5B0LA

Structure of moen5-sso7d fusion protein in complex with beta-nonyl glucoside
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
264
structure length
264
Chain Sequence
DDDDKMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRHLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase, dna binding protein
molecule keywords MoeN5,DNA-binding protein 7d
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
total genus 120
structure length 264
sequence length 264
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2015-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b0lA00
3V1VA 3IPIA 4DWGA 3B7LA 2AEKA 4KVYA 3WCBA 3BNXA 3ICNA 4OGUA 3LVSA 2J5CA 4P0VA 1N24A 5B0KA 4NFJF 4H5DF 3WCFA 3P8RA 2FORA 4OKZA 3RMGA 5DGSF 2ZEUA 3VJ9A 3WEJA 3OACA 2ONGA 5IN8A 2E91A 4KFAA 4DEMF 3M01A 1EZFA 3RBMA 1UBXA 3CC9A 5JV0F 3S9VA 1WY0A 4JVJF 1V4HA 3Q2ZA 5HN7A 3TFVA 2OPMA 3ADZA 3OACB 3WEHA 3P8LA 4NKEA 1ZW5A 4H5CF 3LGKA 1V4IA 3ICZA 3LJIA 3KB9A 5ILKA 3LSNA 2AELA 3TC1A 2Z4YA 3S4JA 3WJNA 3LDWA 5DJRF 5C05A 1HXCA 4LOBA 4LLTA 3RYEA 5AFXA 3DYFA 3AE0A 5A0KA 4DWBA 1N23A 2Z7IA 3OYRA 4RYPA 3TS7A 2Z50A 4F6VA 3WCIA 3WEIA 2ZY1A 5B03A 3N46F 5JUZF 4K10A 4LIXA 5IKAA 4KVIA 5EASA 4RNQA 5ILIA 2ZCSA 5ILYA 1N21A 3ASXA 4FJQA 3ACXA 3N49F 3TFPA 1WL3A 4E9UA 4KKMA 2F7MF 3VJDA 2E4OA 3N3LF 3PH7A 1YHKA 2E93A 4KPDA 5IL8A 5HN8A 4LZCA 2RAHA 1UBYA 3VJEA 3PKOA 3WEGA 3NRIA 4JZXA 3M00A 3AQBB 2AZLA 5KSXF 3VJBA 3KRAA 2F9KF 1N1ZA 2PS4A 1DI1A 4MC8A 3MZVA 3N45F 5DIQF 2VF6A 3WCJA 4OMHA 5ILHA 2J1OA 4LFVF 1HM7A 1YYRA 3WCEA 4DHDA 2F92F 2FTZA 3KRAB 3WCHA 5IK6A 5ILDA 3ACYA 4KK2A 3DYHA 4LFGA 3ID0A 2H8OA 1VG2A 1HX9A 4DI5A 3SDVA 2Z4WA 5JV2F 4XQSF 2AZJA 4MC0A 3AQCB 5JV1F 1YYSA 5DHIA 4PVYF 1WMWA 2E92A 4LA6A 2F8ZF 3LEEA 3LMDA 3WCCA 5E8KA 3KRFA 1VG6A 3WCAA 3N5HF 5AELA 5ILZA 1YHMA 1N20A 4GP2A 1VG7A 2E8TA 5DHKA 4P0WA 2E8WA 2ZCRA 4N9UA 3EGTA 3LK5A 2AETA 4LFEA 1UBWA 5CG6A 4LXWA 4QPFA 5ERNA 3BNYA 4NFIF 1KIZA 3SDUA 4F6XA 4F62A 3KRFB 5H9DA 4JXNA 1VG4A 1WL0A 3N0GA 3DYGA 3VJCA 5IKHA 3SDTA 2F8CF 3LLWA 4N1ZF 3WJKA 3LGZB 3SDQA 3WCMA 4KUXA 4MC3A 3M0GA 4LA5A 4KQUA 3V66A 4HD1A 3PYBA 5A0JA 4WK5A 4NUAA 4KPJA 4RXEA 5JA0F 3CP6A 1JFGA 3P5PA 5E8LA 1YHLA 1YQ7A 3UCAA 5B01A 4LLSA 3Q1OA 3VJ8A 4KVDA 4LPHF 4JXYA 4Q23A 2PS8A 1HXAA 2Z7HA 5EROA 4DXJA 5CG5A 4DZWA 2Z4ZA 1HM4A 3NPRA 4EA2A 5IK0A 3WEFA 5I1UA 3KBKA 3IBAA 4OKMA 4XQTF 1YV5A 4QXSF 5B0JA 4FP4A 4RXCA 2ZCQA 3PDEA 5EAUA 4GP1A 5B0LA 2Z52A 1N22A 4L2XF 2J1PA 5EATA 1HXGA 2QISA 1YJ4A 4E9ZA 3WEKA 1V4KA 1YYTA 2EWGA 3WJOA 3N0FA 4LUUA 2E8UA 1PS1A 4NKFA 3W7FA 4LZ0A 3Q30A 3APZA 2OA6A 5IVGA 3CKEA 4JZBA 5B0MA 2F94F 3SAEA 2Q9ZA 4LTVA 1WL2A 2I19A 3OABA 3G4DA 3LZ9A 3LOMA 5ILJA 2Z4VA 3NPKA 5AYPA 4EA1A 5B02A 3ZMCA 2AZKA 5A0IA 3KROA 2E94A 4UMJA 1WL1A 3QKCA 4E1EA 1YYQA 1WKZA 3N3DA 2Z78A 1N1BA 5B0IA 3OABB 4KQ5A 5DW7A 3WC9A 3MAVA 3TFNA 3ACWA 4ZQ8A 3NF2A 2E90A 4XQRF 2OGDA 2E95A 4KQSA 5E8HA 4GA3A 1RQJA 4LZ3A 2O1OA 2ZEVA 1JFAA 3VJAA 5DZ2A 3KROB 3EFQA 3WCLA 4NG6A 2P1CA 3LG5A 3WCDA 1KIYA 1V4JA 4LPGF 3ZCDA 3WSAA 3EZ3A 3ICMA 4LTZA 5B00A 2OPNA 2Z4XA 2E8VA 3PYAA 4P0XA 3SDRA 2DH4A 5AHUB 5DJPF 4EA0A 3ZL6A 4JYXA 2ONHA 3KRPA 3G4FA 5IK9A 1V4EA 3N1WF 2F89F 3QQVA 4KWDA 3P5RA 2E8XA 3N5JF 4PVXF 5ER8A 2PS7A 1RQIA 1DGPA 5DJVF 3ZOUA 2Q80A 3KRPB 2Q58A 3N6KF 5IMPA 3Q2QA 2PS6A 3ZMBA 3V1XA 3KRCA 5IL3A 5DGNF 4GAXA 2ZCOA 4RXDA 5ERMA 3AQ0A 3P41A 4KVWA 4RXAA 2Q9YA 2PS5A 4H5EF 3RYWA 5IM1A 1VG3A 3WE9A 5HNAA 5IMNA 3KRCB 1UBVA 3N1VF 1YYUA 1RTRA 4NFKF 5DGMF 3WCGA 4OMGA 5IMIA 3ICKA 3WSBA 5HN9A 1FPSA 3M02A 3M9UA
chains in the Genus database with same CATH superfamily
3V1VA 3IPIA 4DWGA 3B7LA 2AEKA 4KVYA 3WCBA 3BNXA 3ICNA 4OGUA 3LVSA 2J5CA 4P0VA 1N24A 5B0KA 4NFJF 4H5DF 3WCFA 3P8RA 2FORA 4OKZA 3RMGA 5DGSF 2ZEUA 3VJ9A 3WEJA 3OACA 2ONGA 5IN8A 2E91A 4KFAA 4DEMF 3M01A 1EZFA 3RBMA 1UBXA 3CC9A 5JV0F 3S9VA 1WY0A 4JVJF 1V4HA 3Q2ZA 5HN7A 3TFVA 2OPMA 3ADZA 3OACB 3WEHA 3P8LA 4NKEA 1ZW5A 4H5CF 3LGKA 1V4IA 3ICZA 3LJIA 3KB9A 5ILKA 3LSNA 2AELA 3TC1A 2Z4YA 3S4JA 3WJNA 3LDWA 5DJRF 5C05A 1HXCA 4LOBA 4LLTA 3RYEA 5AFXA 3DYFA 3AE0A 5A0KA 4DWBA 1N23A 2Z7IA 3OYRA 4RYPA 3TS7A 2Z50A 4F6VA 3WCIA 3WEIA 2ZY1A 5B03A 3N46F 5JUZF 4K10A 4LIXA 5IKAA 4KVIA 5EASA 4RNQA 5ILIA 2ZCSA 5ILYA 1N21A 3ASXA 4FJQA 3ACXA 3N49F 3TFPA 1WL3A 4E9UA 4KKMA 2F7MF 3VJDA 2E4OA 3N3LF 3PH7A 1YHKA 2E93A 4KPDA 5IL8A 5HN8A 4LZCA 2RAHA 1UBYA 3VJEA 3PKOA 3WEGA 3NRIA 4JZXA 3M00A 3AQBB 2AZLA 5KSXF 3VJBA 3KRAA 2F9KF 1N1ZA 2PS4A 1DI1A 4MC8A 3MZVA 3N45F 5DIQF 2VF6A 3WCJA 4OMHA 5ILHA 2J1OA 4LFVF 1HM7A 1YYRA 3WCEA 4DHDA 2F92F 2FTZA 3KRAB 3WCHA 5IK6A 5ILDA 3ACYA 4KK2A 3DYHA 4LFGA 3ID0A 2H8OA 1VG2A 1HX9A 4DI5A 3SDVA 2Z4WA 5JV2F 4XQSF 2AZJA 4MC0A 3AQCB 5JV1F 1YYSA 5DHIA 4PVYF 1WMWA 2E92A 4LA6A 2F8ZF 3LEEA 3LMDA 3WCCA 5E8KA 3KRFA 1VG6A 3WCAA 3N5HF 5AELA 5ILZA 1YHMA 1N20A 4GP2A 1VG7A 2E8TA 5DHKA 4P0WA 2E8WA 2ZCRA 4N9UA 3EGTA 3LK5A 2AETA 4LFEA 1UBWA 5CG6A 4LXWA 4QPFA 5ERNA 3BNYA 4NFIF 1KIZA 3SDUA 4F6XA 4F62A 3KRFB 5H9DA 4JXNA 1VG4A 1WL0A 3N0GA 3DYGA 3VJCA 5IKHA 3SDTA 2F8CF 3LLWA 4N1ZF 3WJKA 3LGZB 3SDQA 3WCMA 4KUXA 4MC3A 3M0GA 4LA5A 4KQUA 3V66A 4HD1A 3PYBA 5A0JA 4WK5A 4NUAA 4KPJA 4RXEA 5JA0F 3CP6A 1JFGA 3P5PA 5E8LA 1YHLA 1YQ7A 3UCAA 5B01A 4LLSA 3Q1OA 3VJ8A 4KVDA 4LPHF 4JXYA 4Q23A 2PS8A 1HXAA 2Z7HA 5EROA 4DXJA 5CG5A 4DZWA 2Z4ZA 1HM4A 3NPRA 4EA2A 5IK0A 3WEFA 5I1UA 3KBKA 3IBAA 4OKMA 4XQTF 1YV5A 4QXSF 5B0JA 4FP4A 4RXCA 2ZCQA 3PDEA 5EAUA 4GP1A 5B0LA 2Z52A 1N22A 4L2XF 2J1PA 5EATA 1HXGA 2QISA 1YJ4A 4E9ZA 3WEKA 1V4KA 1YYTA 2EWGA 3WJOA 3N0FA 4LUUA 2E8UA 1PS1A 4NKFA 3W7FA 4LZ0A 3Q30A 3APZA 2OA6A 5IVGA 3CKEA 4JZBA 5B0MA 2F94F 3SAEA 2Q9ZA 4LTVA 1WL2A 2I19A 3OABA 3G4DA 3LZ9A 3LOMA 5ILJA 2Z4VA 3NPKA 5AYPA 4EA1A 5B02A 3ZMCA 2AZKA 