2OA6A

Aristolochene synthase from aspergillus terreus complexed with pyrophosphate
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
305
structure length
295
Chain Sequence
SLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTLCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aristolochene synthase
publication title X-ray crystal structure of aristolochene synthase from Aspergillus terreus and evolution of templates for the cyclization of farnesyl diphosphate.
pubmed doi rcsb
source organism Aspergillus terreus
molecule tags Lyase
total genus 123
structure length 295
sequence length 305
chains with identical sequence B, C, D
ec nomenclature ec 4.2.3.9: Aristolochene synthase.
pdb deposition date 2006-12-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2oa6A00
3WCDA 3WJOA 3P8LA 2J1PA 4F6XA 2E8VA 4H5CF 5B03A 4LFGA 5IMPA 3ICMA 5ILZA 1YYSA 4DZWA 4LUUA 4DWGA 2ONGA 4DHDA 5HNAA 3NPRA 4OKMA 3B7LA 5AELA 4L2XF 3P5RA 3M0GA 3P41A 3WEGA 5IN8A 4HD1A 3WCJA 5B00A 1ZW5A 5DJVF 4XQTF 4NFIF 4RXCA 2E95A 2E90A 2Z7HA 5AHUB 1RQJA 3LJIA 3WJNA 2PS5A 2OPMA 5JV1F 4P0XA 3LLWA 4OMHA 3AE0A 4KK2A 2EWGA 1N20A 5JUZF 4F6VA 5B02A 4KQSA 2Q9YA 3PYBA 3M01A 4GA3A 1RQIA 3WCIA 1EZFA 1VG7A 2O1OA 5HN8A 5IL8A 3TFPA 5IK0A 2E94A 4NUAA 1V4KA 3N49F 1VG2A 1YYUA 2P1CA 1HXAA 2DH4A 3P8RA 3SDRA 5A0KA 4DI5A 3KBKA 1UBYA 3LGZB 3ZL6A 2F8ZF 4NG6A 2ZCOA 5ILYA 3CKEA 4NKFA 3EZ3A 1VG4A 5IL3A 3Q2ZA 4EA0A 4EA2A 3WCFA 4ZQ8A 2Z7IA 3G4DA 1HXGA 5IK6A 5DHKA 3NPKA 5AFXA 3CP6A 5C05A 3V1XA 5E8HA 4LTVA 5I1UA 4H5DF 1WL3A 4KPJA 5A0IA 5IMNA 4KUXA 3RBMA 4JVJF 3SDTA 2E8UA 2Z4YA 3VJCA 3WCMA 3ID0A 3WEFA 4MC8A 5JA0F 5B0MA 3N46F 1YHMA 4KVIA 3WSAA 2Q58A 5HN9A 5KSXF 2ONHA 5EASA 3ICKA 3LEEA 1WY0A 4RXDA 3KROA 3N3LF 4RXEA 3PYAA 4DXJA 3ASXA 3CC9A 3WJKA 5JV0F 3EFQA 4LLTA 4GP2A 3WEJA 2Z50A 2ZY1A 4QPFA 2Q80A 2E91A 1N1BA 3WCCA 1YYQA 4GAXA 2E8XA 4KQ5A 5H9DA 2RAHA 3ICZA 4KVWA 3NRIA 3AQ0A 4LFVF 5ER8A 3OABA 3V1VA 1YHLA 2E92A 4FP4A 3OABB 1HM7A 4FJQA 