4EA0A

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with diphosphate and quinuclidine bph-651
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 120
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4ea0A00
4NFIF 3Q2QA 3WEFA 2ONHA 3RYWA 3M9UA 4LA6A 4H5DF 4NG6A 3LGZB 5B0JA 3TFNA 5IKAA 2QISA 5ILHA 2F89F 4LXWA 5IMPA 3WEGA 4F6XA 5ILZA 5CG6A 1YJ4A 3ID0A 3WCGA 4Q23A 3N1VF 3PKOA 5DGMF 2OGDA 3CC9A 3UCAA 3KRPB 5HN9A 2E8XA 3KRPA 5A0KA 5B00A 2E93A 3LOMA 1V4JA 3N45F 3M0GA 5IVGA 3WCLA 3VJ8A 5ILKA 1VG6A 4LTVA 4P0VA 3WEKA 4JZBA 5B0KA 1FPSA 3SDQA 1N24A 2H8OA 4NFJF 3Q2ZA 2Z4WA 4L2XF 3KB9A 5IM1A 1VG3A 1UBVA 2E8VA 1V4IA 2F9KF 5C05A 3V66A 5JUZF 4DI5A 4EA2A 3WJOA 1JFAA 3VJCA 3SDVA 5E8HA 3SDTA 4DWGA 4OKMA 3LEEA 3LDWA 1V4HA 1HXAA 1YV5A 2Z4VA 5DIQF 1HXCA 4RXEA 3WSBA 3WCJA 3ICKA 3DYHA 3B7LA 3G4FA 3WCBA 3CP6A 1HXGA 2AELA 4KKMA 4KWDA 5E8KA 3ZL6A 3ACYA 2F7MF 4LLSA 5B02A 4KQUA 4F6VA 2Z7IA 1EZFA 5B0IA 3ZMCA 5ILIA 1V4KA 3ICZA 3QQVA 5DW7A 4KVWA 3WCCA 3RYEA 3Q30A 5B01A 4RXAA 3V1XA 2DH4A 2F92F 3WE9A 2Q9YA 5IMNA 2E8TA 3WCFA 5DJVF 3VJDA 4MC8A 4KPJA 5DJPF 3WEHA 1WL3A 1YYTA 4NUAA 4LTZA 2ZCQA 4NKEA 1RQJA 3G4DA 3NPKA 3TC1A 1HM4A 1RTRA 1YHLA 4XQSF 3EFQA 3RBMA 3EGTA 3N5JF 4FP4A 4P0WA 5H9DA 5EASA 3TFPA 3WCDA 3OYRA 3Q1OA 3ADZA 3AE0A 2E8WA 3M02A 3N49F 3V1VA 5A0JA 2F8ZF 4LPHF 2ZY1A 3KRFB 4RXDA 3NF2A 2P1CA 5DJRF 3KRFA 4KQSA 4KVYA 1N23A 3AQBB 5HN8A 2E91A 2F8CF 2PS4A 4KQ5A 3WEIA 3SDUA 4EA1A 1WY0A 3ZCDA 2J5CA 1KIYA 4JVJF 5JV0F 5ILYA 1N20A 3PYAA 4LIXA 1DI1A 1WL0A 2EWGA 3VJ9A 3ACWA 3ICNA 3N3DA 4RNQA 5DGSF 3S4JA 2PS6A 4HD1A 2Q9ZA 3LJIA 3PH7A 2FTZA 2E90A 2E94A 3OABB 5JV1F 5IK9A 4JYXA 3OABA 3P5RA 2PS7A 5IL3A 4OKZA 4GA3A 1WL2A 5A0IA 3NRIA 3CKEA 3MZVA 4RXCA 4RYPA 5HN7A 1YHKA 4DXJA 4DHDA 3P5PA 3QKCA 3ZOUA 5IL8A 3OACB 3P8LA 3OACA 2Z7HA 3N6KF 4N9UA 3WCEA 5EAUA 4DZWA 2AZJA 3TFVA 4DWBA 1KIZA 3NPRA 4LLTA 3LK5A 3WCHA 3S9VA 1N22A 4LFVF 3N0GA 4H5CF 4PVYF 4KPDA 3ASXA 3WJNA 2OA6A 3MAVA 2Z78A 3PYBA 2I19A 3WCMA 2Z4XA 2Q58A 2F94F 3LLWA 5IKHA 5E8LA 5IN8A 1DGPA 4LA5A 1WMWA 4KVDA 3VJEA 3VJBA 5DZ2A 4JXNA 1WL1A 3LZ9A 3P8RA 5IMIA 3KRCB 2ZCOA 1ZW5A 3KRCA 4OGUA 5DHKA 3N0FA 2ZCSA 3KROA 3DYGA 3VJAA 3RMGA 3LGKA 4LPGF 5I1UA 2E8UA 1HX9A 2AZKA 3WEJA 3DYFA 4GP1A 2AEKA 3P41A 5AFXA 3W7FA 2ZEUA 4XQRF 3WC9A 1YYQA 4P0XA 5JV2F 4E1EA 4UMJA 1PS1A 2O1OA 2E92A 2RAHA 1WKZA 2J1OA 3WSAA 1VG2A 5B0MA 4N1ZF 2Z4YA 3PDEA 4KK2A 1N1BA 5KSXF 2PS8A 3AQ0A 4LOBA 5ILJA 1UBYA 3LSNA 2ONGA 4H5EF 2OPMA 4DEMF 2FORA 4LZ3A 4MC3A 4LFGA 5DHIA 3N3LF 4KUXA 5IK6A 3M01A 3WJKA 5AELA 4LUUA 3ACXA 2Z50A 4K10A 3APZA 5AYPA 4LZCA 4PVXF 1YYSA 4KVIA 1RQIA 1UBXA 3TS7A 3LMDA 3AQCB 1YQ7A 3M00A 5DGNF 3SDRA 4EA0A 5CG5A 5IK0A 2Z52A 2ZCRA 1UBWA 2VF6A 3N1WF 3N46F 5B0LA 3ZMBA 4LZ0A 1YYRA 3WCIA 5JA0F 3BNYA 3KRAB 2PS5A 4GP2A 5EROA 3KRAA 5ER8A 2OPNA 3BNXA 4XQTF 4MC0A 4OMGA 4JXYA 1YHMA 4QXSF 4WK5A 2J1PA 2E4OA 4NKFA 4FJQA 2Q80A 2E95A 3EZ3A 4LFEA 4E9ZA 1YYUA 1V4EA 3N5HF 3LVSA 4QPFA 5EATA 3ICMA 1VG4A 5ILDA 5ERNA 1HM7A 5B03A 3WCAA 2ZEVA 3IPIA 1N21A 4F62A 4OMHA 3IBAA 2AETA 4E9UA 4KFAA 3KROB 4JZXA 1N1ZA 5HNAA 1VG7A 2AZLA 3LG5A 4GAXA 5AHUB 4ZQ8A 3KBKA 1JFGA 4NFKF 5ERMA 3SAEA 2Z4ZA