5A0IA 3KROA 2E94A 4UMJA 1WL1A 3QKCA 4E1EA 1YYQA 1WKZA 3N3DA 2Z78A 1N1BA 5B0IA 3OABB 4KQ5A 5DW7A 3WC9A 3MAVA 3TFNA 3ACWA 4ZQ8A 3NF2A 2E90A 4XQRF 2OGDA 2E95A 4KQSA 5E8HA 4GA3A 1RQJA 4LZ3A 2O1OA 2ZEVA 1JFAA 3VJAA 5DZ2A 3KROB 3EFQA 3WCLA 4NG6A 2P1CA 3LG5A 3WCDA 1KIYA 1V4JA 4LPGF 3ZCDA 3WSAA 3EZ3A 3ICMA 4LTZA 5B00A 2OPNA 2Z4XA 2E8VA 3PYAA 4P0XA 3SDRA 2DH4A 5AHUB 5DJPF 4EA0A 3ZL6A 4JYXA 2ONHA 3KRPA 3G4FA 5IK9A 1V4EA 3N1WF 2F89F 3QQVA 4KWDA 3P5RA 2E8XA 3N5JF 4PVXF 5ER8A 2PS7A 1RQIA 1DGPA 5DJVF 3ZOUA 2Q80A 3KRPB 2Q58A 3N6KF 5IMPA 3Q2QA 2PS6A 3ZMBA 3V1XA 3KRCA 5IL3A 5DGNF 4GAXA 2ZCOA 4RXDA 5ERMA 3AQ0A 3P41A 4KVWA 4RXAA 2Q9YA 2PS5A 4H5EF 3RYWA 5IM1A 1VG3A 3WE9A 5HNAA 5IMNA 3KRCB 1UBVA 3N1VF 1YYUA 1RTRA 4NFKF 5DGMF 3WCGA 4OMGA 5IMIA 3ICKA 3WSBA 5HN9A 1FPSA 3M02A 3M9UA
chains in the Genus database with same CATH topology
3V1VA 3IPIA 4DWGA 3B7LA 2AEKA 4KVYA 3WCBA 3BNXA 3ICNA 4OGUA 3LVSA 2J5CA 4P0VA 1N24A 5B0KA 4NFJF 4H5DF 3WCFA 3P8RA 2FORA 4OKZA 3RMGA 5DGSF 2ZEUA 3VJ9A 3WEJA 3OACA 2ONGA 5IN8A 2E91A 4KFAA 4DEMF 3M01A 1EZFA 3RBMA 1UBXA 3CC9A 5JV0F 3S9VA 1WY0A 4JVJF 1V4HA 3Q2ZA 5HN7A 3TFVA 2OPMA 3ADZA 3OACB 3WEHA 3P8LA 4NKEA 1ZW5A 4H5CF 3LGKA 1V4IA 3ICZA 3LJIA 3KB9A 5ILKA 3LSNA 2AELA 3TC1A 2Z4YA 3S4JA 3WJNA 3LDWA 5DJRF 5C05A 1HXCA 4LOBA 4LLTA 3RYEA 5AFXA 3DYFA 3AE0A 5A0KA 4DWBA 1N23A 2Z7IA 3OYRA 4RYPA 3TS7A 2Z50A 4F6VA 3WCIA 3WEIA 2ZY1A 5B03A 3N46F 5JUZF 4K10A 4LIXA 5IKAA 4KVIA 5EASA 4RNQA 5ILIA 2ZCSA 5ILYA 1N21A 3ASXA 4FJQA 3ACXA 3N49F 3TFPA 1WL3A 4E9UA 4KKMA 2F7MF 3VJDA 2E4OA 3N3LF 3PH7A 1YHKA 2E93A 4KPDA 5IL8A 5HN8A 4LZCA 2RAHA 1UBYA 3VJEA 3PKOA 3WEGA 3NRIA 4JZXA 3M00A 3AQBB 2AZLA 5KSXF 3VJBA 3KRAA 2F9KF 1N1ZA 2PS4A 1DI1A 4MC8A 3MZVA 3N45F 5DIQF 2VF6A 3WCJA 4OMHA 5ILHA 2J1OA 4LFVF 1HM7A 1YYRA 3WCEA 4DHDA 2F92F 2FTZA 3KRAB 3WCHA 5IK6A 5ILDA 3ACYA 4KK2A 3DYHA 4LFGA 3ID0A 2H8OA 1VG2A 1HX9A 4DI5A 3SDVA 2Z4WA 5JV2F 4XQSF 2AZJA 4MC0A 3AQCB 5JV1F 1YYSA 5DHIA 4PVYF 1WMWA 2E92A 4LA6A 2F8ZF 3LEEA 3LMDA 3WCCA 5E8KA 3KRFA 1VG6A 3WCAA 3N5HF 5AELA 5ILZA 1YHMA 1N20A 4GP2A 1VG7A 2E8TA 5DHKA 4P0WA 2E8WA 2ZCRA 4N9UA 3EGTA 3LK5A 2AETA 4LFEA 1UBWA 5CG6A 4LXWA 4QPFA 5ERNA 3BNYA 4NFIF 1KIZA 3SDUA 4F6XA 4F62A 3KRFB 5H9DA 4JXNA 1VG4A 1WL0A 3N0GA 3DYGA 3VJCA 5IKHA 3SDTA 2F8CF 3LLWA 4N1ZF 3WJKA 3LGZB 3SDQA 3WCMA 4KUXA 4MC3A 3M0GA 4LA5A 4KQUA 3V66A 4HD1A 3PYBA 5A0JA 4WK5A 4NUAA 4KPJA 4RXEA 5JA0F 3CP6A 1JFGA 3P5PA 5E8LA 1YHLA 1YQ7A 3UCAA 5B01A 4LLSA 3Q1OA 3VJ8A 4KVDA 4LPHF 4JXYA 4Q23A 2PS8A 1HXAA 2Z7HA 5EROA 4DXJA 5CG5A 4DZWA 2Z4ZA 1HM4A 3NPRA 4EA2A 5IK0A 3WEFA 5I1UA 3KBKA 3IBAA 4OKMA 4XQTF 1YV5A 4QXSF 5B0JA 4FP4A 4RXCA 2ZCQA 3PDEA 5EAUA 4GP1A 5B0LA 2Z52A 1N22A 4L2XF 2J1PA 5EATA 1HXGA 2QISA 1YJ4A 4E9ZA 3WEKA 1V4KA 1YYTA 2EWGA 3WJOA 3N0FA 4LUUA 2E8UA 1PS1A 4NKFA 3W7FA 4LZ0A 3Q30A 3APZA 2OA6A 5IVGA 3CKEA 4JZBA 