superfamily
5B00A 3VJBA 1RQJA 4EA1A 3ASXA 1RQIA 2Z50A 3N0FA 3WCFA 3WC9A 2ZCRA 3M01A 4KWDA 3WEGA 3PH7A 3ICMA 1YHLA 3NPKA 3WEIA 4DXJA 4LZCA 4RXAA 5A0IA 5HNAA 3EFQA 3VJ9A 4P0WA 3Q2QA 4GA3A 5AHUB 1YJ4A 2Z4YA 2Z7HA 5IN8A 1VG2A 3N3DA 3EGTA 3DYFA 3ZL6A 4N9UA 4NFKF 1DI1A 5DJPF 3V66A 4QXSF 2J5CA 3ICKA 3WCEA 1WY0A 3KROA 4P0XA 3N5HF 5I1UA 3APZA 1EZFA 4H5DF 5B0MA 3P5PA 5E8LA 1N20A 4JXYA 4LA6A 2EWGA 2Q9ZA 1WKZA 2E95A 2AELA 2Z4VA 4NUAA 5KSXF 2E4OA 3WJOA 3SDQA 2Z52A 5DGSF 4XQSF 2ZY1A 2Q58A 3BNYA 2H8OA 2OA6A 2E90A 4N1ZF 5DW7A 4HD1A 4KQSA 4LZ0A 4JZBA 1DGPA 4RXDA 5JV2F 3N45F 3RYEA 3WCMA 1WL1A 4OKMA 3N1VF 5IKHA 4LPHF 2Z4WA 4EA0A 2O1OA 1HX9A 4NG6A 3N1WF 4H5CF 1RTRA 4H5EF 5IK6A 1PS1A 3WSAA 3WCIA 3ICNA 4LPGF 5ERNA 4MC3A 2ZCSA 3KRAB 5IK9A 4KVIA 5AFXA 3Q30A 5JUZF 3SDRA 3IPIA 5EROA 1V4JA 5IM1A 2F8ZF 2E8XA 4DHDA 4F6VA 1YQ7A 3KRCB 3OABA 5DIQF 3RMGA 5E8KA 3WEKA 5IKAA 3KB9A 2ZEVA 3ZMBA 2OPNA 5EAUA 5DHIA 5JA0F 3N49F 4LFEA 3KRPB 4FJQA 3WCBA 1HXCA 3WEFA 1YYUA 1UBXA 2Q80A 3OACB 2PS6A 3LGZB 1JFGA 1YYSA 3VJEA 3TFVA 2E94A 3PYAA 3NPRA 3LMDA 4KPJA 5ILDA 3NRIA 3PDEA 1WL0A 3QKCA 5C05A 3N5JF 3LOMA 4MC8A 3KRFB 4RXEA 3WJNA 2E8WA 2AZLA 2AZKA 3M9UA 1N24A 2E8VA 4JYXA 3WCAA 4XQRF 3LK5A 5CG5A 2VF6A 3WCLA 3WCHA 5B02A 3SDTA 3N0GA 2F7MF 5JV0F 3KRAA 3CC9A 3ID0A 4F62A 4OMGA 4EA2A 4PVXF 3LG5A 2AEKA 2F89F 2J1OA 2PS5A 3KRCA 2Z7IA 3OYRA 3G4DA 3ACYA 4RNQA 1N21A 1WL2A 4OKZA 1YYRA 4KPDA 3LGKA 1UBYA 5DJRF 3VJAA 2Q9YA 5IL8A 3AQBB 3LDWA 1KIZA 1YHMA 3WSBA 5IMNA 3PKOA 4DEMF 3KBKA 3LVSA 1KIYA 5CG6A 3N6KF 3P5RA 2F8CF 4DI5A 2PS7A 5AELA 4GP2A 2Z4XA 3G4FA 3CP6A 2Z4ZA 1N1ZA 1YYQA 3N3LF 5ILYA 2OGDA 3NF2A 4JVJF 3BNXA 3TFNA 3WCCA 3N46F 1WMWA 5HN9A 5HN8A 5HN7A 3WCJA 4LTVA 3ZMCA 4GP1A 4OMHA 3KROB 5ILJA 2P1CA 3ZOUA 1JFAA 2F92F 1UBVA 2ONGA 5B01A 2QISA 1HXGA 4XQTF 1FPSA 3IBAA 4NFJF 3WCGA 4LLSA 5B03A 3LSNA 2Z78A 3ACXA 4KK2A 4LXWA 3LJIA 3LEEA 4LZ3A 2F9KF 5A0JA 2FTZA 4DZWA 3DYHA 4E9UA 5A0KA 2FORA 4NFIF 3P8RA 3WEHA 3B7LA 4LIXA 3P8LA 1VG6A 3V1XA 5DHKA 5JV1F 4LUUA 2E8TA 5B0JA 4LOBA 4MC0A 5DGNF 1ZW5A 4KVDA 5EASA 3RBMA 5ILIA 3WJKA 5B0KA 5ILKA 3Q1OA 4PVYF 2OPMA 1UBWA 3ZCDA 2ZCOA 3ICZA 3RYWA 3VJ8A 4FP4A 5B0LA 3AQ0A 1V4HA 2E91A 3V1VA 3M00A 5DZ2A 2ONHA 4Q23A 4QPFA 3UCAA 2ZEUA 1HM4A 3QQVA 3OABB 1VG3A 3EZ3A 3S9VA 3W7FA 4NKEA 5ERMA 5ILHA 3SDUA 3M02A 4KVYA 4LFGA 3ADZA 1YYTA 5DGMF 4RYPA 3TFPA 1YHKA 4KQ5A 1VG4A 3KRPA 4GAXA 5IVGA 4JXNA 2RAHA 1V4KA 