2OA6A

Aristolochene synthase from aspergillus terreus complexed with pyrophosphate
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
305
structure length
295
Chain Sequence
SLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTLCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Aristolochene synthase
publication title X-ray crystal structure of aristolochene synthase from Aspergillus terreus and evolution of templates for the cyclization of farnesyl diphosphate.
pubmed doi rcsb
source organism Aspergillus terreus
total genus 123
structure length 295
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2006-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2oa6A00
4FP4A 5DHKA 1N21A 3WEGA 3G4DA 3KRFB 4KPDA 3EZ3A 5EAUA 3WCAA 1RTRA 1YYSA 5ILZA 3ACWA 3LGKA 1WY0A 1YHKA 1KIZA 3Q30A 5JV0F 3LG5A 3LDWA 3N0GA 3LLWA 4KWDA 1WKZA 5CG6A 2Z4ZA 3SDTA 5ILHA 2EWGA 2RAHA 3MZVA 4PVYF 3WCJA 3N6KF 3QKCA 5ILDA 4DWBA 2OPNA 2ZY1A 4N9UA 3RMGA 4GAXA 4DI5A 2E8TA 1HXCA 2Q80A 3N45F 5AFXA 4GA3A 2AZLA 4KVDA 3WCBA 1N23A 5JV2F 4XQTF 4E1EA 5KSXF 4QXSF 5B0KA 2OA6A 5C05A 3TS7A 2PS5A 4RNQA 3LJIA 5DJRF 5DIQF 4OKMA 3ZMBA 5ILKA 2F8CF 3ZL6A 1JFAA 1UBYA 3WSAA 5I1UA 4NKEA 4JZXA 3NF2A 4RXAA 3TFVA 4P0VA 3Q1OA 3WEJA 4XQRF 4NFIF 4LA5A 3WCCA 2Z78A 3TC1A 1V4KA 3ICNA 1YHMA 3WSBA 3LSNA 5DGMF 4K10A 4LFEA 2O1OA 3EGTA 4NUAA 5E8KA 2E8XA 3VJDA 2E91A 5HN9A 2Z4YA 4KVIA 2J1PA 3KRPB 3QQVA 1HM4A 2DH4A 3SAEA 4OMGA 3KB9A 3KRCB 5IK6A 3VJBA 4LZCA 1KIYA 3P8RA 5ER8A 4DXJA 5IL3A 3Q2QA 1RQJA 4OGUA 5HNAA 1YYQA 3DYGA 4KPJA 2E94A 3ZCDA 5DHIA 3N1VF 2AZKA 3N1WF 3VJ9A 3WE9A 1VG6A 1DGPA 4RXEA 3Q2ZA 3VJ8A 3M02A 3NRIA 2Q9ZA 2ZCRA 5HN8A 5DJVF 1VG2A 3RYWA 3N5JF 3WEHA 1V4EA 2H8OA 4F6XA 4LPHF 1HXAA 3M9UA 1WL2A 3AQ0A 3V66A 3NPKA 4RXCA 4KUXA 4LPGF 3WJOA 2J5CA 5ILJA 4H5DF 4GP2A 5E8LA 1WL3A 3KROA 5B02A 4MC3A 5DGSF 5ILYA 4XQSF 1WL0A 5ERNA 1ZW5A 4LZ3A 5JV1F 3AQBB 3ICKA 3ZMCA 5AYPA 3ACYA 3M00A 3KBKA 5IK9A 3CC9A 3LZ9A 1YYRA 3WCMA 5AELA 3TFNA 1UBVA 1V4JA 4KQ5A 1EZFA 5B00A 2FORA 4NFKF 3B7LA 3S4JA 5IMIA 4KK2A 2Z50A 2ONHA 2E95A 4RYPA 2AETA 4WK5A 4KQSA 5IMNA 5JA0F 3SDUA 4L2XF 3BNYA 3ZOUA 4UMJA 2E90A 2VF6A 3KROB 2AELA 5JUZF 3WCIA 5EROA 5IL8A 4EA2A 5IKAA 5DW7A 4LTZA 3N0FA 3LK5A 5B0LA 5E8HA 1YYTA 3V1XA 5A0KA 2ZCSA 2Q9YA 4DZWA 5DGNF 2F94F 1RQIA 4LIXA 1UBXA 4H5CF 2P1CA 3WJNA 2PS7A 3ICMA 1N1BA 2AEKA 2F89F 3N46F 2E8UA 4E9ZA 1UBWA 2ZCQA 3WCFA 4PVXF 3WEKA 4ZQ8A 3LOMA 2FTZA 3PYAA 4OKZA 3RYEA 3SDVA 3PH7A 1WMWA 3PDEA 3TFPA 2Q58A 5IK0A 4DEMF 2ZEUA 5ERMA 3G4FA 3APZA 3IPIA 3WEFA 4EA1A 1PS1A 3KRAA 2E8VA 5EATA 4EA0A 3PKOA 4KKMA 2PS8A 4LTVA 3ACXA 5B01A 3WCDA 1YJ4A 3LGZB 4HD1A 4N1ZF 2J1OA 4KVYA 5B0MA 3VJEA 4JZBA 4JVJF 5H9DA 2E92A 2F92F 2QISA 2Z4VA 3OABA 4JXNA 3LMDA 4FJQA 1DI1A 3AQCB 2ONGA 2PS6A 3SDQA 3LVSA 4LFGA 1V4HA 5IMPA 3EFQA 5HN7A 3PYBA 4P0XA 1N1ZA 4LXWA 1HXGA 1VG4A 4OMHA 4RXDA 