5IMIA 3S9VA 1YHKA 4E9UA 3WCGA 2F94F 3RYEA 3ZCDA 3VJEA 3ZMBA 3KRFA 4K10A 3WE9A 3KRFB 1DGPA 1HM4A 1V4EA 4LLSA 3WSBA 3IPIA 3WCHA 3MAVA 4KWDA 2FTZA 3PKOA 5EROA 5CG5A 2VF6A 2OPNA 2Z52A 4RYPA 4NFKF 4NKEA 1JFAA 3RMGA 4DEMF 5B01A 1WMWA 3LVSA 3WEKA 3PDEA 3WC9A 2Z4ZA 4RXAA 4JZXA 4LA6A 1YQ7A 4LZCA 4JXYA 3WCLA 5ILJA 2ZCRA 2F8CF 3LMDA 2QISA 2H8OA 3MZVA 4N9UA 2ZEUA 3DYHA 5DW7A 3V66A 5ILIA 3OYRA 2E8WA 5IM1A 5ERMA 2Z4WA 1KIZA 3AQBB 3W7FA 1VG6A 4OGUA 5CG6A 5JV2F 1FPSA 3ACYA 2AEKA 5IKHA 4N1ZF 2F92F 4OKZA 2Z4XA 1V4HA 5DJRF 4LXWA 3KRPA 4QXSF 3KRPB 1YV5A 3N6KF 1YJ4A 3N1VF 3WCAA 2E8TA 5DJPF 5EATA 4KQUA 3QQVA 4DWBA 3WEHA 3LK5A 3EGTA 2Z78A 5IVGA 4P0VA 3TFVA 5E8KA 2ZEVA 3N0FA 3TFNA 3OACA 3VJ9A 3OACB 2F7MF 2E93A 5E8LA 3LSNA 3VJAA 4LZ0A 4KVYA 3PH7A 3LG5A 3N5HF 4JZBA 5EAUA 3NF2A 5DHIA 5IKAA 2OA6A 4KKMA 2PS8A 2I19A 3Q1OA 1N22A 3ZOUA 1VG3A 1WL2A 5DGSF 4KPDA 5DGMF 2J1OA 3UCAA 2AZLA 5DZ2A 1WL1A 1V4JA 2PS7A 2AETA 3WCBA 3ACWA 3SDUA 3DYFA 3SDVA 5B0LA 1DI1A 1UBVA 5AYPA 2PS4A 4KFAA 3IBAA 4KVDA 4WK5A 1UBWA 4XQRF 4EA1A 3LOMA 3LDWA 3KRCA 3WCEA 3KRCB 2AELA 3ACXA 3N5JF 4PVXF 3RYWA 4H5EF 4Q23A 5HN7A 2E4OA 4E9ZA 4OMGA 3VJBA 1RTRA 2Q9ZA 5B0IA 5ERNA 4MC3A 3BNYA 1YYTA 3Q2QA 4PVYF 1N24A 2FORA 4UMJA 3ICNA 4LPHF 3KB9A 1N21A 1PS1A 2F9KF 2PS6A 4JXNA 3QKCA 4LFEA 5B0KA 3N1WF 4NFJF 4F62A 3SAEA 3N45F 3M00A 4LPGF 5ILKA 5IK9A 3VJ8A 1JFGA 3TC1A 4RNQA 3G4FA 1N23A 3SDQA 3LGKA 3ZMCA 1KIYA 4E1EA 4LZ3A 1UBXA 3S4JA 1YYRA 5A0JA 2J5CA 4MC0A 3KRAA 4GP1A 3KRAB 2ZCSA 3VJDA 5ILDA 4LTZA 2ZCQA 1HXCA 3BNXA 4LIXA 5DGNF 2Z4VA 4XQSF 3M9UA 4LA5A 2F89F 3APZA 3M02A 1WKZA 3WEIA 4P0WA 3P5PA 3DYGA 4LOBA 2AZKA 3ADZA 3AQCB 1V4IA 3N0GA 3Q30A 1HX9A 1N1ZA 3KROB 5ILHA 3LZ9A 5B0JA 2AZJA 3TS7A 5DIQF 4JYXA 3N3DA 1WL0A 2OGDA
chains in the Genus database with same CATH superfamily