3OACA 1N22A 3MZVA 4JZXA 2E92A 5H9DA 3P41A 4LA5A 5ILZA 4KVWA 4NKFA 3CKEA 4P0VA 3WE9A 2E93A 4E1EA 3AE0A 5IK0A 2DH4A 2J1PA 1YV5A 5ER8A 3WCDA 4DWBA 5IL3A 3M0GA 2I19A 3LZ9A 4KFAA 4OGUA 3TC1A 3Q2ZA 4KKMA 3PYBA 4E9ZA 3VJCA 5IMPA 2AZJA 3KRFA 3SAEA 4UMJA 4LTZA 5IMIA 1HXAA 1N1BA 4ZQ8A 4L2XF 4KUXA 4F6XA 2F94F 1HM7A 4DWGA 1V4IA 2PS4A 2PS8A 4LFVF 4LLTA 4WK5A 2ZCQA 2AETA 5B0IA 3S4JA 1N23A 5E8HA 1WL3A 4RXCA 5EATA 3TS7A 3MAVA 1V4EA 5DJVF 4K10A 3SDVA 1VG7A 3VJDA 3ACWA 3AQCB 3WEJA 3LLWA 3DYGA 5AYPA 4KQUA 2E8UA
chains in the Genus database with same CATH topology
5B00A 3VJBA 1RQJA 4EA1A 3ASXA 1RQIA 2Z50A 3N0FA 3WCFA 3WC9A 2ZCRA 3M01A 4KWDA 3WEGA 3PH7A 3ICMA 1YHLA 3NPKA 3WEIA 4DXJA 4LZCA 4RXAA 5A0IA 5HNAA 3EFQA 3VJ9A 4P0WA 3Q2QA 4GA3A 5AHUB 1YJ4A 2Z4YA 2Z7HA 5IN8A 1VG2A 3N3DA 3EGTA 3DYFA 3ZL6A 4N9UA 4NFKF 1DI1A 5DJPF 3V66A 4QXSF 2J5CA 3ICKA 3WCEA 1WY0A 3KROA 4P0XA 3N5HF 5I1UA 3APZA 1EZFA 4H5DF 5B0MA 3P5PA 5E8LA 1N20A 4JXYA 4LA6A 2EWGA 2Q9ZA 1WKZA 2E95A 2AELA 2Z4VA 4NUAA 5KSXF 2E4OA 3WJOA 3SDQA 2Z52A 5DGSF 4XQSF 2ZY1A 2Q58A 3BNYA 2H8OA 2OA6A 2E90A 4N1ZF 5DW7A 4HD1A 4KQSA 4LZ0A 4JZBA 1DGPA 4RXDA 5JV2F 3N45F 3RYEA 3WCMA 1WL1A 4OKMA 3N1VF 5IKHA 4LPHF 2Z4WA 4EA0A 2O1OA 1HX9A 4NG6A 3N1WF 4H5CF 1RTRA 4H5EF 5IK6A 1PS1A 3WSAA 3WCIA 3ICNA 4LPGF 5ERNA 4MC3A 2ZCSA 3KRAB 5IK9A 4KVIA 5AFXA 3Q30A 5JUZF 3SDRA 3IPIA 5EROA 1V4JA 5IM1A 2F8ZF 2E8XA 4DHDA 4F6VA 1YQ7A 3KRCB 3OABA 5DIQF 3RMGA 5E8KA 3WEKA 5IKAA 3KB9A 2ZEVA 3ZMBA 2OPNA 5EAUA 5DHIA 5JA0F 3N49F 4LFEA 3KRPB 4FJQA 3WCBA 1HXCA 3WEFA 1YYUA 1UBXA 2Q80A 3OACB 2PS6A 3LGZB 1JFGA 1YYSA 3VJEA 3TFVA 2E94A 3PYAA 3NPRA 3LMDA 4KPJA 5ILDA 3NRIA 3PDEA 1WL0A 3QKCA 5C05A 3N5JF 3LOMA 4MC8A 3KRFB 4RXEA 3WJNA 2E8WA 2AZLA 2AZKA 3M9UA 1N24A 2E8VA 4JYXA 3WCAA 4XQRF 3LK5A 5CG5A 2VF6A 3WCLA 3WCHA 5B02A 3SDTA 3N0GA 2F7MF 5JV0F 3KRAA 3CC9A 3ID0A 4F62A 4OMGA 4EA2A 4PVXF 3LG5A 2AEKA 2F89F 2J1OA 2PS5A 3KRCA 2Z7IA 3OYRA 3G4DA 3ACYA 4RNQA 1N21A 1WL2A 4OKZA 1YYRA 4KPDA 3LGKA 1UBYA 5DJRF 3VJAA 2Q9YA 5IL8A 3AQBB 3LDWA 1KIZA 1YHMA 3WSBA 5IMNA 3PKOA 4DEMF 3KBKA 3LVSA 1KIYA 5CG6A 3N6KF 3P5RA 2F8CF 4DI5A 2PS7A 5AELA 4GP2A 2Z4XA 3G4FA 3CP6A 2Z4ZA 1N1ZA 1YYQA 3N3LF 5ILYA 2OGDA 3NF2A 4JVJF 3BNXA 3TFNA 3WCCA 3N46F 1WMWA 5HN9A 5HN8A 5HN7A 3WCJA 4LTVA 3ZMCA 4GP1A 4OMHA 3KROB 5ILJA 2P1CA 3ZOUA 1JFAA 2F92F 1UBVA 2ONGA 5B01A 2QISA 1HXGA 4XQTF 1FPSA 3IBAA 4NFJF 3WCGA 4LLSA 5B03A 