5EASA 2Z4WA 4Q23A 3P8LA 3S9VA 3SDRA 1HM7A 3P41A 3ADZA 3OYRA 3KRAB 3M0GA 4P0WA 1HX9A 2AZJA 3WCLA 3CKEA 4F6VA 4JYXA 3WCGA 4H5EF 3WJKA 3IBAA 1YYUA 3MAVA 4LA6A 1YQ7A 5DZ2A 5B03A 4KQUA 2OPMA 3KRPA 3OACA 1YV5A 1FPSA 5B0JA 2Z4XA 3BNXA 3P5RA 2F8ZF 3KRCA 4LOBA 1JFGA 1N24A 4F62A 4DHDA 3ID0A 3OABB 3RBMA 4KFAA 4LZ0A 3N49F 3ASXA 3WCHA 5DJPF 3DYHA 5ILIA 2Z7IA 2E8WA 5IVGA 3M01A 3WCEA 1VG7A 2ZCOA 5IKHA 3WEIA 3DYFA 3N5HF 2OGDA 4LUUA 3CP6A 3KRFA 3NPRA 4DWGA 2F9KF 4MC0A 4LLSA 5AHUB 3VJCA 2Z52A 1VG3A 2ZEVA 4MC8A 3LEEA 3W7FA 3AE0A 3OACB 1V4IA 3UCAA 3WC9A 4JXYA 5IM1A 1N20A 5CG5A 3P5PA 5IN8A 4QPFA 1YHLA 2PS4A 3ICZA 1WL1A 3N3DA 4NFJF 2E4OA 4KVWA 4NG6A 4LLTA 2Z7HA 2F7MF 3V1VA 4E9UA 4LFVF 4GP1A 5B0IA 3N3LF 4NKFA 3VJAA 5A0IA 2E93A 2I19A 5A0JA 1N22A
chains in the Genus database with same CATH superfamily
4FP4A 5DHKA 1N21A 3WEGA 3G4DA 3KRFB 4KPDA 3EZ3A 5EAUA 3WCAA 1RTRA 1YYSA 5ILZA 3ACWA 3LGKA 1WY0A 1YHKA 1KIZA 3Q30A 5JV0F 3LG5A 3LDWA 3N0GA 3LLWA 4KWDA 1WKZA 5CG6A 2Z4ZA 3SDTA 5ILHA 2EWGA 2RAHA 3MZVA 4PVYF 3WCJA 3N6KF 3QKCA 5ILDA 4DWBA 2OPNA 2ZY1A 4N9UA 3RMGA 4GAXA 4DI5A 2E8TA 1HXCA 2Q80A 3N45F 5AFXA 4GA3A 2AZLA 4KVDA 3WCBA 1N23A 5JV2F 4XQTF 4E1EA 5KSXF 4QXSF 5B0KA 2OA6A 5C05A 3TS7A 2PS5A 4RNQA 3LJIA 5DJRF 5DIQF 4OKMA 3ZMBA 5ILKA 2F8CF 3ZL6A 1JFAA 1UBYA 3WSAA 5I1UA 4NKEA 4JZXA 3NF2A 4RXAA 3TFVA 4P0VA 3Q1OA 3WEJA 4XQRF 4NFIF 4LA5A 3WCCA 2Z78A 3TC1A 1V4KA 3ICNA 1YHMA 3WSBA 3LSNA 5DGMF 4K10A 4LFEA 2O1OA 3EGTA 4NUAA 5E8KA 2E8XA 3VJDA 2E91A 5HN9A 2Z4YA 4KVIA 2J1PA 3KRPB 3QQVA 1HM4A 2DH4A 3SAEA 4OMGA 3KB9A 3KRCB 5IK6A 3VJBA 4LZCA 1KIYA 3P8RA 5ER8A 4DXJA 5IL3A 3Q2QA 1RQJA 4OGUA 5HNAA 1YYQA 3DYGA 4KPJA 2E94A 3ZCDA 5DHIA 3N1VF 2AZKA 3N1WF 3VJ9A 3WE9A 1VG6A 1DGPA 4RXEA 3Q2ZA 3VJ8A 3M02A 3NRIA 2Q9ZA 2ZCRA 5HN8A 5DJVF 1VG2A 3RYWA 3N5JF 3WEHA 1V4EA 2H8OA 4F6XA 4LPHF 1HXAA 3M9UA 1WL2A 3AQ0A 3V66A 3NPKA 4RXCA 4KUXA 4LPGF 3WJOA 2J5CA 5ILJA 4H5DF 4GP2A 5E8LA 1WL3A 3KROA 5B02A 4MC3A 5DGSF 5ILYA 4XQSF 1WL0A 5ERNA 1ZW5A 4LZ3A 5JV1F 3AQBB 3ICKA 3ZMCA 5AYPA 3ACYA 3M00A 3KBKA 5IK9A 3CC9A 3LZ9A 1YYRA 3WCMA 5AELA 3TFNA 1UBVA 1V4JA 4KQ5A 1EZFA 5B00A 2FORA 4NFKF 3B7LA 3S4JA 5IMIA 4KK2A 2Z50A 2ONHA 2E95A 4RYPA 2AETA 4WK5A 4KQSA 5IMNA 5JA0F 3SDUA 4L2XF 3BNYA 3ZOUA 4UMJA 2E90A 2VF6A 3KROB 2AELA 5JUZF 3WCIA 5EROA 5IL8A 4EA2A 5IKAA 5DW7A 4LTZA 3N0FA 3LK5A 5B0LA 5E8HA 1YYTA 3V1XA 5A0KA 2ZCSA 2Q9YA 4DZWA 5DGNF 2F94F 1RQIA 4LIXA 1UBXA 4H5CF 2P1CA 3WJNA 2PS7A 3ICMA 1N1BA 2AEKA 2F89F 3N46F 2E8UA 4E9ZA 1UBWA 2ZCQA 3WCFA 4PVXF 3WEKA 4ZQ8A 3LOMA 2FTZA 3PYAA 4OKZA 3RYEA 3SDVA 3PH7A 1WMWA 3PDEA 3TFPA 2Q58A 5IK0A 4DEMF 2ZEUA 5ERMA 3G4FA 3APZA 3IPIA 3WEFA 4EA1A 1PS1A 3KRAA 2E8VA 5EATA 4EA0A 3PKOA 4KKMA 2PS8A 4LTVA 3ACXA 5B01A 3WCDA 1YJ4A 3LGZB 4HD1A 4N1ZF 2J1OA 4KVYA 5B0MA 3VJEA 4JZBA 4JVJF 5H9DA 2E92A 2F92F 2QISA 2Z4VA 3OABA 4JXNA 3LMDA 4FJQA 1DI1A 