3WCDA 3WJOA 3P8LA 2J1PA 4F6XA 2E8VA 4H5CF 5B03A 4LFGA 5IMPA 3ICMA 5ILZA 1YYSA 4DZWA 4LUUA 4DWGA 2ONGA 4DHDA 5HNAA 3NPRA 4OKMA 3B7LA 5AELA 4L2XF 3P5RA 3M0GA 3P41A 3WEGA 5IN8A 4HD1A 3WCJA 5B00A 1ZW5A 5DJVF 4XQTF 4NFIF 4RXCA 2E95A 2E90A 2Z7HA 5AHUB 1RQJA 3LJIA 3WJNA 2PS5A 2OPMA 5JV1F 4P0XA 3LLWA 4OMHA 3AE0A 4KK2A 2EWGA 1N20A 5JUZF 4F6VA 5B02A 4KQSA 2Q9YA 3PYBA 3M01A 4GA3A 1RQIA 3WCIA 1EZFA 1VG7A 2O1OA 5HN8A 5IL8A 3TFPA 5IK0A 2E94A 4NUAA 1V4KA 3N49F 1VG2A 1YYUA 2P1CA 1HXAA 2DH4A 3P8RA 3SDRA 5A0KA 4DI5A 3KBKA 1UBYA 3LGZB 3ZL6A 2F8ZF 4NG6A 2ZCOA 5ILYA 3CKEA 4NKFA 3EZ3A 1VG4A 5IL3A 3Q2ZA 4EA0A 4EA2A 3WCFA 4ZQ8A 2Z7IA 3G4DA 1HXGA 5IK6A 5DHKA 3NPKA 5AFXA 3CP6A 5C05A 3V1XA 5E8HA 4LTVA 5I1UA 4H5DF 1WL3A 4KPJA 5A0IA 5IMNA 4KUXA 3RBMA 4JVJF 3SDTA 2E8UA 2Z4YA 3VJCA 3WCMA 3ID0A 3WEFA 4MC8A 5JA0F 5B0MA 3N46F 1YHMA 4KVIA 3WSAA 2Q58A 5HN9A 5KSXF 2ONHA 5EASA 3ICKA 3LEEA 1WY0A 4RXDA 3KROA 3N3LF 4RXEA 3PYAA 4DXJA 3ASXA 3CC9A 3WJKA 5JV0F 3EFQA 4LLTA 4GP2A 3WEJA 2Z50A 2ZY1A 4QPFA 2Q80A 2E91A 1N1BA 3WCCA 1YYQA 4GAXA 2E8XA 4KQ5A 5H9DA 2RAHA 3ICZA 4KVWA 3NRIA 3AQ0A 4LFVF 5ER8A 3OABA 3V1VA 1YHLA 2E92A 4FP4A 3OABB 1HM7A 4FJQA 5IMIA 3S9VA 1YHKA 4E9UA 3WCGA 2F94F 3RYEA 3ZCDA 3VJEA 3ZMBA 3KRFA 4K10A 3WE9A 3KRFB 1DGPA 1HM4A 1V4EA 4LLSA 3WSBA 3IPIA 3WCHA 3MAVA 4KWDA 2FTZA 3PKOA 5EROA 5CG5A 2VF6A 2OPNA 2Z52A 4RYPA 4NFKF 4NKEA 1JFAA 3RMGA 4DEMF 5B01A 1WMWA 3LVSA 3WEKA 3PDEA 3WC9A 2Z4ZA 4RXAA 4JZXA 4LA6A 1YQ7A 4LZCA 4JXYA 3WCLA 5ILJA 2ZCRA 2F8CF 3LMDA 2QISA 2H8OA 3MZVA 4N9UA 2ZEUA 3DYHA 5DW7A 3V66A 5ILIA 3OYRA 2E8WA 5IM1A 5ERMA 2Z4WA 1KIZA 3AQBB 3W7FA 1VG6A 4OGUA 5CG6A 5JV2F 1FPSA 3ACYA 2AEKA 5IKHA 4N1ZF 2F92F 4OKZA 2Z4XA 1V4HA 5DJRF 4LXWA 3KRPA 4QXSF 3KRPB 1YV5A 3N6KF 1YJ4A 3N1VF 3WCAA 2E8TA 5DJPF 5EATA 4KQUA 3QQVA 4DWBA 3WEHA 3LK5A 3EGTA 2Z78A 5IVGA 4P0VA 3TFVA 5E8KA 2ZEVA 3N0FA 3TFNA 3OACA 3VJ9A 3OACB 2F7MF 2E93A 5E8LA 3LSNA 3VJAA 4LZ0A 4KVYA 3PH7A 3LG5A 3N5HF 4JZBA 5EAUA 3NF2A 5DHIA 5IKAA 2OA6A 4KKMA 2PS8A 2I19A 3Q1OA 1N22A 3ZOUA 1VG3A 1WL2A 5DGSF 4KPDA 5DGMF 2J1OA 3UCAA 2AZLA 5DZ2A 1WL1A 1V4JA 2PS7A 2AETA 3WCBA 3ACWA 3SDUA 3DYFA 3SDVA 5B0LA 1DI1A 1UBVA 5AYPA 2PS4A 4KFAA 3IBAA 4KVDA 