3LSNA 2Z78A 3ACXA 4KK2A 4LXWA 3LJIA 3LEEA 4LZ3A 2F9KF 5A0JA 2FTZA 4DZWA 3DYHA 4E9UA 5A0KA 2FORA 4NFIF 3P8RA 3WEHA 3B7LA 4LIXA 3P8LA 1VG6A 3V1XA 5DHKA 5JV1F 4LUUA 2E8TA 5B0JA 4LOBA 4MC0A 5DGNF 1ZW5A 4KVDA 5EASA 3RBMA 5ILIA 3WJKA 5B0KA 5ILKA 3Q1OA 4PVYF 2OPMA 1UBWA 3ZCDA 2ZCOA 3ICZA 3RYWA 3VJ8A 4FP4A 5B0LA 3AQ0A 1V4HA 2E91A 3V1VA 3M00A 5DZ2A 2ONHA 4Q23A 4QPFA 3UCAA 2ZEUA 1HM4A 3QQVA 3OABB 1VG3A 3EZ3A 3S9VA 3W7FA 4NKEA 5ERMA 5ILHA 3SDUA 3M02A 4KVYA 4LFGA 3ADZA 1YYTA 5DGMF 4RYPA 3TFPA 1YHKA 4KQ5A 1VG4A 3KRPA 4GAXA 5IVGA 4JXNA 2RAHA 1V4KA 3OACA 1N22A 3MZVA 4JZXA 2E92A 5H9DA 3P41A 4LA5A 5ILZA 4KVWA 4NKFA 3CKEA 4P0VA 3WE9A 2E93A 4E1EA 3AE0A 5IK0A 2DH4A 2J1PA 1YV5A 5ER8A 3WCDA 4DWBA 5IL3A 3M0GA 2I19A 3LZ9A 4KFAA 4OGUA 3TC1A 3Q2ZA 4KKMA 3PYBA 4E9ZA 3VJCA 5IMPA 2AZJA 3KRFA 3SAEA 4UMJA 4LTZA 5IMIA 1HXAA 1N1BA 4ZQ8A 4L2XF 4KUXA 4F6XA 2F94F 1HM7A 4DWGA 1V4IA 2PS4A 2PS8A 4LFVF 4LLTA 4WK5A 2ZCQA 2AETA 5B0IA 3S4JA 1N23A 5E8HA 1WL3A 4RXCA 5EATA 3TS7A 3MAVA 1V4EA 5DJVF 4K10A 3SDVA 1VG7A 3VJDA 3ACWA 3AQCB 3WEJA 3LLWA 3DYGA 5AYPA 4KQUA 2E8UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5B00 A;  3VJB A;  1RQJ A;  4EA1 A;  3ASX A;  1RQI A;  2Z50 A;  3N0F A;  3WCF A;  3WC9 A;  2ZCR A;  3M01 A;  4KWD A;  3WEG A;  3PH7 A;  3ICM A;  1YHL A;  3NPK A;  3WEI A;  4DXJ A;  4LZC A;  4RXA A;  5A0I A;  5HNA A;  3EFQ A;  3VJ9 A;  4P0W A;  3Q2Q A;  4GA3 A;  5AHU B;  1YJ4 A;  2Z4Y A;  2Z7H A;  5IN8 A;  1VG2 A;  3N3D A;  3EGT A;  3DYF A;  3ZL6 A;  4N9U A;  4NFK F;  1DI1 A;  5DJP F;  3V66 A;  4QXS F;  2J5C A;  3ICK A;  3WCE A;  1WY0 A;  3KRO A;  4P0X A;  3N5H F;  5I1U A;  3APZ A;  1EZF A;  4H5D F;  5B0M A;  3P5P A;  5E8L A;  1N20 A;  4JXY A;  4LA6 A;  2EWG A;  2Q9Z A;  1WKZ A;  2E95 A;  2AEL A;  2Z4V A;  4NUA A;  5KSX F;  2E4O A;  3WJO A;  3SDQ A;  2Z52 A;  5DGS F;  4XQS F;  2ZY1 A;  2Q58 A;  3BNY A;  2H8O A;  2OA6 A;  2E90 A;  4N1Z F;  5DW7 A;  4HD1 A;  4KQS A;  4LZ0 A;  4JZB A;  1DGP A;  4RXD A;  5JV2 F;  3N45 F;  3RYE A;  3WCM A;  1WL1 A;  4OKM A;  3N1V F;  5IKH A;  4LPH F;  2Z4W A;  4EA0 A;  2O1O A;  1HX9 A;  4NG6 A;  3N1W F;  4H5C F;  1RTR A;  4H5E F;  5IK6 A;  1PS1 A;  3WSA A;  3WCI A;  3ICN A;  4LPG F;  5ERN A;  4MC3 A;  2ZCS A;  3KRA B;  5IK9 A;  4KVI A;  5AFX A;  3Q30 A;  5JUZ F;  3SDR A;  3IPI A;  5ERO A;  1V4J A;  5IM1 A;  2F8Z F;  2E8X A;  4DHD A;  4F6V A;  1YQ7 A;  3KRC