3AQCB 2ONGA 2PS6A 3SDQA 3LVSA 4LFGA 1V4HA 5IMPA 3EFQA 5HN7A 3PYBA 4P0XA 1N1ZA 4LXWA 1HXGA 1VG4A 4OMHA 4RXDA 5EASA 2Z4WA 4Q23A 3P8LA 3S9VA 3SDRA 1HM7A 3P41A 3ADZA 3OYRA 3KRAB 3M0GA 4P0WA 1HX9A 2AZJA 3WCLA 3CKEA 4F6VA 4JYXA 3WCGA 4H5EF 3WJKA 3IBAA 1YYUA 3MAVA 4LA6A 1YQ7A 5DZ2A 5B03A 4KQUA 2OPMA 3KRPA 3OACA 1YV5A 1FPSA 5B0JA 2Z4XA 3BNXA 3P5RA 2F8ZF 3KRCA 4LOBA 1JFGA 1N24A 4F62A 4DHDA 3ID0A 3OABB 3RBMA 4KFAA 4LZ0A 3N49F 3ASXA 3WCHA 5DJPF 3DYHA 5ILIA 2Z7IA 2E8WA 5IVGA 3M01A 3WCEA 1VG7A 2ZCOA 5IKHA 3WEIA 3DYFA 3N5HF 2OGDA 4LUUA 3CP6A 3KRFA 3NPRA 4DWGA 2F9KF 4MC0A 4LLSA 5AHUB 3VJCA 2Z52A 1VG3A 2ZEVA 4MC8A 3LEEA 3W7FA 3AE0A 3OACB 1V4IA 3UCAA 3WC9A 4JXYA 5IM1A 1N20A 5CG5A 3P5PA 5IN8A 4QPFA 1YHLA 2PS4A 3ICZA 1WL1A 3N3DA 4NFJF 2E4OA 4KVWA 4NG6A 4LLTA 2Z7HA 2F7MF 3V1VA 4E9UA 4LFVF 4GP1A 5B0IA 3N3LF 4NKFA 3VJAA 5A0IA 2E93A 2I19A 5A0JA 1N22A
chains in the Genus database with same CATH topology
4FP4A 5DHKA 1N21A 3WEGA 3G4DA 3KRFB 4KPDA 3EZ3A 5EAUA 3WCAA 1RTRA 1YYSA 5ILZA 3ACWA 3LGKA 1WY0A 1YHKA 1KIZA 3Q30A 5JV0F 3LG5A 3LDWA 3N0GA 3LLWA 4KWDA 1WKZA 5CG6A 2Z4ZA 3SDTA 5ILHA 2EWGA 2RAHA 3MZVA 4PVYF 3WCJA 3N6KF 3QKCA 5ILDA 4DWBA 2OPNA 2ZY1A 4N9UA 3RMGA 4GAXA 4DI5A 2E8TA 1HXCA 2Q80A 3N45F 5AFXA 4GA3A 2AZLA 4KVDA 3WCBA 1N23A 5JV2F 4XQTF 4E1EA 5KSXF 4QXSF 5B0KA 2OA6A 5C05A 3TS7A 2PS5A 4RNQA 3LJIA 5DJRF 5DIQF 4OKMA 3ZMBA 5ILKA 2F8CF 3ZL6A 1JFAA 1UBYA 3WSAA 5I1UA 4NKEA 4JZXA 3NF2A 4RXAA 3TFVA 4P0VA 3Q1OA 3WEJA 4XQRF 4NFIF 4LA5A 3WCCA 2Z78A 3TC1A 1V4KA 3ICNA 1YHMA 3WSBA 3LSNA 5DGMF 4K10A 4LFEA 2O1OA 3EGTA 4NUAA 5E8KA 2E8XA 3VJDA 2E91A 5HN9A 2Z4YA 4KVIA 2J1PA 3KRPB 3QQVA 1HM4A 2DH4A 3SAEA 4OMGA 3KB9A 3KRCB 5IK6A 3VJBA 4LZCA 1KIYA 3P8RA 5ER8A 4DXJA 5IL3A 3Q2QA 1RQJA 4OGUA 5HNAA 1YYQA 3DYGA 4KPJA 2E94A 3ZCDA 5DHIA 3N1VF 2AZKA 3N1WF 3VJ9A 3WE9A 1VG6A 1DGPA 4RXEA 3Q2ZA 3VJ8A 3M02A 3NRIA 2Q9ZA 2ZCRA 5HN8A 5DJVF 1VG2A 3RYWA 3N5JF 3WEHA 1V4EA 2H8OA 4F6XA 4LPHF 1HXAA 3M9UA 1WL2A 3AQ0A 3V66A 3NPKA 4RXCA 4KUXA 4LPGF 3WJOA 2J5CA 5ILJA 4H5DF 4GP2A 5E8LA 1WL3A 3KROA 5B02A 4MC3A 5DGSF 5ILYA 4XQSF 1WL0A 5ERNA 1ZW5A 4LZ3A 5JV1F 3AQBB 3ICKA 3ZMCA 5AYPA 3ACYA 3M00A 3KBKA 5IK9A 3CC9A 3LZ9A 1YYRA 3WCMA 5AELA 3TFNA 1UBVA 1V4JA 4KQ5A 1EZFA 5B00A 2FORA 4NFKF 3B7LA 3S4JA 5IMIA 4KK2A 2Z50A 2ONHA 2E95A 4RYPA 2AETA 4WK5A 4KQSA 5IMNA 5JA0F 3SDUA 4L2XF 3BNYA 3ZOUA 4UMJA 2E90A 2VF6A 3KROB 2AELA 5JUZF 3WCIA 5EROA 5IL8A 4EA2A 5IKAA 5DW7A 4LTZA 3N0FA 3LK5A 5B0LA 5E8HA 1YYTA 3V1XA 5A0KA 2ZCSA 2Q9YA 4DZWA 5DGNF 2F94F 1RQIA 4LIXA 1UBXA 4H5CF 2P1CA 3WJNA 2PS7A 3ICMA 1N1BA 2AEKA 2F89F 3N46F 2E8UA 4E9ZA 1UBWA 2ZCQA 3WCFA 4PVXF 3WEKA 4ZQ8A 3LOMA 2FTZA 3PYAA 4OKZA 3RYEA 3SDVA 3PH7A 1WMWA 3PDEA 3TFPA 2Q58A 5IK0A 4DEMF 2ZEUA 5ERMA 3G4FA 3APZA 3IPIA 3WEFA 4EA1A 1PS1A 3KRAA 2E8VA 5EATA 4EA0A 3PKOA 4KKMA 2PS8A 4LTVA 3ACXA 5B01A 3WCDA 1YJ4A 3LGZB 4HD1A 4N1ZF 