4WK5A 1UBWA 4XQRF 4EA1A 3LOMA 3LDWA 3KRCA 3WCEA 3KRCB 2AELA 3ACXA 3N5JF 4PVXF 3RYWA 4H5EF 4Q23A 5HN7A 2E4OA 4E9ZA 4OMGA 3VJBA 1RTRA 2Q9ZA 5B0IA 5ERNA 4MC3A 3BNYA 1YYTA 3Q2QA 4PVYF 1N24A 2FORA 4UMJA 3ICNA 4LPHF 3KB9A 1N21A 1PS1A 2F9KF 2PS6A 4JXNA 3QKCA 4LFEA 5B0KA 3N1WF 4NFJF 4F62A 3SAEA 3N45F 3M00A 4LPGF 5ILKA 5IK9A 3VJ8A 1JFGA 3TC1A 4RNQA 3G4FA 1N23A 3SDQA 3LGKA 3ZMCA 1KIYA 4E1EA 4LZ3A 1UBXA 3S4JA 1YYRA 5A0JA 2J5CA 4MC0A 3KRAA 4GP1A 3KRAB 2ZCSA 3VJDA 5ILDA 4LTZA 2ZCQA 1HXCA 3BNXA 4LIXA 5DGNF 2Z4VA 4XQSF 3M9UA 4LA5A 2F89F 3APZA 3M02A 1WKZA 3WEIA 4P0WA 3P5PA 3DYGA 4LOBA 2AZKA 3ADZA 3AQCB 1V4IA 3N0GA 3Q30A 1HX9A 1N1ZA 3KROB 5ILHA 3LZ9A 5B0JA 2AZJA 3TS7A 5DIQF 4JYXA 3N3DA 1WL0A 2OGDA
chains in the Genus database with same CATH topology
3WCDA 3WJOA 3P8LA 2J1PA 4F6XA 2E8VA 4H5CF 5B03A 4LFGA 5IMPA 3ICMA 5ILZA 1YYSA 4DZWA 4LUUA 4DWGA 2ONGA 4DHDA 5HNAA 3NPRA 4OKMA 3B7LA 5AELA 4L2XF 3P5RA 3M0GA 3P41A 3WEGA 5IN8A 4HD1A 3WCJA 5B00A 1ZW5A 5DJVF 4XQTF 4NFIF 4RXCA 2E95A 2E90A 2Z7HA 5AHUB 1RQJA 3LJIA 3WJNA 2PS5A 2OPMA 5JV1F 4P0XA 3LLWA 4OMHA 3AE0A 4KK2A 2EWGA 1N20A 5JUZF 4F6VA 5B02A 4KQSA 2Q9YA 3PYBA 3M01A 4GA3A 1RQIA 3WCIA 1EZFA 1VG7A 2O1OA 5HN8A 5IL8A 3TFPA 5IK0A 2E94A 4NUAA 1V4KA 3N49F 1VG2A 1YYUA 2P1CA 1HXAA 2DH4A 3P8RA 3SDRA 5A0KA 4DI5A 3KBKA 1UBYA 3LGZB 3ZL6A 2F8ZF 4NG6A 2ZCOA 5ILYA 3CKEA 4NKFA 3EZ3A 1VG4A 5IL3A 3Q2ZA 4EA0A 4EA2A 3WCFA 4ZQ8A 2Z7IA 3G4DA 1HXGA 5IK6A 5DHKA 3NPKA 5AFXA 3CP6A 5C05A 3V1XA 5E8HA 4LTVA 5I1UA 4H5DF 1WL3A 4KPJA 5A0IA 5IMNA 4KUXA 3RBMA 4JVJF 3SDTA 2E8UA 2Z4YA 3VJCA 3WCMA 3ID0A 3WEFA 4MC8A 5JA0F 5B0MA 3N46F 1YHMA 4KVIA 3WSAA 2Q58A 5HN9A 5KSXF 2ONHA 5EASA 3ICKA 3LEEA 1WY0A 4RXDA 3KROA 3N3LF 4RXEA 3PYAA 4DXJA 3ASXA 3CC9A 3WJKA 5JV0F 3EFQA 4LLTA 4GP2A 3WEJA 2Z50A 2ZY1A 4QPFA 2Q80A 2E91A 1N1BA 3WCCA 1YYQA 4GAXA 2E8XA 4KQ5A 5H9DA 2RAHA 3ICZA 4KVWA 3NRIA 3AQ0A 4LFVF 5ER8A 3OABA 3V1VA 1YHLA 2E92A 4FP4A 3OABB 1HM7A 4FJQA 5IMIA 3S9VA 1YHKA 4E9UA 3WCGA 2F94F 3RYEA 3ZCDA 