chains in the Genus database with same CATH superfamily
4NFIF 3Q2QA 3WEFA 2ONHA 3RYWA 3M9UA 4LA6A 4H5DF 4NG6A 3LGZB 5B0JA 3TFNA 5IKAA 2QISA 5ILHA 2F89F 4LXWA 5IMPA 3WEGA 4F6XA 5ILZA 5CG6A 1YJ4A 3ID0A 3WCGA 4Q23A 3N1VF 3PKOA 5DGMF 2OGDA 3CC9A 3UCAA 3KRPB 5HN9A 2E8XA 3KRPA 5A0KA 5B00A 2E93A 3LOMA 1V4JA 3N45F 3M0GA 5IVGA 3WCLA 3VJ8A 5ILKA 1VG6A 4LTVA 4P0VA 3WEKA 4JZBA 5B0KA 1FPSA 3SDQA 1N24A 2H8OA 4NFJF 3Q2ZA 2Z4WA 4L2XF 3KB9A 5IM1A 1VG3A 1UBVA 2E8VA 1V4IA 2F9KF 5C05A 3V66A 5JUZF 4DI5A 4EA2A 3WJOA 1JFAA 3VJCA 3SDVA 5E8HA 3SDTA 4DWGA 4OKMA 3LEEA 3LDWA 1V4HA 1HXAA 1YV5A 2Z4VA 5DIQF 1HXCA 4RXEA 3WSBA 3WCJA 3ICKA 3DYHA 3B7LA 3G4FA 3WCBA 3CP6A 1HXGA 2AELA 4KKMA 4KWDA 5E8KA 3ZL6A 3ACYA 2F7MF 4LLSA 5B02A 4KQUA 4F6VA 2Z7IA 1EZFA 5B0IA 3ZMCA 5ILIA 1V4KA 3ICZA 3QQVA 5DW7A 4KVWA 3WCCA 3RYEA 3Q30A 5B01A 4RXAA 3V1XA 2DH4A 2F92F 3WE9A 2Q9YA 5IMNA 2E8TA 3WCFA 5DJVF 3VJDA 4MC8A 4KPJA 5DJPF 3WEHA 1WL3A 1YYTA 4NUAA 4LTZA 2ZCQA 4NKEA 1RQJA 3G4DA 3NPKA 3TC1A 1HM4A 1RTRA 1YHLA 4XQSF 3EFQA 3RBMA 3EGTA 3N5JF 4FP4A 4P0WA 5H9DA 5EASA 3TFPA 3WCDA 3OYRA 3Q1OA 3ADZA 3AE0A 2E8WA 3M02A 3N49F 3V1VA 5A0JA 2F8ZF 4LPHF 2ZY1A 3KRFB 4RXDA 3NF2A 2P1CA 5DJRF 3KRFA 4KQSA 4KVYA 1N23A 3AQBB 5HN8A 2E91A 2F8CF 2PS4A 4KQ5A 3WEIA 3SDUA 4EA1A 1WY0A 3ZCDA 2J5CA 1KIYA 4JVJF 5JV0F 5ILYA 1N20A 3PYAA 4LIXA 1DI1A 1WL0A 2EWGA 3VJ9A 3ACWA 3ICNA 3N3DA 4RNQA 5DGSF 3S4JA 2PS6A 4HD1A 2Q9ZA 3LJIA 3PH7A 2FTZA 2E90A 2E94A 3OABB 5JV1F 5IK9A 4JYXA 3OABA 3P5RA 2PS7A 5IL3A 4OKZA 4GA3A 1WL2A 5A0IA 3NRIA 3CKEA 3MZVA 4RXCA 4RYPA 5HN7A 1YHKA 4DXJA 4DHDA 3P5PA 3QKCA 3ZOUA 5IL8A 3OACB 3P8LA 3OACA 2Z7HA 3N6KF 4N9UA 3WCEA 5EAUA 4DZWA 2AZJA 3TFVA 4DWBA 1KIZA 3NPRA 4LLTA 3LK5A 3WCHA 3S9VA 1N22A 4LFVF 3N0GA 4H5CF 4PVYF 4KPDA 3ASXA 3WJNA 2OA6A 3MAVA 2Z78A 3PYBA 2I19A 3WCMA 2Z4XA 2Q58A 2F94F 3LLWA 5IKHA 5E8LA 5IN8A 1DGPA 4LA5A 1WMWA 4KVDA 3VJEA 3VJBA 5DZ2A 4JXNA 1WL1A 3LZ9A 3P8RA 5IMIA 3KRCB 2ZCOA 1ZW5A 3KRCA 4OGUA 5DHKA 3N0FA 2ZCSA 3KROA 3DYGA 3VJAA 3RMGA 3LGKA 4LPGF 5I1UA 2E8UA 1HX9A 2AZKA 3WEJA 3DYFA 4GP1A 2AEKA 3P41A 5AFXA 3W7FA 2ZEUA 4XQRF 3WC9A 1YYQA 4P0XA 5JV2F 4E1EA 4UMJA 1PS1A 2O1OA 2E92A 2RAHA 1WKZA 2J1OA 3WSAA 1VG2A 5B0MA 4N1ZF 2Z4YA 3PDEA 4KK2A 1N1BA 5KSXF 2PS8A 3AQ0A 4LOBA 5ILJA 1UBYA 3LSNA 2ONGA 4H5EF 2OPMA 4DEMF 2FORA 4LZ3A 4MC3A 4LFGA 5DHIA 3N3LF 4KUXA 5IK6A 3M01A 3WJKA 5AELA 4LUUA 3ACXA 2Z50A 4K10A 3APZA 5AYPA 4LZCA 4PVXF 1YYSA 4KVIA 1RQIA 1UBXA 3TS7A 3LMDA 3AQCB 