2J1OA 4KVYA 5B0MA 3VJEA 4JZBA 4JVJF 5H9DA 2E92A 2F92F 2QISA 2Z4VA 3OABA 4JXNA 3LMDA 4FJQA 1DI1A 3AQCB 2ONGA 2PS6A 3SDQA 3LVSA 4LFGA 1V4HA 5IMPA 3EFQA 5HN7A 3PYBA 4P0XA 1N1ZA 4LXWA 1HXGA 1VG4A 4OMHA 4RXDA 5EASA 2Z4WA 4Q23A 3P8LA 3S9VA 3SDRA 1HM7A 3P41A 3ADZA 3OYRA 3KRAB 3M0GA 4P0WA 1HX9A 2AZJA 3WCLA 3CKEA 4F6VA 4JYXA 3WCGA 4H5EF 3WJKA 3IBAA 1YYUA 3MAVA 4LA6A 1YQ7A 5DZ2A 5B03A 4KQUA 2OPMA 3KRPA 3OACA 1YV5A 1FPSA 5B0JA 2Z4XA 3BNXA 3P5RA 2F8ZF 3KRCA 4LOBA 1JFGA 1N24A 4F62A 4DHDA 3ID0A 3OABB 3RBMA 4KFAA 4LZ0A 3N49F 3ASXA 3WCHA 5DJPF 3DYHA 5ILIA 2Z7IA 2E8WA 5IVGA 3M01A 3WCEA 1VG7A 2ZCOA 5IKHA 3WEIA 3DYFA 3N5HF 2OGDA 4LUUA 3CP6A 3KRFA 3NPRA 4DWGA 2F9KF 4MC0A 4LLSA 5AHUB 3VJCA 2Z52A 1VG3A 2ZEVA 4MC8A 3LEEA 3W7FA 3AE0A 3OACB 1V4IA 3UCAA 3WC9A 4JXYA 5IM1A 1N20A 5CG5A 3P5PA 5IN8A 4QPFA 1YHLA 2PS4A 3ICZA 1WL1A 3N3DA 4NFJF 2E4OA 4KVWA 4NG6A 4LLTA 2Z7HA 2F7MF 3V1VA 4E9UA 4LFVF 4GP1A 5B0IA 3N3LF 4NKFA 3VJAA 5A0IA 2E93A 2I19A 5A0JA 1N22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FP4 A;  5DHK A;  1N21 A;  3WEG A;  3G4D A;  3KRF B;  4KPD A;  3EZ3 A;  5EAU A;  3WCA A;  1RTR A;  1YYS A;  5ILZ A;  3ACW A;  3LGK A;  1WY0 A;  1YHK A;  1KIZ A;  3Q30 A;  5JV0 F;  3LG5 A;  3LDW A;  3N0G A;  3LLW A;  4KWD A;  1WKZ A;  5CG6 A;  2Z4Z A;  3SDT A;  5ILH A;  2EWG A;  2RAH A;  3MZV A;  4PVY F;  3WCJ A;  3N6K F;  3QKC A;  5ILD A;  4DWB A;  2OPN A;  2ZY1 A;  4N9U A;  3RMG A;  4GAX A;  4DI5 A;  2E8T A;  1HXC A;  2Q80 A;  3N45 F;  5AFX A;  4GA3 A;  2AZL A;  4KVD A;  3WCB A;  1N23 A;  5JV2 F;  4XQT F;  4E1E A;  5KSX F;  4QXS F;  5B0K A;  2OA6 A;  5C05 A;  3TS7 A;  2PS5 A;  4RNQ A;  3LJI A;  5DJR F;  5DIQ F;  4OKM A;  3ZMB A;  5ILK A;  2F8C F;  3ZL6 A;  1JFA A;  1UBY A;  3WSA A;  5I1U A;  4NKE A;  4JZX A;  3NF2 A;  4RXA A;  3TFV A;  4P0V A;  3Q1O A;  3WEJ A;  4XQR F;  4NFI F;  4LA5 A;  3WCC A;  2Z78 A;  3TC1 A;  1V4K A;  3ICN A;  1YHM A;  3WSB A;  3LSN A;  5DGM F;  4K10 A;  4LFE A;  2O1O A;  3EGT A;  4NUA A;  5E8K A;  2E8X A;  3VJD A;  2E91 A;  5HN9 A;  2Z4Y A;  4KVI A;  2J1P A;  3KRP B;  3QQV A;  1HM4 A;  2DH4 A;  3SAE A;  4OMG A;  3KB9 A;  3KRC B;  5IK6 A;  3VJB A;  4LZC A;  1KIY A;  3P8R A;  5ER8 A;  4DXJ A;  5IL3 A;  3Q2Q A;  1RQJ A;  4OGU A;  5HNA A;  1YYQ A;  3DYG A;  4KPJ A;  2E94 A;  3ZCD A;  5DHI A;  3N1V F;  2AZK A;  3N1W F;  3VJ9 A;  3WE9 A;  1VG6 A;  1DGP A;  4RXE A;  3Q2Z A;  3VJ8 A;  3M02 A;  3NRI A;  2Q9Z A;  2ZCR A;  5HN8 A;  5DJV F;  1VG2 A;  3RYW A;  3N5J F;  3WEH A;  1V4E A;  2H8O A;  4F6X A;  4LPH F;  1HXA A;  3M9U A;  1WL2 A;  3AQ0 A;  3V66 A;  3NPK A;  4RXC A;  4KUX A;  4LPG F;  3WJO A;  2J5C A;  5ILJ A;  4H5D F;  4GP2 A;  5E8L A;  1WL3 A;  3KRO A;  5B02 A;  4MC3 A;  5DGS F;  5ILY A;  4XQS F;  1WL0 A;  5ERN A;  1ZW5 A;  4LZ3 A;  5JV1 F;  3AQB B;  3ICK A;  3ZMC A;  5AYP A;  3ACY A;  3M00 