5B0MA 2F94F 3SAEA 2Q9ZA 4LTVA 1WL2A 2I19A 3OABA 3G4DA 3LZ9A 3LOMA 5ILJA 2Z4VA 3NPKA 5AYPA 4EA1A 5B02A 3ZMCA 2AZKA 5A0IA 3KROA 2E94A 4UMJA 1WL1A 3QKCA 4E1EA 1YYQA 1WKZA 3N3DA 2Z78A 1N1BA 5B0IA 3OABB 4KQ5A 5DW7A 3WC9A 3MAVA 3TFNA 3ACWA 4ZQ8A 3NF2A 2E90A 4XQRF 2OGDA 2E95A 4KQSA 5E8HA 4GA3A 1RQJA 4LZ3A 2O1OA 2ZEVA 1JFAA 3VJAA 5DZ2A 3KROB 3EFQA 3WCLA 4NG6A 2P1CA 3LG5A 3WCDA 1KIYA 1V4JA 4LPGF 3ZCDA 3WSAA 3EZ3A 3ICMA 4LTZA 5B00A 2OPNA 2Z4XA 2E8VA 3PYAA 4P0XA 3SDRA 2DH4A 5AHUB 5DJPF 4EA0A 3ZL6A 4JYXA 2ONHA 3KRPA 3G4FA 5IK9A 1V4EA 3N1WF 2F89F 3QQVA 4KWDA 3P5RA 2E8XA 3N5JF 4PVXF 5ER8A 2PS7A 1RQIA 1DGPA 5DJVF 3ZOUA 2Q80A 3KRPB 2Q58A 3N6KF 5IMPA 3Q2QA 2PS6A 3ZMBA 3V1XA 3KRCA 5IL3A 5DGNF 4GAXA 2ZCOA 4RXDA 5ERMA 3AQ0A 3P41A 4KVWA 4RXAA 2Q9YA 2PS5A 4H5EF 3RYWA 5IM1A 1VG3A 3WE9A 5HNAA 5IMNA 3KRCB 1UBVA 3N1VF 1YYUA 1RTRA 4NFKF 5DGMF 3WCGA 4OMGA 5IMIA 3ICKA 3WSBA 5HN9A 1FPSA 3M02A 3M9UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V1V A;  3IPI A;  4DWG A;  3B7L A;  2AEK A;  4KVY A;  3WCB A;  3BNX A;  3ICN A;  4OGU A;  3LVS A;  2J5C A;  4P0V A;  1N24 A;  5B0K A;  4NFJ F;  4H5D F;  3WCF A;  3P8R A;  2FOR A;  4OKZ A;  3RMG A;  5DGS F;  2ZEU A;  3VJ9 A;  3WEJ A;  3OAC A;  2ONG A;  5IN8 A;  2E91 A;  4KFA A;  4DEM F;  3M01 A;  1EZF A;  3RBM A;  1UBX A;  3CC9 A;  5JV0 F;  3S9V A;  1WY0 A;  4JVJ F;  1V4H A;  3Q2Z A;  5HN7 A;  3TFV A;  2OPM A;  3ADZ A;  3OAC B;  3WEH A;  3P8L A;  4NKE A;  1ZW5 A;  4H5C F;  3LGK A;  1V4I A;  3ICZ A;  3LJI A;  3KB9 A;  5ILK A;  3LSN A;  2AEL A;  3TC1 A;  2Z4Y A;  3S4J A;  3WJN A;  3LDW A;  5DJR F;  5C05 A;  1HXC A;  4LOB A;  4LLT A;  3RYE A;  5AFX A;  3DYF A;  3AE0 A;  5A0K A;  4DWB A;  1N23 A;  2Z7I A;  3OYR A;  4RYP A;  3TS7 A;  2Z50 A;  4F6V A;  3WCI A;  3WEI A;  2ZY1 A;  5B03 A;  3N46 F;  5JUZ F;  4K10 A;  4LIX A;  5IKA A;  4KVI A;  5EAS A;  4RNQ A;  5ILI A;  2ZCS A;  5ILY A;  1N21 A;  3ASX A;  4FJQ A;  3ACX A;  3N49 F;  3TFP A;  1WL3 A;  4E9U A;  4KKM A;  2F7M F;  3VJD A;  2E4O A;  3N3L F;  3PH7 A;  1YHK A;  2E93 A;  4KPD A;  5IL8 A;  5HN8 A;  4LZC A;  2RAH A;  1UBY A;  3VJE A;  3PKO A;  3WEG A;  3NRI A;  4JZX A;  3M00 A;  3AQB B;  2AZL A;  5KSX F;  3VJB A;  3KRA A;  2F9K F;  1N1Z A;  2PS4 A;  1DI1 A;  4MC8 A;  3MZV A;  3N45 F;  5DIQ F;  2VF6 A;  3WCJ A;  4OMH A;  5ILH A;  2J1O A;  4LFV F;  1HM7 A;  1YYR A;  3WCE A;  4DHD A;  2F92 F;  2FTZ A;  3KRA B;  3WCH A;  5IK6 A;  5ILD A;  3ACY A;  4KK2 A;  3DYH A;  4LFG A;  3ID0 A;  2H8O A;  1VG2 A;  1HX9 A;  4DI5 A;  3SDV A;  2Z4W A;  5JV2 F;  4XQS F;  2AZJ A;  4MC0 A;  3AQC B;  5JV1 F;  1YYS A;  5DHI A;  4PVY F;  1WMW A;  2E92 A;  4LA6 A;  2F8Z F;  3LEE A;  3LMD A;  3WCC A;  5E8K A;  3KRF A;  1VG6 A;  3WCA A;  3N5H F;  5AEL A;  5ILZ A;  1YHM A;  1N20 A;  4GP2 A;  1VG7 A;  2E8T A;  5DHK A;  4P0W A;  2E8W A;  2ZCR