1YQ7A 3M00A 5DGNF 3SDRA 4EA0A 5CG5A 5IK0A 2Z52A 2ZCRA 1UBWA 2VF6A 3N1WF 3N46F 5B0LA 3ZMBA 4LZ0A 1YYRA 3WCIA 5JA0F 3BNYA 3KRAB 2PS5A 4GP2A 5EROA 3KRAA 5ER8A 2OPNA 3BNXA 4XQTF 4MC0A 4OMGA 4JXYA 1YHMA 4QXSF 4WK5A 2J1PA 2E4OA 4NKFA 4FJQA 2Q80A 2E95A 3EZ3A 4LFEA 4E9ZA 1YYUA 1V4EA 3N5HF 3LVSA 4QPFA 5EATA 3ICMA 1VG4A 5ILDA 5ERNA 1HM7A 5B03A 3WCAA 2ZEVA 3IPIA 1N21A 4F62A 4OMHA 3IBAA 2AETA 4E9UA 4KFAA 3KROB 4JZXA 1N1ZA 5HNAA 1VG7A 2AZLA 3LG5A 4GAXA 5AHUB 4ZQ8A 3KBKA 1JFGA 4NFKF 5ERMA 3SAEA 2Z4ZA
chains in the Genus database with same CATH topology
4NFIF 3Q2QA 3WEFA 2ONHA 3RYWA 3M9UA 4LA6A 4H5DF 4NG6A 3LGZB 5B0JA 3TFNA 5IKAA 2QISA 5ILHA 2F89F 4LXWA 5IMPA 3WEGA 4F6XA 5ILZA 5CG6A 1YJ4A 3ID0A 3WCGA 4Q23A 3N1VF 3PKOA 5DGMF 2OGDA 3CC9A 3UCAA 3KRPB 5HN9A 2E8XA 3KRPA 5A0KA 5B00A 2E93A 3LOMA 1V4JA 3N45F 3M0GA 5IVGA 3WCLA 3VJ8A 5ILKA 1VG6A 4LTVA 4P0VA 3WEKA 4JZBA 5B0KA 1FPSA 3SDQA 1N24A 2H8OA 4NFJF 3Q2ZA 2Z4WA 4L2XF 3KB9A 5IM1A 1VG3A 1UBVA 2E8VA 1V4IA 2F9KF 5C05A 3V66A 5JUZF 4DI5A 4EA2A 3WJOA 1JFAA 3VJCA 3SDVA 5E8HA 3SDTA 4DWGA 4OKMA 3LEEA 3LDWA 1V4HA 1HXAA 1YV5A 2Z4VA 5DIQF 1HXCA 4RXEA 3WSBA 3WCJA 3ICKA 3DYHA 3B7LA 3G4FA 3WCBA 3CP6A 1HXGA 2AELA 4KKMA 4KWDA 5E8KA 3ZL6A 3ACYA 2F7MF 4LLSA 5B02A 4KQUA 4F6VA 2Z7IA 1EZFA 5B0IA 3ZMCA 5ILIA 1V4KA 3ICZA 3QQVA 5DW7A 4KVWA 3WCCA 3RYEA 3Q30A 5B01A 4RXAA 3V1XA 2DH4A 2F92F 3WE9A 2Q9YA 5IMNA 2E8TA 3WCFA 5DJVF 3VJDA 4MC8A 4KPJA 5DJPF 3WEHA 1WL3A 1YYTA 4NUAA 4LTZA 2ZCQA 4NKEA 1RQJA 3G4DA 3NPKA 3TC1A 1HM4A 1RTRA 1YHLA 4XQSF 3EFQA 3RBMA 3EGTA 3N5JF 4FP4A 4P0WA 5H9DA 5EASA 3TFPA 3WCDA 3OYRA 3Q1OA 3ADZA 3AE0A 2E8WA 3M02A 3N49F 3V1VA 5A0JA 2F8ZF 4LPHF 2ZY1A 3KRFB 4RXDA 3NF2A 2P1CA 5DJRF 3KRFA 4KQSA 4KVYA 1N23A 3AQBB 5HN8A 2E91A 2F8CF 2PS4A 4KQ5A 3WEIA 3SDUA 4EA1A 1WY0A 3ZCDA 2J5CA 1KIYA 4JVJF 5JV0F 5ILYA 1N20A 3PYAA 4LIXA 1DI1A 1WL0A 2EWGA 3VJ9A 3ACWA 3ICNA 3N3DA 4RNQA 5DGSF 3S4JA 2PS6A 4HD1A 2Q9ZA 3LJIA 3PH7A 2FTZA 2E90A 2E94A 3OABB 5JV1F 5IK9A 4JYXA 3OABA 3P5RA 2PS7A 5IL3A 4OKZA 4GA3A 1WL2A 5A0IA 3NRIA 3CKEA 3MZVA 4RXCA 4RYPA 5HN7A 1YHKA 4DXJA 4DHDA 3P5PA 3QKCA 3ZOUA 5IL8A 3OACB 3P8LA 3OACA 2Z7HA 3N6KF 4N9UA 3WCEA 5EAUA 4DZWA 2AZJA 3TFVA 4DWBA 1KIZA 3NPRA 4LLTA 3LK5A 3WCHA 3S9VA 1N22A 4LFVF 3N0GA 4H5CF 4PVYF 4KPDA 3ASXA 3WJNA 2OA6A 3MAVA 2Z78A 3PYBA 2I19A 3WCMA 2Z4XA 2Q58A 2F94F 3LLWA 5IKHA 5E8LA 5IN8A 1DGPA 4LA5A 1WMWA 4KVDA 3VJEA 3VJBA 5DZ2A 4JXNA 1WL1A 3LZ9A 3P8RA 5IMIA 3KRCB 2ZCOA 1ZW5A 3KRCA 4OGUA 5DHKA 3N0FA 2ZCSA 3KROA 3DYGA 3VJAA 3RMGA 3LGKA 4LPGF 5I1UA 2E8UA 1HX9A 2AZKA 3WEJA 3DYFA 4GP1A 2AEKA 3P41A 5AFXA 3W7FA 2ZEUA 4XQRF 3WC9A 1YYQA 4P0XA 5JV2F 4E1EA 4UMJA 1PS1A 2O1OA 2E92A 2RAHA 1WKZA 2J1OA 3WSAA 1VG2A 5B0MA 4N1ZF 2Z4YA 3PDEA 4KK2A 1N1BA 5KSXF 2PS8A 3AQ0A 4LOBA 5ILJA 1UBYA 3LSNA 2ONGA 4H5EF 2OPMA 4DEMF 