A;  3KBK A;  5IK9 A;  3CC9 A;  3LZ9 A;  1YYR A;  3WCM A;  5AEL A;  3TFN A;  1UBV A;  1V4J A;  4KQ5 A;  1EZF A;  5B00 A;  2FOR A;  4NFK F;  3B7L A;  3S4J A;  5IMI A;  4KK2 A;  2Z50 A;  2ONH A;  2E95 A;  4RYP A;  2AET A;  4WK5 A;  4KQS A;  5IMN A;  5JA0 F;  3SDU A;  4L2X F;  3BNY A;  3ZOU A;  4UMJ A;  2E90 A;  2VF6 A;  3KRO B;  2AEL A;  5JUZ F;  3WCI A;  5ERO A;  5IL8 A;  4EA2 A;  5IKA A;  5DW7 A;  4LTZ A;  3N0F A;  3LK5 A;  5B0L A;  5E8H A;  1YYT A;  3V1X A;  5A0K A;  2ZCS A;  2Q9Y A;  4DZW A;  5DGN F;  2F94 F;  1RQI A;  4LIX A;  1UBX A;  4H5C F;  2P1C A;  3WJN A;  2PS7 A;  3ICM A;  1N1B A;  2AEK A;  2F89 F;  3N46 F;  2E8U A;  4E9Z A;  1UBW A;  2ZCQ A;  3WCF A;  4PVX F;  3WEK A;  4ZQ8 A;  3LOM A;  2FTZ A;  3PYA A;  4OKZ A;  3RYE A;  3SDV A;  3PH7 A;  1WMW A;  3PDE A;  3TFP A;  2Q58 A;  5IK0 A;  4DEM F;  2ZEU A;  5ERM A;  3G4F A;  3APZ A;  3IPI A;  3WEF A;  4EA1 A;  1PS1 A;  3KRA A;  2E8V A;  5EAT A;  4EA0 A;  3PKO A;  4KKM A;  2PS8 A;  4LTV A;  3ACX A;  5B01 A;  3WCD A;  1YJ4 A;  3LGZ B;  4HD1 A;  4N1Z F;  2J1O A;  4KVY A;  5B0M A;  3VJE A;  4JZB A;  4JVJ F;  5H9D A;  2E92 A;  2F92 F;  2QIS A;  2Z4V A;  3OAB A;  4JXN A;  3LMD A;  4FJQ A;  1DI1 A;  3AQC B;  2ONG A;  2PS6 A;  3SDQ A;  3LVS A;  4LFG A;  1V4H A;  5IMP A;  3EFQ A;  5HN7 A;  3PYB A;  4P0X A;  1N1Z A;  4LXW A;  1HXG A;  1VG4 A;  4OMH A;  4RXD A;  5EAS A;  2Z4W A;  4Q23 A;  3P8L A;  3S9V A;  3SDR A;  1HM7 A;  3P41 A;  3ADZ A;  3OYR A;  3KRA B;  3M0G A;  4P0W A;  1HX9 A;  2AZJ A;  3WCL A;  3CKE A;  4F6V A;  4JYX A;  3WCG A;  4H5E F;  3WJK A;  3IBA A;  1YYU A;  3MAV A;  4LA6 A;  1YQ7 A;  5DZ2 A;  5B03 A;  4KQU A;  2OPM A;  3KRP A;  3OAC A;  1YV5 A;  1FPS A;  5B0J A;  2Z4X A;  3BNX A;  3P5R A;  2F8Z F;  3KRC A;  4LOB A;  1JFG A;  1N24 A;  4F62 A;  4DHD A;  3ID0 A;  3OAB B;  3RBM A;  4KFA A;  4LZ0 A;  3N49 F;  3ASX A;  3WCH A;  5DJP F;  3DYH A;  5ILI A;  2Z7I A;  2E8W A;  5IVG A;  3M01 A;  3WCE A;  1VG7 A;  2ZCO A;  5IKH A;  3WEI A;  3DYF A;  3N5H F;  2OGD A;  4LUU A;  3CP6 A;  3KRF A;  3NPR A;  4DWG A;  2F9K F;  4MC0 A;  4LLS A;  5AHU B;  3VJC A;  2Z52 A;  1VG3 A;  2ZEV A;  4MC8 A;  3LEE A;  3W7F A;  3AE0 A;  3OAC B;  1V4I A;  3UCA A;  3WC9 A;  4JXY A;  5IM1 A;  1N20 A;  5CG5 A;  3P5P A;  5IN8 A;  4QPF A;  1YHL A;  2PS4 A;  3ICZ A;  1WL1 A;  3N3D A;  4NFJ F;  2E4O A;  4KVW A;  4NG6 A;  4LLT A;  2Z7H A;  2F7M F;  3V1V A;  4E9U A;  4LFV F;  4GP1 A;  5B0I A;  3N3L F;  4NKF A;  3VJA A;  5A0I A;  2E93 A;  2I19 A;  5A0J A;  1N22 A; 
#chains in the Genus database with same CATH topology