3VJEA 3ZMBA 3KRFA 4K10A 3WE9A 3KRFB 1DGPA 1HM4A 1V4EA 4LLSA 3WSBA 3IPIA 3WCHA 3MAVA 4KWDA 2FTZA 3PKOA 5EROA 5CG5A 2VF6A 2OPNA 2Z52A 4RYPA 4NFKF 4NKEA 1JFAA 3RMGA 4DEMF 5B01A 1WMWA 3LVSA 3WEKA 3PDEA 3WC9A 2Z4ZA 4RXAA 4JZXA 4LA6A 1YQ7A 4LZCA 4JXYA 3WCLA 5ILJA 2ZCRA 2F8CF 3LMDA 2QISA 2H8OA 3MZVA 4N9UA 2ZEUA 3DYHA 5DW7A 3V66A 5ILIA 3OYRA 2E8WA 5IM1A 5ERMA 2Z4WA 1KIZA 3AQBB 3W7FA 1VG6A 4OGUA 5CG6A 5JV2F 1FPSA 3ACYA 2AEKA 5IKHA 4N1ZF 2F92F 4OKZA 2Z4XA 1V4HA 5DJRF 4LXWA 3KRPA 4QXSF 3KRPB 1YV5A 3N6KF 1YJ4A 3N1VF 3WCAA 2E8TA 5DJPF 5EATA 4KQUA 3QQVA 4DWBA 3WEHA 3LK5A 3EGTA 2Z78A 5IVGA 4P0VA 3TFVA 5E8KA 2ZEVA 3N0FA 3TFNA 3OACA 3VJ9A 3OACB 2F7MF 2E93A 5E8LA 3LSNA 3VJAA 4LZ0A 4KVYA 3PH7A 3LG5A 3N5HF 4JZBA 5EAUA 3NF2A 5DHIA 5IKAA 2OA6A 4KKMA 2PS8A 2I19A 3Q1OA 1N22A 3ZOUA 1VG3A 1WL2A 5DGSF 4KPDA 5DGMF 2J1OA 3UCAA 2AZLA 5DZ2A 1WL1A 1V4JA 2PS7A 2AETA 3WCBA 3ACWA 3SDUA 3DYFA 3SDVA 5B0LA 1DI1A 1UBVA 5AYPA 2PS4A 4KFAA 3IBAA 4KVDA 4WK5A 1UBWA 4XQRF 4EA1A 3LOMA 3LDWA 3KRCA 3WCEA 3KRCB 2AELA 3ACXA 3N5JF 4PVXF 3RYWA 4H5EF 4Q23A 5HN7A 2E4OA 4E9ZA 4OMGA 3VJBA 1RTRA 2Q9ZA 5B0IA 5ERNA 4MC3A 3BNYA 1YYTA 3Q2QA 4PVYF 1N24A 2FORA 4UMJA 3ICNA 4LPHF 3KB9A 1N21A 1PS1A 2F9KF 2PS6A 4JXNA 3QKCA 4LFEA 5B0KA 3N1WF 4NFJF 4F62A 3SAEA 3N45F 3M00A 4LPGF 5ILKA 5IK9A 3VJ8A 1JFGA 3TC1A 4RNQA 3G4FA 1N23A 3SDQA 3LGKA 3ZMCA 1KIYA 4E1EA 4LZ3A 1UBXA 3S4JA 1YYRA 5A0JA 2J5CA 4MC0A 3KRAA 4GP1A 3KRAB 2ZCSA 3VJDA 5ILDA 4LTZA 2ZCQA 1HXCA 3BNXA 4LIXA 5DGNF 2Z4VA 4XQSF 3M9UA 4LA5A 2F89F 3APZA 3M02A 1WKZA 3WEIA 4P0WA 3P5PA 3DYGA 4LOBA 2AZKA 3ADZA 3AQCB 1V4IA 3N0GA 3Q30A 1HX9A 1N1ZA 3KROB 5ILHA 3LZ9A 5B0JA 2AZJA 3TS7A 5DIQF 4JYXA 3N3DA 1WL0A 2OGDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WCD A;  3WJO A;  3P8L A;  2J1P A;  4F6X A;  2E8V A;  4H5C F;  5B03 A;  4LFG A;  5IMP A;  3ICM A;  5ILZ A;  1YYS A;  4DZW A;  4LUU A;  4DWG A;  2ONG A;  4DHD A;  5HNA A;  3NPR A;  4OKM A;  3B7L A;  5AEL A;  4L2X F;  3P5R A;  3M0G A;  3P41 