2FORA 4LZ3A 4MC3A 4LFGA 5DHIA 3N3LF 4KUXA 5IK6A 3M01A 3WJKA 5AELA 4LUUA 3ACXA 2Z50A 4K10A 3APZA 5AYPA 4LZCA 4PVXF 1YYSA 4KVIA 1RQIA 1UBXA 3TS7A 3LMDA 3AQCB 1YQ7A 3M00A 5DGNF 3SDRA 4EA0A 5CG5A 5IK0A 2Z52A 2ZCRA 1UBWA 2VF6A 3N1WF 3N46F 5B0LA 3ZMBA 4LZ0A 1YYRA 3WCIA 5JA0F 3BNYA 3KRAB 2PS5A 4GP2A 5EROA 3KRAA 5ER8A 2OPNA 3BNXA 4XQTF 4MC0A 4OMGA 4JXYA 1YHMA 4QXSF 4WK5A 2J1PA 2E4OA 4NKFA 4FJQA 2Q80A 2E95A 3EZ3A 4LFEA 4E9ZA 1YYUA 1V4EA 3N5HF 3LVSA 4QPFA 5EATA 3ICMA 1VG4A 5ILDA 5ERNA 1HM7A 5B03A 3WCAA 2ZEVA 3IPIA 1N21A 4F62A 4OMHA 3IBAA 2AETA 4E9UA 4KFAA 3KROB 4JZXA 1N1ZA 5HNAA 1VG7A 2AZLA 3LG5A 4GAXA 5AHUB 4ZQ8A 3KBKA 1JFGA 4NFKF 5ERMA 3SAEA 2Z4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NFI F;  3Q2Q A;  3WEF A;  2ONH A;  3RYW A;  3M9U A;  4LA6 A;  4H5D F;  4NG6 A;  3LGZ B;  5B0J A;  3TFN A;  5IKA A;  2QIS A;  5ILH A;  2F89 F;  4LXW A;  5IMP A;  3WEG A;  4F6X A;  5ILZ A;  5CG6 A;  1YJ4 A;  3ID0 A;  3WCG A;  4Q23 A;  3N1V F;  3PKO A;  5DGM F;  2OGD A;  3CC9 A;  3UCA A;  3KRP B;  5HN9 A;  2E8X A;  3KRP A;  5A0K A;  5B00 A;  2E93 A;  3LOM A;  1V4J A;  3N45 F;  3M0G A;  5IVG A;  3WCL A;  3VJ8 A;  5ILK A;  1VG6 A;  4LTV A;  4P0V A;  3WEK A;  4JZB A;  5B0K A;  1FPS A;  3SDQ A;  1N24 A;  2H8O A;  4NFJ F;  3Q2Z A;  2Z4W A;  4L2X F;  3KB9 A;  5IM1 A;  1VG3 A;  1UBV A;  2E8V A;  1V4I A;  2F9K F;  5C05 A;  3V66 A;  5JUZ F;  4DI5 A;  4EA2 A;  3WJO A;  1JFA A;  3VJC A;  3SDV A;  5E8H A;  3SDT A;  4DWG A;  4OKM A;  3LEE A;  3LDW A;  1V4H A;  1HXA A;  1YV5 A;  2Z4V A;  5DIQ F;  1HXC A;  4RXE A;  3WSB A;  3WCJ A;  3ICK A;  3DYH A;  3B7L A;  3G4F A;  3WCB A;  3CP6 A;  1HXG A;  2AEL A;  4KKM A;  4KWD A;  5E8K A;  3ZL6 A;  3ACY A;  2F7M F;  4LLS A;  5B02 A;  4KQU A;  4F6V A;  2Z7I A;  1EZF A;  5B0I A;  3ZMC A;  5ILI A;  1V4K A;  3ICZ A;  3QQV A;  5DW7 A;  4KVW A;  3WCC A;  3RYE A;  3Q30 A;  5B01 A;  4RXA A;  3V1X A;  2DH4 A;  2F92 F;  3WE9 A;  2Q9Y A;  5IMN A;  2E8T A;  3WCF A;  5DJV F;  3VJD A;  4MC8 A;  4KPJ A;  5DJP F;  3WEH A;  1WL3 A;  1YYT A;  4NUA A;  4LTZ A;  2ZCQ A;  4NKE A;  1RQJ A;  3G4D A;  3NPK A;  3TC1 A;  1HM4 A;  1RTR A;  1YHL A;  4XQS F;  3EFQ A;  3RBM A;  3EGT A;  3N5J F;  4FP4 A;  4P0W A;  5H9D A;  5EAS A;  3TFP A;  3WCD A;  3OYR A;  3Q1O A;  3ADZ A;  3AE0 A;  2E8W A;  3M02 A;  3N49 F;  3V1V A;  5A0J A;  2F8Z F;  4LPH F;  2ZY1 A;  3KRF B;  4RXD A;  3NF2 A;  2P1C A;  5DJR F;  3KRF A;  4KQS A;  4KVY A;  1N23 A;  3AQB B;  5HN8 A;  2E91 A;  2F8C F;  2PS4 A;  4KQ5 A;  3WEI A;  3SDU A;  4EA1 A;  1WY0 A;  3ZCD A;  2J5C A;  1KIY A;  4JVJ F;  5JV0 F;  5ILY A;  1N20 A;  3PYA A;  4LIX A;  1DI1 A;  1WL0 A;  2EWG A;  3VJ9 A;  3ACW A;  3ICN A;  3N3D A;  4RNQ A;  5DGS F;  3S4J A;  2PS6 A;  4HD1 A;  2Q9Z A;  3LJI A;  3PH7 A;  2FTZ A;  2E90 