 4FP4 A;  5DHK A;  1N21 A;  3WEG A;  3G4D A;  3KRF B;  4KPD A;  3EZ3 A;  5EAU A;  3WCA A;  1RTR A;  1YYS A;  5ILZ A;  3ACW A;  3LGK A;  1WY0 A;  1YHK A;  1KIZ A;  3Q30 A;  5JV0 F;  3LG5 A;  3LDW A;  3N0G A;  3LLW A;  4KWD A;  1WKZ A;  5CG6 A;  2Z4Z A;  3SDT A;  5ILH A;  2EWG A;  2RAH A;  3MZV A;  4PVY F;  3WCJ A;  3N6K F;  3QKC A;  5ILD A;  4DWB A;  2OPN A;  2ZY1 A;  4N9U A;  3RMG A;  4GAX A;  4DI5 A;  2E8T A;  1HXC A;  2Q80 A;  3N45 F;  5AFX A;  4GA3 A;  2AZL A;  4KVD A;  3WCB A;  1N23 A;  5JV2 F;  4XQT F;  4E1E A;  5KSX F;  4QXS F;  5B0K A;  2OA6 A;  5C05 A;  3TS7 A;  2PS5 A;  4RNQ A;  3LJI A;  5DJR F;  5DIQ F;  4OKM A;  3ZMB A;  5ILK A;  2F8C F;  3ZL6 A;  1JFA A;  1UBY A;  3WSA A;  5I1U A;  4NKE A;  4JZX A;  3NF2 A;  4RXA A;  3TFV A;  4P0V A;  3Q1O A;  3WEJ A;  4XQR F;  4NFI F;  4LA5 A;  3WCC A;  2Z78 A;  3TC1 A;  1V4K A;  3ICN A;  1YHM A;  3WSB A;  3LSN A;  5DGM F;  4K10 A;  4LFE A;  2O1O A;  3EGT A;  4NUA A;  5E8K A;  2E8X A;  3VJD A;  2E91 A;  5HN9 A;  2Z4Y A;  4KVI A;  2J1P A;  3KRP B;  3QQV A;  1HM4 A;  2DH4 A;  3SAE A;  4OMG A;  3KB9 A;  3KRC B;  5IK6 A;  3VJB A;  4LZC A;  1KIY A;  3P8R A;  5ER8 A;  4DXJ A;  5IL3 A;  3Q2Q A;  1RQJ A;  4OGU A;  5HNA A;  1YYQ A;  3DYG A;  4KPJ A;  2E94 A;  3ZCD A;  5DHI A;  3N1V F;  2AZK A;  3N1W F;  3VJ9 A;  3WE9 A;  1VG6 A;  1DGP A;  4RXE A;  3Q2Z A;  3VJ8 A;  3M02 A;  3NRI A;  2Q9Z A;  2ZCR A;  5HN8 A;  5DJV F;  1VG2 A;  3RYW A;  3N5J F;  3WEH A;  1V4E A;  2H8O A;  4F6X A;  4LPH F;  1HXA A;  3M9U A;  1WL2 A;  3AQ0 A;  3V66 A;  3NPK A;  4RXC A;  4KUX A;  4LPG F;  3WJO A;  2J5C A;  5ILJ A;  4H5D F;  4GP2 A;  5E8L A;  1WL3 A;  3KRO A;  5B02 A;  4MC3 A;  5DGS F;  5ILY A;  4XQS F;  1WL0 A;  5ERN A;  1ZW5 A;  4LZ3 A;  5JV1 F;  3AQB B;  3ICK A;  3ZMC A;  5AYP A;  3ACY A;  3M00 A;  3KBK A;  5IK9 A;  3CC9 A;  3LZ9 A;  1YYR A;  3WCM A;  5AEL A;  3TFN A;  1UBV A;  1V4J A;  4KQ5 A;  1EZF A;  5B00 A;  2FOR A;  4NFK F;  3B7L A;  3S4J A;  5IMI A;  4KK2 A;  2Z50 A;  2ONH A;  2E95 A;  4RYP A;  2AET A;  4WK5 A;  4KQS A;  5IMN A;  5JA0 F;  3SDU A;  4L2X F;  3BNY A;  3ZOU A;  4UMJ A;  2E90 A;  2VF6 A;  3KRO B;  2AEL A;  5JUZ F;  3WCI A;  5ERO A;  5IL8 A;  4EA2 A;  5IKA A;  5DW7 A;  4LTZ A;  3N0F A;  3LK5 A;  5B0L A;  5E8H A;  1YYT A;  3V1X A;  5A0K A;  2ZCS A;  2Q9Y A;  4DZW A;  5DGN F;  2F94 F;  1RQI A;  4LIX A;  1UBX A;  4H5C F;  2P1C A;  3WJN A;  2PS7 A;  3ICM A;  1N1B A;  2AEK A;  2F89 F;  3N46 F;  2E8U A;  4E9Z A;  1UBW A;  2ZCQ A;  3WCF A;  4PVX F;  3WEK A;  4ZQ8 A;  3LOM A;  2FTZ A;  3PYA A;  4OKZ A;  3RYE A;  3SDV A;  3PH7 A;  1WMW A;  3PDE A;  3TFP A;  2Q58 A;  5IK0 A;  4DEM F;  2ZEU A;  5ERM A;  3G4F A;  3APZ A;  3IPI A;  3WEF A;  4EA1 A;  1PS1 A;  3KRA A;  2E8V A;  5EAT A;  4EA0 A;  3PKO A;  4KKM A;  2PS8 A;  4LTV A;  3ACX A;  5B01 A;  3WCD A;  1YJ4 A;  3LGZ B;  4HD1 A;  4N1Z F;  2J1O A;  4KVY A;  5B0M A;  3VJE A;  4JZB A;  4JVJ F;  5H9D A;  2E92 A;  2F92 F;  2QIS A;  2Z4V A;  3OAB A;  4JXN A;  3LMD A;  4FJQ A;  1DI1 A;  3AQC B;  2ONG A;  2PS6 A;  3SDQ A;  3LVS A;  4LFG A;  1V4H A;  5IMP A;  