A;  3WEG A;  5IN8 A;  4HD1 A;  3WCJ A;  5B00 A;  1ZW5 A;  5DJV F;  4XQT F;  4NFI F;  4RXC A;  2E95 A;  2E90 A;  2Z7H A;  5AHU B;  1RQJ A;  3LJI A;  3WJN A;  2PS5 A;  2OPM A;  5JV1 F;  4P0X A;  3LLW A;  4OMH A;  3AE0 A;  4KK2 A;  2EWG A;  1N20 A;  5JUZ F;  4F6V A;  5B02 A;  4KQS A;  2Q9Y A;  3PYB A;  3M01 A;  4GA3 A;  1RQI A;  3WCI A;  1EZF A;  1VG7 A;  2O1O A;  5HN8 A;  5IL8 A;  3TFP A;  5IK0 A;  2E94 A;  4NUA A;  1V4K A;  3N49 F;  1VG2 A;  1YYU A;  2P1C A;  1HXA A;  2DH4 A;  3P8R A;  3SDR A;  5A0K A;  4DI5 A;  3KBK A;  1UBY A;  3LGZ B;  3ZL6 A;  2F8Z F;  4NG6 A;  2ZCO A;  5ILY A;  3CKE A;  4NKF A;  3EZ3 A;  1VG4 A;  5IL3 A;  3Q2Z A;  4EA0 A;  4EA2 A;  3WCF A;  4ZQ8 A;  2Z7I A;  3G4D A;  1HXG A;  5IK6 A;  5DHK A;  3NPK A;  5AFX A;  3CP6 A;  5C05 A;  3V1X A;  5E8H A;  4LTV A;  5I1U A;  4H5D F;  1WL3 A;  4KPJ A;  5A0I A;  5IMN A;  4KUX A;  3RBM A;  4JVJ F;  3SDT A;  2E8U A;  2Z4Y A;  3VJC A;  3WCM A;  3ID0 A;  3WEF A;  4MC8 A;  5JA0 F;  5B0M A;  3N46 F;  1YHM A;  4KVI A;  3WSA A;  2Q58 A;  5HN9 A;  5KSX F;  2ONH A;  5EAS A;  3ICK A;  3LEE A;  1WY0 A;  4RXD A;  3KRO A;  3N3L F;  4RXE A;  3PYA A;  4DXJ A;  3ASX A;  3CC9 A;  3WJK A;  5JV0 F;  3EFQ A;  4LLT A;  4GP2 A;  3WEJ A;  2Z50 A;  2ZY1 A;  4QPF A;  2Q80 A;  2E91 A;  1N1B A;  3WCC A;  1YYQ A;  4GAX A;  2E8X A;  4KQ5 A;  5H9D A;  2RAH A;  3ICZ A;  4KVW A;  3NRI A;  3AQ0 A;  4LFV F;  5ER8 A;  3OAB A;  3V1V A;  1YHL A;  2E92 A;  4FP4 A;  3OAB B;  1HM7 A;  4FJQ A;  5IMI A;  3S9V A;  1YHK A;  4E9U A;  3WCG A;  2F94 F;  3RYE A;  3ZCD A;  3VJE A;  3ZMB A;  3KRF A;  4K10 A;  3WE9 A;  3KRF B;  1DGP A;  1HM4 A;  1V4E A;  4LLS A;  3WSB A;  3IPI A;  3WCH A;  3MAV A;  4KWD A;  2FTZ A;  3PKO A;  5ERO A;  5CG5 A;  2VF6 A;  2OPN A;  2Z52 A;  4RYP A;  4NFK F;  4NKE A;  1JFA A;  3RMG A;  4DEM F;  5B01 A;  1WMW A;  3LVS A;  3WEK A;  3PDE A;  3WC9 A;  2Z4Z A;  4RXA A;  4JZX A;  4LA6 A;  1YQ7 A;  4LZC A;  4JXY A;  3WCL A;  5ILJ A;  2ZCR A;  