A;  2E94 A;  3OAB B;  5JV1 F;  5IK9 A;  4JYX A;  3OAB A;  3P5R A;  2PS7 A;  5IL3 A;  4OKZ A;  4GA3 A;  1WL2 A;  5A0I A;  3NRI A;  3CKE A;  3MZV A;  4RXC A;  4RYP A;  5HN7 A;  1YHK A;  4DXJ A;  4DHD A;  3P5P A;  3QKC A;  3ZOU A;  5IL8 A;  3OAC B;  3P8L A;  3OAC A;  2Z7H A;  3N6K F;  4N9U A;  3WCE A;  5EAU A;  4DZW A;  2AZJ A;  3TFV A;  4DWB A;  1KIZ A;  3NPR A;  4LLT A;  3LK5 A;  3WCH A;  3S9V A;  1N22 A;  4LFV F;  3N0G A;  4H5C F;  4PVY F;  4KPD A;  3ASX A;  3WJN A;  2OA6 A;  3MAV A;  2Z78 A;  3PYB A;  2I19 A;  3WCM A;  2Z4X A;  2Q58 A;  2F94 F;  3LLW A;  5IKH A;  5E8L A;  5IN8 A;  1DGP A;  4LA5 A;  1WMW A;  4KVD A;  3VJE A;  3VJB A;  5DZ2 A;  4JXN A;  1WL1 A;  3LZ9 A;  3P8R A;  5IMI A;  3KRC B;  2ZCO A;  1ZW5 A;  3KRC A;  4OGU A;  5DHK A;  3N0F A;  2ZCS A;  3KRO A;  3DYG A;  3VJA A;  3RMG A;  3LGK A;  4LPG F;  5I1U A;  2E8U A;  1HX9 A;  2AZK A;  3WEJ A;  3DYF A;  4GP1 A;  2AEK A;  3P41 A;  5AFX A;  3W7F A;  2ZEU A;  4XQR F;  3WC9 A;  1YYQ A;  4P0X A;  5JV2 F;  4E1E A;  4UMJ A;  1PS1 A;  2O1O A;  2E92 A;  2RAH A;  1WKZ A;  2J1O A;  3WSA A;  1VG2 A;  5B0M A;  4N1Z F;  2Z4Y A;  3PDE A;  4KK2 A;  1N1B A;  5KSX F;  2PS8 A;  3AQ0 A;  4LOB A;  5ILJ A;  1UBY A;  3LSN A;  2ONG A;  4H5E F;  2OPM A;  4DEM F;  2FOR A;  4LZ3 A;  4MC3 A;  4LFG A;  5DHI A;  3N3L F;  4KUX A;  5IK6 A;  3M01 A;  3WJK A;  5AEL A;  4LUU A;  3ACX A;  2Z50 A;  4K10 A;  3APZ A;  5AYP A;  4LZC A;  4PVX F;  1YYS A;  4KVI A;  1RQI A;  1UBX A;  3TS7 A;  3LMD A;  3AQC B;  1YQ7 A;  3M00 A;  5DGN F;  3SDR A;  4EA0 A;  5CG5 A;  5IK0 A;  2Z52 A;  2ZCR A;  1UBW A;  2VF6 A;  3N1W F;  3N46 F;  5B0L A;  3ZMB A;  4LZ0 A;  1YYR A;  3WCI A;  5JA0 F;  3BNY A;  3KRA B;  2PS5 A;  4GP2 A;  5ERO A;  3KRA A;  5ER8 A;  2OPN A;  3BNX A;  4XQT F;  4MC0 A;  4OMG A;  4JXY A;  1YHM A;  4QXS F;  4WK5 A;  2J1P A;  2E4O A;  4NKF A;  4FJQ A;  2Q80 A;  2E95 A;  3EZ3 A;  4LFE A;  4E9Z A;  1YYU A;  1V4E A;  3N5H F;  3LVS A;  4QPF A;  5EAT A;  3ICM A;  1VG4 A;  5ILD A;  5ERN A;  1HM7 A;  5B03 A;  3WCA A;  2ZEV A;  3IPI A;  1N21 A;  4F62 A;  4OMH A;  3IBA A;  2AET A;  4E9U A;  4KFA A;  3KRO B;  4JZX A;  1N1Z A;  5HNA A;  1VG7 A;  2AZL A;  3LG5 A;  4GAX A;  5AHU B;  4ZQ8 A;  3KBK A;  1JFG A;  4NFK F;  5ERM A;  3SAE A;  2Z4Z A; 
#chains in the Genus database with same CATH topology
 4NFI F;  3Q2Q A;  3WEF A;  2ONH A;  3RYW A;  3M9U A;  4LA6 A;  4H5D F;  4NG6 A;  3LGZ B;  5B0J A;  3TFN A;  5IKA A;  2QIS A;  5ILH A;  2F89 F;  4LXW A;  5IMP A;  3WEG A;  4F6X A;  5ILZ A;  5CG6 A;  1YJ4 A;  3ID0 A;  3WCG A;  4Q23 A;  3N1V F;  3PKO A;  5DGM F;  2OGD A;  3CC9 A;  3UCA A;  3KRP B;  5HN9 A;  2E8X A;  3KRP A;  5A0K A;  5B00 A;  2E93 A;  3LOM A;  1V4J A;  3N45 F;  3M0G A;  5IVG A;  3WCL A;  3VJ8 A;  5ILK A;  