3EFQ A;  5HN7 A;  3PYB A;  4P0X A;  1N1Z A;  4LXW A;  1HXG A;  1VG4 A;  4OMH A;  4RXD A;  5EAS A;  2Z4W A;  4Q23 A;  3P8L A;  3S9V A;  3SDR A;  1HM7 A;  3P41 A;  3ADZ A;  3OYR A;  3KRA B;  3M0G A;  4P0W A;  1HX9 A;  2AZJ A;  3WCL A;  3CKE A;  4F6V A;  4JYX A;  3WCG A;  4H5E F;  3WJK A;  3IBA A;  1YYU A;  3MAV A;  4LA6 A;  1YQ7 A;  5DZ2 A;  5B03 A;  4KQU A;  2OPM A;  3KRP A;  3OAC A;  1YV5 A;  1FPS A;  5B0J A;  2Z4X A;  3BNX A;  3P5R A;  2F8Z F;  3KRC A;  4LOB A;  1JFG A;  1N24 A;  4F62 A;  4DHD A;  3ID0 A;  3OAB B;  3RBM A;  4KFA A;  4LZ0 A;  3N49 F;  3ASX A;  3WCH A;  5DJP F;  3DYH A;  5ILI A;  2Z7I A;  2E8W A;  5IVG A;  3M01 A;  3WCE A;  1VG7 A;  2ZCO A;  5IKH A;  3WEI A;  3DYF A;  3N5H F;  2OGD A;  4LUU A;  3CP6 A;  3KRF A;  3NPR A;  4DWG A;  2F9K F;  4MC0 A;  4LLS A;  5AHU B;  3VJC A;  2Z52 A;  1VG3 A;  2ZEV A;  4MC8 A;  3LEE A;  3W7F A;  3AE0 A;  3OAC B;  1V4I A;  3UCA A;  3WC9 A;  4JXY A;  5IM1 A;  1N20 A;  5CG5 A;  3P5P A;  5IN8 A;  4QPF A;  1YHL A;  2PS4 A;  3ICZ A;  1WL1 A;  3N3D A;  4NFJ F;  2E4O A;  4KVW A;  4NG6 A;  4LLT A;  2Z7H A;  2F7M F;  3V1V A;  4E9U A;  4LFV F;  4GP1 A;  5B0I A;  3N3L F;  4NKF A;  3VJA A;  5A0I A;  2E93 A;  2I19 A;  5A0J A;  1N22 A; 
#chains in the Genus database with same CATH homology
 4FP4 A;  5DHK A;  1N21 A;  3WEG A;  3G4D A;  3KRF B;  4KPD A;  3EZ3 A;  5EAU A;  3WCA A;  1RTR A;  1YYS A;  5ILZ A;  3ACW A;  3LGK A;  1WY0 A;  1YHK A;  1KIZ A;  3Q30 A;  5JV0 F;  3LG5 A;  3LDW A;  3N0G A;  3LLW A;  4KWD A;  1WKZ A;  5CG6 A;  2Z4Z A;  3SDT A;  5ILH A;  2EWG A;  2RAH A;  3MZV A;  4PVY F;  3WCJ A;  3N6K F;  3QKC A;  5ILD A;  4DWB A;  2OPN A;  2ZY1 A;  4N9U A;  3RMG A;  4GAX A;  4DI5 A;  2E8T A;  1HXC A;  2Q80 A;  3N45 F;  5AFX A;  4GA3 A;  2AZL A;  4KVD A;  3WCB A;  1N23 A;  5JV2 F;  4XQT F;  4E1E A;  5KSX F;  4QXS F;  5B0K A;  2OA6 A;  5C05 A;  3TS7 A;  2PS5 A;  4RNQ A;  3LJI A;  5DJR F;  5DIQ F;  4OKM A;  3ZMB A;  5ILK A;  2F8C F;  3ZL6 A;  1JFA A;  1UBY A;  3WSA A;  5I1U A;  4NKE A;  4JZX A;  3NF2 A;  4RXA A;  3TFV A;  4P0V A;  3Q1O A;  3WEJ A;  4XQR F;  4NFI F;  4LA5 A;  3WCC A;  2Z78 A;  3TC1 A;  1V4K A;  3ICN A;  1YHM A;  3WSB A;  3LSN A;  5DGM F;  4K10 A;  4LFE A;  2O1O A;  3EGT A;  4NUA A;  5E8K A;  2E8X A;  3VJD A;  2E91 A;  5HN9 A;  2Z4Y A;  4KVI A;  2J1P A;  3KRP B;  3QQV A;  1HM4 A;  2DH4 A;  3SAE A;  4OMG A;  3KB9 A;  3KRC B;  5IK6 A;  3VJB A;  4LZC A;  1KIY A;  3P8R A;  5ER8 A;  4DXJ A;  5IL3 A;  3Q2Q A;  1RQJ A;  4OGU A;  5HNA A;  1YYQ A;  3DYG A;  4KPJ A;  2E94 A;  3ZCD A;  5DHI A;  3N1V F;  2AZK A;  3N1W F;  3VJ9 A;  3WE9 A;  1VG6 A;  1DGP A;  4RXE A;  3Q2Z A;  3VJ8 A;  3M02 A;  3NRI A;  2Q9Z A;  2ZCR A;  5HN8 A;  5DJV F;  1VG2 A;  3RYW A;  3N5J F;  3WEH A;  1V4E A;  2H8O A;  4F6X A;  4LPH F;  1HXA A;  3M9U A;  1WL2 A;  3AQ0 A;  3V66 