B;  3OAB A;  5DIQ F;  3RMG A;  5E8K A;  3WEK A;  5IKA A;  3KB9 A;  2ZEV A;  3ZMB A;  2OPN A;  5EAU A;  5DHI A;  5JA0 F;  3N49 F;  4LFE A;  3KRP B;  4FJQ A;  3WCB A;  1HXC A;  3WEF A;  1YYU A;  1UBX A;  2Q80 A;  3OAC B;  2PS6 A;  3LGZ B;  1JFG A;  1YYS A;  3VJE A;  3TFV A;  2E94 A;  3PYA A;  3NPR A;  3LMD A;  4KPJ A;  5ILD A;  3NRI A;  3PDE A;  1WL0 A;  3QKC A;  5C05 A;  3N5J F;  3LOM A;  4MC8 A;  3KRF B;  4RXE A;  3WJN A;  2E8W A;  2AZL A;  2AZK A;  3M9U A;  1N24 A;  2E8V A;  4JYX A;  3WCA A;  4XQR F;  3LK5 A;  5CG5 A;  2VF6 A;  3WCL A;  3WCH A;  5B02 A;  3SDT A;  3N0G A;  2F7M F;  5JV0 F;  3KRA A;  3CC9 A;  3ID0 A;  4F62 A;  4OMG A;  4EA2 A;  4PVX F;  3LG5 A;  2AEK A;  2F89 F;  2J1O A;  2PS5 A;  3KRC A;  2Z7I A;  3OYR A;  3G4D A;  3ACY A;  4RNQ A;  1N21 A;  1WL2 A;  4OKZ A;  1YYR A;  4KPD A;  3LGK A;  1UBY A;  5DJR F;  3VJA A;  2Q9Y A;  5IL8 A;  3AQB B;  3LDW A;  1KIZ A;  1YHM A;  3WSB A;  5IMN A;  3PKO A;  4DEM F;  3KBK A;  3LVS A;  1KIY A;  5CG6 A;  3N6K F;  3P5R A;  2F8C F;  4DI5 A;  2PS7 A;  5AEL A;  4GP2 A;  2Z4X A;  3G4F A;  3CP6 A;  2Z4Z A;  1N1Z A;  1YYQ A;  3N3L F;  5ILY A;  2OGD A;  3NF2 A;  4JVJ F;  3BNX A;  3TFN A;  3WCC A;  3N46 F;  1WMW A;  5HN9 A;  5HN8 A;  5HN7 A;  3WCJ A;  4LTV A;  3ZMC A;  4GP1 A;  4OMH A;  3KRO B;  5ILJ A;  2P1C A;  3ZOU A;  1JFA A;  2F92 F;  1UBV A;  2ONG A;  5B01 A;  2QIS A;  1HXG A;  4XQT F;  1FPS A;  3IBA A;  4NFJ F;  3WCG A;  4LLS A;  5B03 A;  3LSN A;  2Z78 A;  3ACX A;  4KK2 A;  4LXW A;  3LJI A;  3LEE A;  4LZ3 A;  2F9K F;  5A0J A;  2FTZ A;  4DZW A;  3DYH A;  4E9U A;  5A0K A;  2FOR A;  4NFI F;  3P8R A;  3WEH A;  3B7L A;  4LIX A;  3P8L A;  1VG6 A;  3V1X A;  5DHK A;  5JV1 F;  4LUU A;  2E8T A;  5B0J A;  4LOB A;  4MC0 A;  5DGN F;  1ZW5 A;  4KVD A;  5EAS A;  3RBM A;  5ILI A;  3WJK A;  5B0K A;  5ILK A;  3Q1O A;  4PVY F;  2OPM A;  1UBW A;  3ZCD A;  2ZCO A;  3ICZ A;  3RYW A;  3VJ8 A;  4FP4 A;  5B0L A;  3AQ0 A;  1V4H A;  2E91 A;  3V1V A;  3M00 A;  5DZ2 A;  2ONH A;  4Q23 A;  4QPF A;  3UCA A;  2ZEU A;  1HM4 A;  3QQV A;  3OAB B;  1VG3 A;  3EZ3 A;  3S9V A;  3W7F A;  4NKE A;  5ERM A;  5ILH A;  3SDU A;  3M02 A;  4KVY A;  4LFG A;  3ADZ A;  1YYT A;  5DGM F;  4RYP A;  3TFP A;  1YHK A;  4KQ5 A;  1VG4 A;  3KRP A;  4GAX A;  5IVG A;  4JXN A;  2RAH A;  1V4K A;  3OAC A;  1N22 A;  3MZV A;  4JZX A;  2E92 A;  5H9D A;  3P41 A;  4LA5 A;  5ILZ A;  4KVW A;  4NKF A;  3CKE A;  4P0V A;  3WE9 A;  2E93 A;  4E1E A;  3AE0 A;  5IK0 A;  2DH4 A;  2J1P A;  1YV5 A;  5ER8 A;  3WCD A;  4DWB A;  5IL3 A;  3M0G A;  2I19 A;  3LZ9 A;  4KFA A;  4OGU A;  3TC1 A;  3Q2Z A;  4KKM A;  3PYB A;  4E9Z A;  3VJC A;  5IMP A;  2AZJ A;  3KRF A;  3SAE A;  4UMJ A;  4LTZ A;  5IMI A;  1HXA A;  1N1B A;  4ZQ8 A;  4L2X F;  4KUX A;  4F6X A;  2F94 F;  1HM7 A;  4DWG A;  1V4I A;  2PS4 A;  2PS8 A;  4LFV F;  4LLT A;  4WK5 A;  2ZCQ A;  2AET A;  5B0I A;  3S4J A;  1N23 A;  5E8H A;  1WL3 A;  4RXC A;  5EAT A;  3TS7 A;  3MAV A;  1V4E A;  5DJV F;  4K10 A;  3SDV A;  1VG7 A;  3VJD A;  3ACW A;  3AQC B;  3WEJ A;  3LLW A;  3DYG A;  5AYP A;  4KQU A;  2E8U A; 
#chains in the Genus database with same CATH topology
 5B00 A;  3VJB A;  1RQJ A;  4EA1 A;  3ASX A;  1RQI A;  2Z50 A;  3N0F A;  3WCF A;  3WC9 A;  2ZCR A;  3M01 A;  4KWD A;  3WEG A;  3PH7 A;  3ICM A;  1YHL A;  3NPK A;  3WEI A;  4DXJ A;  4LZC A;  4RXA A;  5A0I A;  5HNA A;  3EFQ A;  3VJ9 A;  4P0W A;  3Q2Q A;  4GA3 A;  5AHU B;  1YJ4 A;  2Z4Y A;  2Z7H A;  5IN8 A;  1VG2 A;  3N3D A;  3EGT A;  3DYF A;  3ZL6 A;  4N9U A;  4NFK F;  1DI1 A;  5DJP F;  3V66 A;  4QXS F;  2J5C A;  3ICK A;  3WCE A;  1WY0 A;  3KRO A;  4P0X A;  3N5H F;  5I1U A;  3APZ A;  1EZF A;  4H5D F;  5B0M A;  3P5P A;  5E8L A;  1N20 A;  4JXY A;  4LA6 A;  2EWG A;  2Q9Z A;  1WKZ A;  2E95 A;  2AEL A;  2Z4V A;  4NUA A;  5KSX F;  2E4O A;  3WJO A;  3SDQ A;  2Z52 A;  5DGS F;  4XQS F;  2ZY1 A;  2Q58 A;  3BNY A;  2H8O A;  2OA6 A;  2E90 A;  4N1Z F;  5DW7 A;  4HD1 A;  4KQS A;  4LZ0 A;  4JZB A;  1DGP A;  4RXD A;  5JV2 F;  3N45 F;  3RYE A;  3WCM A;  1WL1 A;  4OKM A;  3N1V F;  5IKH A;  4LPH F;  2Z4W A;  4EA0 A;  2O1O A;  1HX9 A;  4NG6 A;  3N1W F;  4H5C F;  1RTR A;  4H5E F;  5IK6 A;  1PS1 A;  3WSA A;  3WCI A;  3ICN A;  4LPG F;  5ERN A;  4MC3 A;  2ZCS A;  3KRA B;  5IK9 A;  4KVI A;  5AFX A;  3Q30 A;  5JUZ F;  3SDR A;  3IPI A;  5ERO A;  1V4J A;  5IM1 A;  2F8Z F;  2E8X A;  4DHD A;  4F6V A;  1YQ7 A;  3KRC B;  3OAB A;  5DIQ F;  3RMG A;  5E8K A;  3WEK A;  5IKA A;  3KB9 A;  2ZEV A;  3ZMB A;  2OPN A;  5EAU A;  5DHI A;  5JA0 F;  3N49 F;  4LFE A;  3KRP B;  4FJQ A;  3WCB A;  1HXC A;  3WEF A;  1YYU A;  1UBX A;  2Q80 A;  3OAC B;  2PS6 A;  3LGZ B;  1JFG A;  1YYS A;  3VJE A;  3TFV A;  2E94 A;  3PYA A;  3NPR A;  3LMD A;  4KPJ A;  5ILD A;  3NRI A;  3PDE A;  1WL0 A;  3QKC A;  