1VG6 A;  4LTV A;  4P0V A;  3WEK A;  4JZB A;  5B0K A;  1FPS A;  3SDQ A;  1N24 A;  2H8O A;  4NFJ F;  3Q2Z A;  2Z4W A;  4L2X F;  3KB9 A;  5IM1 A;  1VG3 A;  1UBV A;  2E8V A;  1V4I A;  2F9K F;  5C05 A;  3V66 A;  5JUZ F;  4DI5 A;  4EA2 A;  3WJO A;  1JFA A;  3VJC A;  3SDV A;  5E8H A;  3SDT A;  4DWG A;  4OKM A;  3LEE A;  3LDW A;  1V4H A;  1HXA A;  1YV5 A;  2Z4V A;  5DIQ F;  1HXC A;  4RXE A;  3WSB A;  3WCJ A;  3ICK A;  3DYH A;  3B7L A;  3G4F A;  3WCB A;  3CP6 A;  1HXG A;  2AEL A;  4KKM A;  4KWD A;  5E8K A;  3ZL6 A;  3ACY A;  2F7M F;  4LLS A;  5B02 A;  4KQU A;  4F6V A;  2Z7I A;  1EZF A;  5B0I A;  3ZMC A;  5ILI A;  1V4K A;  3ICZ A;  3QQV A;  5DW7 A;  4KVW A;  3WCC A;  3RYE A;  3Q30 A;  5B01 A;  4RXA A;  3V1X A;  2DH4 A;  2F92 F;  3WE9 A;  2Q9Y A;  5IMN A;  2E8T A;  3WCF A;  5DJV F;  3VJD A;  4MC8 A;  4KPJ A;  5DJP F;  3WEH A;  1WL3 A;  1YYT A;  4NUA A;  4LTZ A;  2ZCQ A;  4NKE A;  1RQJ A;  3G4D A;  3NPK A;  3TC1 A;  1HM4 A;  1RTR A;  1YHL A;  4XQS F;  3EFQ A;  3RBM A;  3EGT A;  3N5J F;  4FP4 A;  4P0W A;  5H9D A;  5EAS A;  3TFP A;  3WCD A;  3OYR A;  3Q1O A;  3ADZ A;  3AE0 A;  2E8W A;  3M02 A;  3N49 F;  3V1V A;  5A0J A;  2F8Z F;  4LPH F;  2ZY1 A;  3KRF B;  4RXD A;  3NF2 A;  2P1C A;  5DJR F;  3KRF A;  4KQS A;  4KVY A;  1N23 A;  3AQB B;  5HN8 A;  2E91 A;  2F8C F;  2PS4 A;  4KQ5 A;  3WEI A;  3SDU A;  4EA1 A;  1WY0 A;  3ZCD A;  2J5C A;  1KIY A;  4JVJ F;  5JV0 F;  5ILY A;  1N20 A;  3PYA A;  4LIX A;  1DI1 A;  1WL0 A;  2EWG A;  3VJ9 A;  3ACW A;  3ICN A;  3N3D A;  4RNQ A;  5DGS F;  3S4J A;  2PS6 A;  4HD1 A;  2Q9Z A;  3LJI A;  3PH7 A;  2FTZ A;  2E90 A;  2E94 A;  3OAB B;  5JV1 F;  5IK9 A;  4JYX A;  3OAB A;  3P5R A;  2PS7 A;  5IL3 A;  4OKZ A;  4GA3 A;  1WL2 A;  5A0I A;  3NRI A;  3CKE A;  3MZV A;  4RXC A;  4RYP A;  5HN7 A;  1YHK A;  4DXJ A;  4DHD A;  3P5P A;  3QKC A;  3ZOU A;  5IL8 A;  3OAC B;  3P8L A;  3OAC A;  2Z7H A;  3N6K F;  4N9U A;  3WCE A;  5EAU A;  4DZW A;  2AZJ A;  3TFV A;  4DWB A;  1KIZ A;  3NPR A;  4LLT A;  3LK5 A;  3WCH A;  3S9V A;  1N22 A;  4LFV F;  3N0G A;  4H5C F;  4PVY F;  4KPD A;  3ASX A;  3WJN A;  2OA6 A;  3MAV A;  2Z78 A;  3PYB A;  2I19 A;  3WCM A;  2Z4X A;  2Q58 A;  2F94 F;  3LLW A;  5IKH A;  5E8L A;  5IN8 A;  1DGP A;  4LA5 A;  1WMW A;  4KVD A;  3VJE A;  3VJB A;  5DZ2 A;  4JXN A;  1WL1 A;  3LZ9 A;  3P8R A;  5IMI A;  3KRC B;  2ZCO A;  1ZW5 A;  3KRC A;  4OGU A;  5DHK A;  3N0F A;  2ZCS A;  3KRO A;  3DYG A;  3VJA A;  3RMG A;  3LGK A;  4LPG F;  5I1U A;  2E8U A;  1HX9 A;  2AZK A;  3WEJ A;  3DYF A;  4GP1 A;  2AEK A;  3P41 A;  5AFX A;  3W7F A;  2ZEU A;  4XQR F;  3WC9 A;  1YYQ A;  4P0X A;  5JV2 F;  4E1E A;  4UMJ A;  1PS1 A;  2O1O A;  2E92 A;  2RAH A;  1WKZ A;  2J1O A;  3WSA A;  1VG2 A;  5B0M A;  4N1Z F;  2Z4Y A;  3PDE A;  4KK2 A;  1N1B A;  