A;  3NPK A;  4RXC A;  4KUX A;  4LPG F;  3WJO A;  2J5C A;  5ILJ A;  4H5D F;  4GP2 A;  5E8L A;  1WL3 A;  3KRO A;  5B02 A;  4MC3 A;  5DGS F;  5ILY A;  4XQS F;  1WL0 A;  5ERN A;  1ZW5 A;  4LZ3 A;  5JV1 F;  3AQB B;  3ICK A;  3ZMC A;  5AYP A;  3ACY A;  3M00 A;  3KBK A;  5IK9 A;  3CC9 A;  3LZ9 A;  1YYR A;  3WCM A;  5AEL A;  3TFN A;  1UBV A;  1V4J A;  4KQ5 A;  1EZF A;  5B00 A;  2FOR A;  4NFK F;  3B7L A;  3S4J A;  5IMI A;  4KK2 A;  2Z50 A;  2ONH A;  2E95 A;  4RYP A;  2AET A;  4WK5 A;  4KQS A;  5IMN A;  5JA0 F;  3SDU A;  4L2X F;  3BNY A;  3ZOU A;  4UMJ A;  2E90 A;  2VF6 A;  3KRO B;  2AEL A;  5JUZ F;  3WCI A;  5ERO A;  5IL8 A;  4EA2 A;  5IKA A;  5DW7 A;  4LTZ A;  3N0F A;  3LK5 A;  5B0L A;  5E8H A;  1YYT A;  3V1X A;  5A0K A;  2ZCS A;  2Q9Y A;  4DZW A;  5DGN F;  2F94 F;  1RQI A;  4LIX A;  1UBX A;  4H5C F;  2P1C A;  3WJN A;  2PS7 A;  3ICM A;  1N1B A;  2AEK A;  2F89 F;  3N46 F;  2E8U A;  4E9Z A;  1UBW A;  2ZCQ A;  3WCF A;  4PVX F;  3WEK A;  4ZQ8 A;  3LOM A;  2FTZ A;  3PYA A;  4OKZ A;  3RYE A;  3SDV A;  3PH7 A;  1WMW A;  3PDE A;  3TFP A;  2Q58 A;  5IK0 A;  4DEM F;  2ZEU A;  5ERM A;  3G4F A;  3APZ A;  3IPI A;  3WEF A;  4EA1 A;  1PS1 A;  3KRA A;  2E8V A;  5EAT A;  4EA0 A;  3PKO A;  4KKM A;  2PS8 A;  4LTV A;  3ACX A;  5B01 A;  3WCD A;  1YJ4 A;  3LGZ B;  4HD1 A;  4N1Z F;  2J1O A;  4KVY A;  5B0M A;  3VJE A;  4JZB A;  4JVJ F;  5H9D A;  2E92 A;  2F92 F;  2QIS A;  2Z4V A;  3OAB A;  4JXN A;  3LMD A;  4FJQ A;  1DI1 A;  3AQC B;  2ONG A;  2PS6 A;  3SDQ A;  3LVS A;  4LFG A;  1V4H A;  5IMP A;  3EFQ A;  5HN7 A;  3PYB A;  4P0X A;  1N1Z A;  4LXW A;  1HXG A;  1VG4 A;  4OMH A;  4RXD A;  5EAS A;  2Z4W A;  4Q23 A;  3P8L A;  3S9V A;  3SDR A;  1HM7 A;  3P41 A;  3ADZ A;  3OYR A;  3KRA B;  3M0G A;  4P0W A;  1HX9 A;  2AZJ A;  3WCL A;  3CKE A;  4F6V A;  4JYX A;  3WCG A;  4H5E F;  3WJK A;  3IBA A;  1YYU A;  3MAV A;  4LA6 A;  1YQ7 A;  5DZ2 A;  5B03 A;  4KQU A;  2OPM A;  3KRP A;  3OAC A;  1YV5 A;  1FPS A;  5B0J A;  2Z4X A;  3BNX A;  3P5R A;  2F8Z F;  3KRC A;  4LOB A;  1JFG A;  1N24 A;  4F62 A;  4DHD A;  3ID0 A;  3OAB B;  3RBM A;  4KFA A;  4LZ0 A;  3N49 F;  3ASX A;  3WCH A;  5DJP F;  3DYH A;  5ILI A;  2Z7I A;  2E8W A;  5IVG A;  3M01 A;  3WCE A;  1VG7 A;  2ZCO A;  5IKH A;  3WEI A;  3DYF A;  3N5H F;  2OGD A;  4LUU A;  3CP6 A;  3KRF A;  3NPR A;  4DWG A;  2F9K F;  4MC0 A;  4LLS A;  5AHU B;  3VJC A;  2Z52 A;  1VG3 A;  2ZEV A;  4MC8 A;  3LEE A;  3W7F A;  3AE0 A;  3OAC B;  1V4I A;  3UCA A;  3WC9 A;  4JXY A;  5IM1 A;  1N20 A;  5CG5 A;  3P5P A;  5IN8 A;  4QPF A;  1YHL A;  2PS4 A;  3ICZ A;  1WL1 A;  3N3D A;  4NFJ F;  2E4O A;  4KVW A;  4NG6 A;  4LLT A;  2Z7H A;  2F7M F;  3V1V A;  4E9U A;  4LFV F;  4GP1 A;  5B0I A;  3N3L F;  4NKF A;  3VJA A;  5A0I A;  2E93 A;  2I19 A;  5A0J A;  1N22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...