A;  4N9U A;  3EGT A;  3LK5 A;  2AET A;  4LFE A;  1UBW A;  5CG6 A;  4LXW A;  4QPF A;  5ERN A;  3BNY A;  4NFI F;  1KIZ A;  3SDU A;  4F6X A;  4F62 A;  3KRF B;  5H9D A;  4JXN A;  1VG4 A;  1WL0 A;  3N0G A;  3DYG A;  3VJC A;  5IKH A;  3SDT A;  2F8C F;  3LLW A;  4N1Z F;  3WJK A;  3LGZ B;  3SDQ A;  3WCM A;  4KUX A;  4MC3 A;  3M0G A;  4LA5 A;  4KQU A;  3V66 A;  4HD1 A;  3PYB A;  5A0J A;  4WK5 A;  4NUA A;  4KPJ A;  4RXE A;  5JA0 F;  3CP6 A;  1JFG A;  3P5P A;  5E8L A;  1YHL A;  1YQ7 A;  3UCA A;  5B01 A;  4LLS A;  3Q1O A;  3VJ8 A;  4KVD A;  4LPH F;  4JXY A;  4Q23 A;  2PS8 A;  1HXA A;  2Z7H A;  5ERO A;  4DXJ A;  5CG5 A;  4DZW A;  2Z4Z A;  1HM4 A;  3NPR A;  4EA2 A;  5IK0 A;  3WEF A;  5I1U A;  3KBK A;  3IBA A;  4OKM A;  4XQT F;  1YV5 A;  4QXS F;  5B0J A;  4FP4 A;  4RXC A;  2ZCQ A;  3PDE A;  5EAU A;  4GP1 A;  5B0L A;  2Z52 A;  1N22 A;  4L2X F;  2J1P A;  5EAT A;  1HXG A;  2QIS A;  1YJ4 A;  4E9Z A;  3WEK A;  1V4K A;  1YYT A;  2EWG A;  3WJO A;  3N0F A;  4LUU A;  2E8U A;  1PS1 A;  4NKF A;  3W7F A;  4LZ0 A;  3Q30 A;  3APZ A;  2OA6 A;  5IVG A;  3CKE A;  4JZB A;  5B0M A;  2F94 F;  3SAE A;  2Q9Z A;  4LTV A;  1WL2 A;  2I19 A;  3OAB A;  3G4D A;  3LZ9 A;  3LOM A;  5ILJ A;  2Z4V A;  3NPK A;  5AYP A;  4EA1 A;  5B02 A;  3ZMC A;  2AZK A;  5A0I A;  3KRO A;  2E94 A;  4UMJ A;  1WL1 A;  3QKC A;  4E1E A;  1YYQ A;  1WKZ A;  3N3D A;  2Z78 A;  1N1B A;  5B0I A;  3OAB B;  4KQ5 A;  5DW7 A;  3WC9 A;  3MAV A;  3TFN A;  3ACW A;  4ZQ8 A;  3NF2 A;  2E90 A;  4XQR F;  2OGD A;  2E95 A;  4KQS A;  5E8H A;  4GA3 A;  1RQJ A;  4LZ3 A;  2O1O A;  2ZEV A;  1JFA A;  3VJA A;  5DZ2 A;  3KRO B;  3EFQ A;  3WCL A;  4NG6 A;  2P1C A;  3LG5 A;  3WCD A;  1KIY A;  1V4J A;  4LPG F;  3ZCD A;  3WSA A;  3EZ3 A;  3ICM A;  4LTZ A;  5B00 A;  2OPN A;  2Z4X A;  2E8V A;  3PYA A;  4P0X A;  3SDR A;  2DH4 A;  5AHU B;  5DJP F;  4EA0 A;  3ZL6 A;  4JYX A;  2ONH A;  3KRP A;  3G4F A;  5IK9 A;  1V4E A;  3N1W F;  2F89 F;  3QQV A;  4KWD A;  3P5R A;  2E8X A;  3N5J F;  4PVX F;  5ER8 A;  2PS7 A;  1RQI A;  1DGP A;  5DJV F;  3ZOU A;  2Q80 A;  3KRP B;  2Q58 A;  3N6K F;  5IMP A;  3Q2Q A;  2PS6 A;  3ZMB A;  3V1X A;  3KRC A;  5IL3 A;  5DGN F;  4GAX A;  2ZCO A;  4RXD A;  5ERM A;  3AQ0 A;  3P41 A;  4KVW A;  4RXA A;  2Q9Y A;  2PS5 A;  4H5E F;  3RYW A;  5IM1 A;  1VG3 A;  3WE9 A;  5HNA A;  5IMN A;  3KRC B;  1UBV A;  3N1V F;  1YYU A;  1RTR A;  4NFK F;  5DGM F;  3WCG A;  4OMG A;  5IMI A;  3ICK A;  3WSB A;  5HN9 A;  1FPS A;  3M02 A;  3M9U A; 
#chains in the Genus database with same CATH topology