5KSX F;  2PS8 A;  3AQ0 A;  4LOB A;  5ILJ A;  1UBY A;  3LSN A;  2ONG A;  4H5E F;  2OPM A;  4DEM F;  2FOR A;  4LZ3 A;  4MC3 A;  4LFG A;  5DHI A;  3N3L F;  4KUX A;  5IK6 A;  3M01 A;  3WJK A;  5AEL A;  4LUU A;  3ACX A;  2Z50 A;  4K10 A;  3APZ A;  5AYP A;  4LZC A;  4PVX F;  1YYS A;  4KVI A;  1RQI A;  1UBX A;  3TS7 A;  3LMD A;  3AQC B;  1YQ7 A;  3M00 A;  5DGN F;  3SDR A;  4EA0 A;  5CG5 A;  5IK0 A;  2Z52 A;  2ZCR A;  1UBW A;  2VF6 A;  3N1W F;  3N46 F;  5B0L A;  3ZMB A;  4LZ0 A;  1YYR A;  3WCI A;  5JA0 F;  3BNY A;  3KRA B;  2PS5 A;  4GP2 A;  5ERO A;  3KRA A;  5ER8 A;  2OPN A;  3BNX A;  4XQT F;  4MC0 A;  4OMG A;  4JXY A;  1YHM A;  4QXS F;  4WK5 A;  2J1P A;  2E4O A;  4NKF A;  4FJQ A;  2Q80 A;  2E95 A;  3EZ3 A;  4LFE A;  4E9Z A;  1YYU A;  1V4E A;  3N5H F;  3LVS A;  4QPF A;  5EAT A;  3ICM A;  1VG4 A;  5ILD A;  5ERN A;  1HM7 A;  5B03 A;  3WCA A;  2ZEV A;  3IPI A;  1N21 A;  4F62 A;  4OMH A;  3IBA A;  2AET A;  4E9U A;  4KFA A;  3KRO B;  4JZX A;  1N1Z A;  5HNA A;  1VG7 A;  2AZL A;  3LG5 A;  4GAX A;  5AHU B;  4ZQ8 A;  3KBK A;  1JFG A;  4NFK F;  5ERM A;  3SAE A;  2Z4Z A; 
#chains in the Genus database with same CATH homology
 4NFI F;  3Q2Q A;  3WEF A;  2ONH A;  3RYW A;  3M9U A;  4LA6 A;  4H5D F;  4NG6 A;  3LGZ B;  5B0J A;  3TFN A;  5IKA A;  2QIS A;  5ILH A;  2F89 F;  4LXW A;  5IMP A;  3WEG A;  4F6X A;  5ILZ A;  5CG6 A;  1YJ4 A;  3ID0 A;  3WCG A;  4Q23 A;  3N1V F;  3PKO A;  5DGM F;  2OGD A;  3CC9 A;  3UCA A;  3KRP B;  5HN9 A;  2E8X A;  3KRP A;  5A0K A;  5B00 A;  2E93 A;  3LOM A;  1V4J A;  3N45 F;  3M0G A;  5IVG A;  3WCL A;  3VJ8 A;  5ILK A;  1VG6 A;  4LTV A;  4P0V A;  3WEK A;  4JZB A;  5B0K A;  1FPS A;  3SDQ A;  1N24 A;  2H8O A;  4NFJ F;  3Q2Z A;  2Z4W A;  4L2X F;  3KB9 A;  5IM1 A;  1VG3 A;  1UBV A;  2E8V A;  1V4I A;  2F9K F;  5C05 A;  3V66 A;  5JUZ F;  4DI5 A;  4EA2 A;  3WJO A;  1JFA A;  3VJC A;  3SDV A;  5E8H A;  3SDT A;  4DWG A;  4OKM A;  3LEE A;  3LDW A;  1V4H A;  1HXA A;  1YV5 A;  2Z4V A;  5DIQ F;  1HXC A;  4RXE A;  3WSB A;  3WCJ A;  3ICK A;  3DYH A;  3B7L A;  3G4F A;  3WCB A;  3CP6 A;  1HXG A;  2AEL A;  4KKM A;  4KWD A;  5E8K A;  3ZL6 A;  3ACY A;  2F7M F;  4LLS A;  5B02 A;  4KQU A;  4F6V A;  2Z7I A;  1EZF A;  5B0I A;  3ZMC A;  5ILI A;  1V4K A;  3ICZ A;  3QQV A;  5DW7 A;  4KVW A;  3WCC A;  3RYE A;  3Q30 A;  5B01 A;  4RXA A;  3V1X A;  2DH4 A;  2F92 F;  3WE9 A;  2Q9Y A;  5IMN A;  2E8T A;  3WCF A;  5DJV F;  3VJD A;  4MC8 A;  4KPJ A;  5DJP F;  3WEH A;  1WL3 A;  1YYT A;  4NUA A;  4LTZ A;  2ZCQ A;  4NKE A;  1RQJ A;  3G4D A;  3NPK A;  3TC1 A;  1HM4 A;  1RTR A;  1YHL A;  4XQS F;  3EFQ A;  3RBM A;  3EGT A;  3N5J F;  4FP4 A;  4P0W A;  5H9D A;  5EAS A;  3TFP A;  3WCD A;  3OYR A;  3Q1O A;  3ADZ A;  3AE0 A;  2E8W A;  3M02 A;  3N49 F;  3V1V A;  5A0J