5C05 A;  3N5J F;  3LOM A;  4MC8 A;  3KRF B;  4RXE A;  3WJN A;  2E8W A;  2AZL A;  2AZK A;  3M9U A;  1N24 A;  2E8V A;  4JYX A;  3WCA A;  4XQR F;  3LK5 A;  5CG5 A;  2VF6 A;  3WCL A;  3WCH A;  5B02 A;  3SDT A;  3N0G A;  2F7M F;  5JV0 F;  3KRA A;  3CC9 A;  3ID0 A;  4F62 A;  4OMG A;  4EA2 A;  4PVX F;  3LG5 A;  2AEK A;  2F89 F;  2J1O A;  2PS5 A;  3KRC A;  2Z7I A;  3OYR A;  3G4D A;  3ACY A;  4RNQ A;  1N21 A;  1WL2 A;  4OKZ A;  1YYR A;  4KPD A;  3LGK A;  1UBY A;  5DJR F;  3VJA A;  2Q9Y A;  5IL8 A;  3AQB B;  3LDW A;  1KIZ A;  1YHM A;  3WSB A;  5IMN A;  3PKO A;  4DEM F;  3KBK A;  3LVS A;  1KIY A;  5CG6 A;  3N6K F;  3P5R A;  2F8C F;  4DI5 A;  2PS7 A;  5AEL A;  4GP2 A;  2Z4X A;  3G4F A;  3CP6 A;  2Z4Z A;  1N1Z A;  1YYQ A;  3N3L F;  5ILY A;  2OGD A;  3NF2 A;  4JVJ F;  3BNX A;  3TFN A;  3WCC A;  3N46 F;  1WMW A;  5HN9 A;  5HN8 A;  5HN7 A;  3WCJ A;  4LTV A;  3ZMC A;  4GP1 A;  4OMH A;  3KRO B;  5ILJ A;  2P1C A;  3ZOU A;  1JFA A;  2F92 F;  1UBV A;  2ONG A;  5B01 A;  2QIS A;  1HXG A;  4XQT F;  1FPS A;  3IBA A;  4NFJ F;  3WCG A;  4LLS A;  5B03 A;  3LSN A;  2Z78 A;  3ACX A;  4KK2 A;  4LXW A;  3LJI A;  3LEE A;  4LZ3 A;  2F9K F;  5A0J A;  2FTZ A;  4DZW A;  3DYH A;  4E9U A;  5A0K A;  2FOR A;  4NFI F;  3P8R A;  3WEH A;  3B7L A;  4LIX A;  3P8L A;  1VG6 A;  3V1X A;  5DHK A;  5JV1 F;  4LUU A;  2E8T A;  5B0J A;  4LOB A;  4MC0 A;  5DGN F;  1ZW5 A;  4KVD A;  5EAS A;  3RBM A;  5ILI A;  3WJK A;  5B0K A;  5ILK A;  3Q1O A;  4PVY F;  2OPM A;  1UBW A;  3ZCD A;  2ZCO A;  3ICZ A;  3RYW A;  3VJ8 A;  4FP4 A;  5B0L A;  3AQ0 A;  1V4H A;  2E91 A;  3V1V A;  3M00 A;  5DZ2 A;  2ONH A;  4Q23 A;  4QPF A;  3UCA A;  2ZEU A;  1HM4 A;  3QQV A;  3OAB B;  1VG3 A;  3EZ3 A;  3S9V A;  3W7F A;  4NKE A;  5ERM A;  5ILH A;  3SDU A;  3M02 A;  4KVY A;  4LFG A;  3ADZ A;  1YYT A;  5DGM F;  4RYP A;  3TFP A;  1YHK A;  4KQ5 A;  1VG4 A;  3KRP A;  4GAX A;  5IVG A;  4JXN A;  2RAH A;  1V4K A;  3OAC A;  1N22 A;  3MZV A;  4JZX A;  2E92 A;  5H9D A;  3P41 A;  4LA5 A;  5ILZ A;  4KVW A;  4NKF A;  3CKE A;  4P0V A;  3WE9 A;  2E93 A;  4E1E A;  3AE0 A;  5IK0 A;  2DH4 A;  2J1P A;  1YV5 A;  5ER8 A;  3WCD A;  4DWB A;  5IL3 A;  3M0G A;  2I19 A;  3LZ9 A;  4KFA A;  4OGU A;  3TC1 A;  3Q2Z A;  4KKM A;  3PYB A;  4E9Z A;  3VJC A;  5IMP A;  2AZJ A;  3KRF A;  3SAE A;  4UMJ A;  4LTZ A;  5IMI A;  1HXA A;  1N1B A;  4ZQ8 A;  4L2X F;  4KUX A;  4F6X A;  2F94 F;  1HM7 A;  4DWG A;  1V4I A;  2PS4 A;  2PS8 A;  4LFV F;  4LLT A;  4WK5 A;  2ZCQ A;  2AET A;  5B0I A;  3S4J A;  1N23 A;  5E8H A;  1WL3 A;  4RXC A;  5EAT A;  3TS7 A;  3MAV A;  1V4E A;  5DJV F;  4K10 A;  3SDV A;  1VG7 A;  3VJD A;  3ACW A;  3AQC B;  3WEJ A;  3LLW A;  3DYG A;  5AYP A;  4KQU A;  2E8U A; 