 3V1V A;  3IPI A;  4DWG A;  3B7L A;  2AEK A;  4KVY A;  3WCB A;  3BNX A;  3ICN A;  4OGU A;  3LVS A;  2J5C A;  4P0V A;  1N24 A;  5B0K A;  4NFJ F;  4H5D F;  3WCF A;  3P8R A;  2FOR A;  4OKZ A;  3RMG A;  5DGS F;  2ZEU A;  3VJ9 A;  3WEJ A;  3OAC A;  2ONG A;  5IN8 A;  2E91 A;  4KFA A;  4DEM F;  3M01 A;  1EZF A;  3RBM A;  1UBX A;  3CC9 A;  5JV0 F;  3S9V A;  1WY0 A;  4JVJ F;  1V4H A;  3Q2Z A;  5HN7 A;  3TFV A;  2OPM A;  3ADZ A;  3OAC B;  3WEH A;  3P8L A;  4NKE A;  1ZW5 A;  4H5C F;  3LGK A;  1V4I A;  3ICZ A;  3LJI A;  3KB9 A;  5ILK A;  3LSN A;  2AEL A;  3TC1 A;  2Z4Y A;  3S4J A;  3WJN A;  3LDW A;  5DJR F;  5C05 A;  1HXC A;  4LOB A;  4LLT A;  3RYE A;  5AFX A;  3DYF A;  3AE0 A;  5A0K A;  4DWB A;  1N23 A;  2Z7I A;  3OYR A;  4RYP A;  3TS7 A;  2Z50 A;  4F6V A;  3WCI A;  3WEI A;  2ZY1 A;  5B03 A;  3N46 F;  5JUZ F;  4K10 A;  4LIX A;  5IKA A;  4KVI A;  5EAS A;  4RNQ A;  5ILI A;  2ZCS A;  5ILY A;  1N21 A;  3ASX A;  4FJQ A;  3ACX A;  3N49 F;  3TFP A;  1WL3 A;  4E9U A;  4KKM A;  2F7M F;  3VJD A;  2E4O A;  3N3L F;  3PH7 A;  1YHK A;  2E93 A;  4KPD A;  5IL8 A;  5HN8 A;  4LZC A;  2RAH A;  1UBY A;  3VJE A;  3PKO A;  3WEG A;  3NRI A;  4JZX A;  3M00 A;  3AQB B;  2AZL A;  5KSX F;  3VJB A;  3KRA A;  2F9K F;  1N1Z A;  2PS4 A;  1DI1 A;  4MC8 A;  3MZV A;  3N45 F;  5DIQ F;  2VF6 A;  3WCJ A;  4OMH A;  5ILH A;  2J1O A;  4LFV F;  1HM7 A;  1YYR A;  3WCE A;  4DHD A;  2F92 F;  2FTZ A;  3KRA B;  3WCH A;  5IK6 A;  5ILD A;  3ACY A;  4KK2 A;  3DYH A;  4LFG A;  3ID0 A;  2H8O A;  1VG2 A;  1HX9 A;  4DI5 A;  3SDV A;  2Z4W A;  5JV2 F;  4XQS F;  2AZJ A;  4MC0 A;  3AQC B;  5JV1 F;  1YYS A;  5DHI A;  4PVY F;  1WMW A;  2E92 A;  4LA6 A;  2F8Z F;  3LEE A;  3LMD A;  3WCC A;  5E8K A;  3KRF A;  1VG6 A;  3WCA A;  3N5H F;  5AEL A;  5ILZ A;  1YHM A;  1N20 A;  4GP2 A;  1VG7 A;  2E8T A;  5DHK A;  4P0W A;  2E8W A;  2ZCR A;  4N9U A;  3EGT A;  3LK5 A;  2AET A;  4LFE A;  1UBW A;  5CG6 A;  4LXW A;  4QPF A;  5ERN A;  3BNY A;  4NFI F;  1KIZ A;  3SDU A;  4F6X A;  4F62 A;  3KRF B;  5H9D A;  4JXN A;  1VG4 A;  1WL0 A;  3N0G A;  3DYG A;  3VJC A;  5IKH A;  3SDT A;  2F8C F;  3LLW A;  4N1Z F;  3WJK A;  3LGZ B;  3SDQ A;  3WCM A;  4KUX A;  4MC3 A;  3M0G A;  4LA5 A;  4KQU A;  3V66 A;  4HD1 A;  3PYB A;  5A0J A;  4WK5 A;  4NUA A;  4KPJ A;  4RXE A;  5JA0 F;  3CP6 A;  1JFG A;  3P5P A;  5E8L A;  1YHL A;  1YQ7 A;  3UCA A;  5B01 A;  4LLS A;  3Q1O A;  3VJ8 A;  4KVD A;  4LPH F;  4JXY A;  4Q23 A;  2PS8 A;  1HXA A;  2Z7H A;  5ERO A;  4DXJ A;  5CG5 A;  4DZW A;  2Z4Z A;  1HM4 A;  3NPR A;  4EA2 A;  5IK0 A;  3WEF A;  5I1U A;  3KBK A;  3IBA A;  4OKM A;  4XQT F;  1YV5 A;  4QXS F;  5B0J A;  4FP4 A;  4RXC A;  2ZCQ A;  3PDE A;  5EAU A;  4GP1 A;  5B0L A;  2Z52 A;  1N22 A;  4L2X F;  2J1P A;  5EAT A;  1HXG A;  2QIS A;  1YJ4 A;  4E9Z A;  3WEK A;  1V4K A;  1YYT A;  2EWG A;  3WJO A;  3N0F A;  4LUU A;  2E8U A;  1PS1 A;  4NKF A;  3W7F A;  4LZ0 A;  3Q30 A;  3APZ A;  2OA6 A;  5IVG A;  3CKE A;  4JZB A;  5B0M A;  2F94 F;  3SAE A;  2Q9Z A;  4LTV A;  1WL2 A;  2I19 A;  3OAB A;  3G4D A;  3LZ9 A;  3LOM A;  5ILJ A;  2Z4V A;  3NPK A;  5AYP A;  4EA1 A;  5B02 A;  3ZMC