A;  2F8Z F;  4LPH F;  2ZY1 A;  3KRF B;  4RXD A;  3NF2 A;  2P1C A;  5DJR F;  3KRF A;  4KQS A;  4KVY A;  1N23 A;  3AQB B;  5HN8 A;  2E91 A;  2F8C F;  2PS4 A;  4KQ5 A;  3WEI A;  3SDU A;  4EA1 A;  1WY0 A;  3ZCD A;  2J5C A;  1KIY A;  4JVJ F;  5JV0 F;  5ILY A;  1N20 A;  3PYA A;  4LIX A;  1DI1 A;  1WL0 A;  2EWG A;  3VJ9 A;  3ACW A;  3ICN A;  3N3D A;  4RNQ A;  5DGS F;  3S4J A;  2PS6 A;  4HD1 A;  2Q9Z A;  3LJI A;  3PH7 A;  2FTZ A;  2E90 A;  2E94 A;  3OAB B;  5JV1 F;  5IK9 A;  4JYX A;  3OAB A;  3P5R A;  2PS7 A;  5IL3 A;  4OKZ A;  4GA3 A;  1WL2 A;  5A0I A;  3NRI A;  3CKE A;  3MZV A;  4RXC A;  4RYP A;  5HN7 A;  1YHK A;  4DXJ A;  4DHD A;  3P5P A;  3QKC A;  3ZOU A;  5IL8 A;  3OAC B;  3P8L A;  3OAC A;  2Z7H A;  3N6K F;  4N9U A;  3WCE A;  5EAU A;  4DZW A;  2AZJ A;  3TFV A;  4DWB A;  1KIZ A;  3NPR A;  4LLT A;  3LK5 A;  3WCH A;  3S9V A;  1N22 A;  4LFV F;  3N0G A;  4H5C F;  4PVY F;  4KPD A;  3ASX A;  3WJN A;  2OA6 A;  3MAV A;  2Z78 A;  3PYB A;  2I19 A;  3WCM A;  2Z4X A;  2Q58 A;  2F94 F;  3LLW A;  5IKH A;  5E8L A;  5IN8 A;  1DGP A;  4LA5 A;  1WMW A;  4KVD A;  3VJE A;  3VJB A;  5DZ2 A;  4JXN A;  1WL1 A;  3LZ9 A;  3P8R A;  5IMI A;  3KRC B;  2ZCO A;  1ZW5 A;  3KRC A;  4OGU A;  5DHK A;  3N0F A;  2ZCS A;  3KRO A;  3DYG A;  3VJA A;  3RMG A;  3LGK A;  4LPG F;  5I1U A;  2E8U A;  1HX9 A;  2AZK A;  3WEJ A;  3DYF A;  4GP1 A;  2AEK A;  3P41 A;  5AFX A;  3W7F A;  2ZEU A;  4XQR F;  3WC9 A;  1YYQ A;  4P0X A;  5JV2 F;  4E1E A;  4UMJ A;  1PS1 A;  2O1O A;  2E92 A;  2RAH A;  1WKZ A;  2J1O A;  3WSA A;  1VG2 A;  5B0M A;  4N1Z F;  2Z4Y A;  3PDE A;  4KK2 A;  1N1B A;  5KSX F;  2PS8 A;  3AQ0 A;  4LOB A;  5ILJ A;  1UBY A;  3LSN A;  2ONG A;  4H5E F;  2OPM A;  4DEM F;  2FOR A;  4LZ3 A;  4MC3 A;  4LFG A;  5DHI A;  3N3L F;  4KUX A;  5IK6 A;  3M01 A;  3WJK A;  5AEL A;  4LUU A;  3ACX A;  2Z50 A;  4K10 A;  3APZ A;  5AYP A;  4LZC A;  4PVX F;  1YYS A;  4KVI A;  1RQI A;  1UBX A;  3TS7 A;  3LMD A;  3AQC B;  1YQ7 A;  3M00 A;  5DGN F;  3SDR A;  4EA0 A;  5CG5 A;  5IK0 A;  2Z52 A;  2ZCR A;  1UBW A;  2VF6 A;  3N1W F;  3N46 F;  5B0L A;  3ZMB A;  4LZ0 A;  1YYR A;  3WCI A;  5JA0 F;  3BNY A;  3KRA B;  2PS5 A;  4GP2 A;  5ERO A;  3KRA A;  5ER8 A;  2OPN A;  3BNX A;  4XQT F;  4MC0 A;  4OMG A;  4JXY A;  1YHM A;  4QXS F;  4WK5 A;  2J1P A;  2E4O A;  4NKF A;  4FJQ A;  2Q80 A;  2E95 A;  3EZ3 A;  4LFE A;  4E9Z A;  1YYU A;  1V4E A;  3N5H F;  3LVS A;  4QPF A;  5EAT A;  3ICM A;  1VG4 A;  5ILD A;  5ERN A;  1HM7 A;  5B03 A;  3WCA A;  2ZEV A;  3IPI A;  1N21 A;  4F62 A;  4OMH A;  3IBA A;  2AET A;  4E9U A;  4KFA A;  3KRO B;  4JZX A;  1N1Z A;  5HNA A;  1VG7 A;  2AZL A;  3LG5 A;  4GAX A;  5AHU B;  4ZQ8 A;  3KBK A;  1JFG A;  4NFK F;  5ERM A;  3SAE A;  2Z4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...