#chains in the Genus database with same CATH homology
 5B00 A;  3VJB A;  1RQJ A;  4EA1 A;  3ASX A;  1RQI A;  2Z50 A;  3N0F A;  3WCF A;  3WC9 A;  2ZCR A;  3M01 A;  4KWD A;  3WEG A;  3PH7 A;  3ICM A;  1YHL A;  3NPK A;  3WEI A;  4DXJ A;  4LZC A;  4RXA A;  5A0I A;  5HNA A;  3EFQ A;  3VJ9 A;  4P0W A;  3Q2Q A;  4GA3 A;  5AHU B;  1YJ4 A;  2Z4Y A;  2Z7H A;  5IN8 A;  1VG2 A;  3N3D A;  3EGT A;  3DYF A;  3ZL6 A;  4N9U A;  4NFK F;  1DI1 A;  5DJP F;  3V66 A;  4QXS F;  2J5C A;  3ICK A;  3WCE A;  1WY0 A;  3KRO A;  4P0X A;  3N5H F;  5I1U A;  3APZ A;  1EZF A;  4H5D F;  5B0M A;  3P5P A;  5E8L A;  1N20 A;  4JXY A;  4LA6 A;  2EWG A;  2Q9Z A;  1WKZ A;  2E95 A;  2AEL A;  2Z4V A;  4NUA A;  5KSX F;  2E4O A;  3WJO A;  3SDQ A;  2Z52 A;  5DGS F;  4XQS F;  2ZY1 A;  2Q58 A;  3BNY A;  2H8O A;  2OA6 A;  2E90 A;  4N1Z F;  5DW7 A;  4HD1 A;  4KQS A;  4LZ0 A;  4JZB A;  1DGP A;  4RXD A;  5JV2 F;  3N45 F;  3RYE A;  3WCM A;  1WL1 A;  4OKM A;  3N1V F;  5IKH A;  4LPH F;  2Z4W A;  4EA0 A;  2O1O A;  1HX9 A;  4NG6 A;  3N1W F;  4H5C F;  1RTR A;  4H5E F;  5IK6 A;  1PS1 A;  3WSA A;  3WCI A;  3ICN A;  4LPG F;  5ERN A;  4MC3 A;  2ZCS A;  3KRA B;  5IK9 A;  4KVI A;  5AFX A;  3Q30 A;  5JUZ F;  3SDR A;  3IPI A;  5ERO A;  1V4J A;  5IM1 A;  2F8Z F;  2E8X A;  4DHD A;  4F6V A;  1YQ7 A;  3KRC B;  3OAB A;  5DIQ F;  3RMG A;  5E8K A;  3WEK A;  5IKA A;  3KB9 A;  2ZEV A;  3ZMB A;  2OPN A;  5EAU A;  5DHI A;  5JA0 F;  3N49 F;  4LFE A;  3KRP B;  4FJQ A;  3WCB A;  1HXC A;  3WEF A;  1YYU A;  1UBX A;  2Q80 A;  3OAC B;  2PS6 A;  3LGZ B;  1JFG A;  1YYS A;  3VJE A;  3TFV A;  2E94 A;  3PYA A;  3NPR A;  3LMD A;  4KPJ A;  5ILD A;  3NRI A;  3PDE A;  1WL0 A;  3QKC A;  5C05 A;  3N5J F;  3LOM A;  4MC8 A;  3KRF B;  4RXE A;  3WJN A;  2E8W A;  2AZL A;  2AZK A;  3M9U A;  1N24 A;  2E8V A;  4JYX A;  3WCA A;  4XQR F;  3LK5 A;  5CG5 A;  2VF6 A;  3WCL A;  3WCH A;  5B02 A;  3SDT A;  3N0G A;  2F7M F;  5JV0 F;  3KRA A;  3CC9 A;  3ID0 A;  4F62 A;  4OMG A;  4EA2 A;  4PVX F;  3LG5 A;  2AEK A;  2F89 F;  2J1O A;  2PS5 A;  3KRC A;  2Z7I A;  