A;  2AZK A;  5A0I A;  3KRO A;  2E94 A;  4UMJ A;  1WL1 A;  3QKC A;  4E1E A;  1YYQ A;  1WKZ A;  3N3D A;  2Z78 A;  1N1B A;  5B0I A;  3OAB B;  4KQ5 A;  5DW7 A;  3WC9 A;  3MAV A;  3TFN A;  3ACW A;  4ZQ8 A;  3NF2 A;  2E90 A;  4XQR F;  2OGD A;  2E95 A;  4KQS A;  5E8H A;  4GA3 A;  1RQJ A;  4LZ3 A;  2O1O A;  2ZEV A;  1JFA A;  3VJA A;  5DZ2 A;  3KRO B;  3EFQ A;  3WCL A;  4NG6 A;  2P1C A;  3LG5 A;  3WCD A;  1KIY A;  1V4J A;  4LPG F;  3ZCD A;  3WSA A;  3EZ3 A;  3ICM A;  4LTZ A;  5B00 A;  2OPN A;  2Z4X A;  2E8V A;  3PYA A;  4P0X A;  3SDR A;  2DH4 A;  5AHU B;  5DJP F;  4EA0 A;  3ZL6 A;  4JYX A;  2ONH A;  3KRP A;  3G4F A;  5IK9 A;  1V4E A;  3N1W F;  2F89 F;  3QQV A;  4KWD A;  3P5R A;  2E8X A;  3N5J F;  4PVX F;  5ER8 A;  2PS7 A;  1RQI A;  1DGP A;  5DJV F;  3ZOU A;  2Q80 A;  3KRP B;  2Q58 A;  3N6K F;  5IMP A;  3Q2Q A;  2PS6 A;  3ZMB A;  3V1X A;  3KRC A;  5IL3 A;  5DGN F;  4GAX A;  2ZCO A;  4RXD A;  5ERM A;  3AQ0 A;  3P41 A;  4KVW A;  4RXA A;  2Q9Y A;  2PS5 A;  4H5E F;  3RYW A;  5IM1 A;  1VG3 A;  3WE9 A;  5HNA A;  5IMN A;  3KRC B;  1UBV A;  3N1V F;  1YYU A;  1RTR A;  4NFK F;  5DGM F;  3WCG A;  4OMG A;  5IMI A;  3ICK A;  3WSB A;  5HN9 A;  1FPS A;  3M02 A;  3M9U A; 
#chains in the Genus database with same CATH homology
 3V1V A;  3IPI A;  4DWG A;  3B7L A;  2AEK A;  4KVY A;  3WCB A;  3BNX A;  3ICN A;  4OGU A;  3LVS A;  2J5C A;  4P0V A;  1N24 A;  5B0K A;  4NFJ F;  4H5D F;  3WCF A;  3P8R A;  2FOR A;  4OKZ A;  3RMG A;  5DGS F;  2ZEU A;  3VJ9 A;  3WEJ A;  3OAC A;  2ONG A;  5IN8 A;  2E91 A;  4KFA A;  4DEM F;  3M01 A;  1EZF A;  3RBM A;  1UBX A;  3CC9 A;  5JV0 F;  3S9V A;  1WY0 A;  4JVJ F;  1V4H A;  3Q2Z A;  5HN7 A;  3TFV A;  2OPM A;  3ADZ A;  3OAC B;  3WEH A;  3P8L A;  4NKE A;  1ZW5 A;  4H5C F;  3LGK A;  1V4I A;  3ICZ A;  3LJI A;  3KB9 A;  5ILK A;  3LSN A;  2AEL A;  3TC1 A;  2Z4Y A;  3S4J A;  3WJN A;  3LDW A;  5DJR F;  5C05 A;  1HXC A;  4LOB A;  4LLT A;  3RYE A;  5AFX A;  3DYF A;  3AE0 A;  5A0K A;  4DWB A;  1N23 A;  2Z7I A;  3OYR A;  4RYP A;  3TS7 A;  2Z50 A;  4F6V A;  3WCI A;  3WEI A;  2ZY1 A;  5B03 A;  3N46 F;  5JUZ F;  4K10 A;  4LIX A;  5IKA A;  4KVI A;  5EAS A;  4RNQ A;  5ILI A;  2ZCS A;  5ILY A;  1N21 A;  3ASX A;  4FJQ A;  3ACX A;  3N49 F;  3TFP A;  1WL3 A;  4E9U A;  4KKM A;  2F7M F;  3VJD A;  2E4O A;  3N3L F;  3PH7 A;  1YHK A;  2E93 A;  4KPD A;  5IL8 A;  5HN8 A;  4LZC A;  2RAH A;  1UBY A;  3VJE A;  3PKO A;  3WEG A;  3NRI A;  4JZX A;  3M00 A;  3AQB B;  2AZL A;  5KSX F;  3VJB A;  3KRA A;  2F9K F;  1N1Z A;  2PS4 A;  1DI1 A;  4MC8 A;  3MZV A;  3N45 F;  5DIQ F;  2VF6 A;  3WCJ A;  4OMH A;  5ILH A;  2J1O A;  4LFV F;  1HM7 A;  1YYR A;  3WCE A;  4DHD A;  2F92 F;  2FTZ A;  3KRA B;  3WCH A;  5IK6 A;  5ILD A;  3ACY A;  4KK2 A;  3DYH A;  4LFG A;  3ID0 A;  2H8O A;  1VG2 A;  1HX9 A;  4DI5 A;  3SDV A;  2Z4W