3OYR A;  3G4D A;  3ACY A;  4RNQ A;  1N21 A;  1WL2 A;  4OKZ A;  1YYR A;  4KPD A;  3LGK A;  1UBY A;  5DJR F;  3VJA A;  2Q9Y A;  5IL8 A;  3AQB B;  3LDW A;  1KIZ A;  1YHM A;  3WSB A;  5IMN A;  3PKO A;  4DEM F;  3KBK A;  3LVS A;  1KIY A;  5CG6 A;  3N6K F;  3P5R A;  2F8C F;  4DI5 A;  2PS7 A;  5AEL A;  4GP2 A;  2Z4X A;  3G4F A;  3CP6 A;  2Z4Z A;  1N1Z A;  1YYQ A;  3N3L F;  5ILY A;  2OGD A;  3NF2 A;  4JVJ F;  3BNX A;  3TFN A;  3WCC A;  3N46 F;  1WMW A;  5HN9 A;  5HN8 A;  5HN7 A;  3WCJ A;  4LTV A;  3ZMC A;  4GP1 A;  4OMH A;  3KRO B;  5ILJ A;  2P1C A;  3ZOU A;  1JFA A;  2F92 F;  1UBV A;  2ONG A;  5B01 A;  2QIS A;  1HXG A;  4XQT F;  1FPS A;  3IBA A;  4NFJ F;  3WCG A;  4LLS A;  5B03 A;  3LSN A;  2Z78 A;  3ACX A;  4KK2 A;  4LXW A;  3LJI A;  3LEE A;  4LZ3 A;  2F9K F;  5A0J A;  2FTZ A;  4DZW A;  3DYH A;  4E9U A;  5A0K A;  2FOR A;  4NFI F;  3P8R A;  3WEH A;  3B7L A;  4LIX A;  3P8L A;  1VG6 A;  3V1X A;  5DHK A;  5JV1 F;  4LUU A;  2E8T A;  5B0J A;  4LOB A;  4MC0 A;  5DGN F;  1ZW5 A;  4KVD A;  5EAS A;  3RBM A;  5ILI A;  3WJK A;  5B0K A;  5ILK A;  3Q1O A;  4PVY F;  2OPM A;  1UBW A;  3ZCD A;  2ZCO A;  3ICZ A;  3RYW A;  3VJ8 A;  4FP4 A;  5B0L A;  3AQ0 A;  1V4H A;  2E91 A;  3V1V A;  3M00 A;  5DZ2 A;  2ONH A;  4Q23 A;  4QPF A;  3UCA A;  2ZEU A;  1HM4 A;  3QQV A;  3OAB B;  1VG3 A;  3EZ3 A;  3S9V A;  3W7F A;  4NKE A;  5ERM A;  5ILH A;  3SDU A;  3M02 A;  4KVY A;  4LFG A;  3ADZ A;  1YYT A;  5DGM F;  4RYP A;  3TFP A;  1YHK A;  4KQ5 A;  1VG4 A;  3KRP A;  4GAX A;  5IVG A;  4JXN A;  2RAH A;  1V4K A;  3OAC A;  1N22 A;  3MZV A;  4JZX A;  2E92 A;  5H9D A;  3P41 A;  4LA5 A;  5ILZ A;  4KVW A;  4NKF A;  3CKE A;  4P0V A;  3WE9 A;  2E93 A;  4E1E A;  3AE0 A;  5IK0 A;  2DH4 A;  2J1P A;  1YV5 A;  5ER8 A;  3WCD A;  4DWB A;  5IL3 A;  3M0G A;  2I19 A;  3LZ9 A;  4KFA A;  4OGU A;  3TC1 A;  3Q2Z A;  4KKM A;  3PYB A;  4E9Z A;  3VJC A;  5IMP A;  2AZJ A;  3KRF A;  3SAE A;  4UMJ A;  4LTZ A;  5IMI A;  1HXA A;  1N1B A;  4ZQ8 A;  4L2X F;  4KUX A;  4F6X A;  2F94 F;  1HM7 A;  4DWG A;  1V4I A;  2PS4 A;  2PS8 A;  4LFV F;  4LLT A;  4WK5 A;  2ZCQ A;  2AET A;  5B0I A;  3S4J A;  1N23 A;  5E8H A;  1WL3 A;  4RXC A;  5EAT A;  3TS7 A;  3MAV A;  1V4E A;  5DJV F;  4K10 A;  3SDV A;  1VG7 A;  3VJD A;  3ACW A;  3AQC B;  3WEJ A;  3LLW A;  3DYG A;  5AYP A;  4KQU A;  2E8U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...