A;  5JV2 F;  4XQS F;  2AZJ A;  4MC0 A;  3AQC B;  5JV1 F;  1YYS A;  5DHI A;  4PVY F;  1WMW A;  2E92 A;  4LA6 A;  2F8Z F;  3LEE A;  3LMD A;  3WCC A;  5E8K A;  3KRF A;  1VG6 A;  3WCA A;  3N5H F;  5AEL A;  5ILZ A;  1YHM A;  1N20 A;  4GP2 A;  1VG7 A;  2E8T A;  5DHK A;  4P0W A;  2E8W A;  2ZCR A;  4N9U A;  3EGT A;  3LK5 A;  2AET A;  4LFE A;  1UBW A;  5CG6 A;  4LXW A;  4QPF A;  5ERN A;  3BNY A;  4NFI F;  1KIZ A;  3SDU A;  4F6X A;  4F62 A;  3KRF B;  5H9D A;  4JXN A;  1VG4 A;  1WL0 A;  3N0G A;  3DYG A;  3VJC A;  5IKH A;  3SDT A;  2F8C F;  3LLW A;  4N1Z F;  3WJK A;  3LGZ B;  3SDQ A;  3WCM A;  4KUX A;  4MC3 A;  3M0G A;  4LA5 A;  4KQU A;  3V66 A;  4HD1 A;  3PYB A;  5A0J A;  4WK5 A;  4NUA A;  4KPJ A;  4RXE A;  5JA0 F;  3CP6 A;  1JFG A;  3P5P A;  5E8L A;  1YHL A;  1YQ7 A;  3UCA A;  5B01 A;  4LLS A;  3Q1O A;  3VJ8 A;  4KVD A;  4LPH F;  4JXY A;  4Q23 A;  2PS8 A;  1HXA A;  2Z7H A;  5ERO A;  4DXJ A;  5CG5 A;  4DZW A;  2Z4Z A;  1HM4 A;  3NPR A;  4EA2 A;  5IK0 A;  3WEF A;  5I1U A;  3KBK A;  3IBA A;  4OKM A;  4XQT F;  1YV5 A;  4QXS F;  5B0J A;  4FP4 A;  4RXC A;  2ZCQ A;  3PDE A;  5EAU A;  4GP1 A;  5B0L A;  2Z52 A;  1N22 A;  4L2X F;  2J1P A;  5EAT A;  1HXG A;  2QIS A;  1YJ4 A;  4E9Z A;  3WEK A;  1V4K A;  1YYT A;  2EWG A;  3WJO A;  3N0F A;  4LUU A;  2E8U A;  1PS1 A;  4NKF A;  3W7F A;  4LZ0 A;  3Q30 A;  3APZ A;  2OA6 A;  5IVG A;  3CKE A;  4JZB A;  5B0M A;  2F94 F;  3SAE A;  2Q9Z A;  4LTV A;  1WL2 A;  2I19 A;  3OAB A;  3G4D A;  3LZ9 A;  3LOM A;  5ILJ A;  2Z4V A;  3NPK A;  5AYP A;  4EA1 A;  5B02 A;  3ZMC A;  2AZK A;  5A0I A;  3KRO A;  2E94 A;  4UMJ A;  1WL1 A;  3QKC A;  4E1E A;  1YYQ A;  1WKZ A;  3N3D A;  2Z78 A;  1N1B A;  5B0I A;  3OAB B;  4KQ5 A;  5DW7 A;  3WC9 A;  3MAV A;  3TFN A;  3ACW A;  4ZQ8 A;  3NF2 A;  2E90 A;  4XQR F;  2OGD A;  2E95 A;  4KQS A;  5E8H A;  4GA3 A;  1RQJ A;  4LZ3 A;  2O1O A;  2ZEV A;  1JFA A;  3VJA A;  5DZ2 A;  3KRO B;  3EFQ A;  3WCL A;  4NG6 A;  2P1C A;  3LG5 A;  3WCD A;  1KIY A;  1V4J A;  4LPG F;  3ZCD A;  3WSA A;  3EZ3 A;  3ICM A;  4LTZ A;  5B00 A;  2OPN A;  2Z4X A;  2E8V A;  3PYA A;  4P0X A;  3SDR A;  2DH4 A;  5AHU B;  5DJP F;  4EA0 A;  3ZL6 A;  4JYX A;  2ONH A;  3KRP A;  3G4F A;  5IK9 A;  1V4E A;  3N1W F;  2F89 F;  3QQV A;  4KWD A;  3P5R A;  2E8X A;  3N5J F;  4PVX F;  5ER8 A;  2PS7 A;  1RQI A;  1DGP A;  5DJV F;  3ZOU A;  2Q80 A;  3KRP B;  2Q58 A;  3N6K F;  5IMP A;  3Q2Q A;  2PS6 A;  3ZMB A;  3V1X A;  3KRC A;  5IL3 A;  5DGN F;  4GAX A;  2ZCO A;  4RXD A;  5ERM A;  3AQ0 A;  3P41 A;  4KVW A;  4RXA A;  2Q9Y A;  2PS5 A;  4H5E F;  3RYW A;  5IM1 A;  1VG3 A;  3WE9 A;  5HNA A;  5IMN A;  3KRC B;  1UBV A;  3N1V F;  1YYU A;  1RTR A;  4NFK F;  5DGM F;  3WCG A;  4OMG A;  5IMI A;  3ICK A;  3WSB A;  5HN9 A;  1FPS A;  3M02 A;  3M9U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...