2F8C F;  3LMD A;  2QIS A;  2H8O A;  3MZV A;  4N9U A;  2ZEU A;  3DYH A;  5DW7 A;  3V66 A;  5ILI A;  3OYR A;  2E8W A;  5IM1 A;  5ERM A;  2Z4W A;  1KIZ A;  3AQB B;  3W7F A;  1VG6 A;  4OGU A;  5CG6 A;  5JV2 F;  1FPS A;  3ACY A;  2AEK A;  5IKH A;  4N1Z F;  2F92 F;  4OKZ A;  2Z4X A;  1V4H A;  5DJR F;  4LXW A;  3KRP A;  4QXS F;  3KRP B;  1YV5 A;  3N6K F;  1YJ4 A;  3N1V F;  3WCA A;  2E8T A;  5DJP F;  5EAT A;  4KQU A;  3QQV A;  4DWB A;  3WEH A;  3LK5 A;  3EGT A;  2Z78 A;  5IVG A;  4P0V A;  3TFV A;  5E8K A;  2ZEV A;  3N0F A;  3TFN A;  3OAC A;  3VJ9 A;  3OAC B;  2F7M F;  2E93 A;  5E8L A;  3LSN A;  3VJA A;  4LZ0 A;  4KVY A;  3PH7 A;  3LG5 A;  3N5H F;  4JZB A;  5EAU A;  3NF2 A;  5DHI A;  5IKA A;  2OA6 A;  4KKM A;  2PS8 A;  2I19 A;  3Q1O A;  1N22 A;  3ZOU A;  1VG3 A;  1WL2 A;  5DGS F;  4KPD A;  5DGM F;  2J1O A;  3UCA A;  2AZL A;  5DZ2 A;  1WL1 A;  1V4J A;  2PS7 A;  2AET A;  3WCB A;  3ACW A;  3SDU A;  3DYF A;  3SDV A;  5B0L A;  1DI1 A;  1UBV A;  5AYP A;  2PS4 A;  4KFA A;  3IBA A;  4KVD A;  4WK5 A;  1UBW A;  4XQR F;  4EA1 A;  3LOM A;  3LDW A;  3KRC A;  3WCE A;  3KRC B;  2AEL A;  3ACX A;  3N5J F;  4PVX F;  3RYW A;  4H5E F;  4Q23 A;  5HN7 A;  2E4O A;  4E9Z A;  4OMG A;  3VJB A;  1RTR A;  2Q9Z A;  5B0I A;  5ERN A;  4MC3 A;  3BNY A;  1YYT A;  3Q2Q A;  4PVY F;  1N24 A;  2FOR A;  4UMJ A;  3ICN A;  4LPH F;  3KB9 A;  1N21 A;  1PS1 A;  2F9K F;  2PS6 A;  4JXN A;  3QKC A;  4LFE A;  5B0K A;  3N1W F;  4NFJ F;  4F62 A;  3SAE A;  3N45 F;  3M00 A;  4LPG F;  5ILK A;  5IK9 A;  3VJ8 A;  1JFG A;  3TC1 A;  4RNQ A;  3G4F A;  1N23 A;  3SDQ A;  3LGK A;  3ZMC A;  1KIY A;  4E1E A;  4LZ3 A;  1UBX A;  3S4J A;  1YYR A;  5A0J A;  2J5C A;  4MC0 A;  3KRA A;  4GP1 A;  3KRA B;  2ZCS A;  3VJD A;  5ILD A;  4LTZ A;  2ZCQ A;  1HXC A;  3BNX A;  4LIX A;  5DGN F;  2Z4V A;  4XQS F;  3M9U A;  4LA5 A;  2F89 F;  3APZ A;  3M02 A;  1WKZ A;  3WEI A;  4P0W A;  3P5P A;  3DYG A;  4LOB A;  2AZK A;  3ADZ A;  3AQC B;  1V4I A;  3N0G A;  3Q30 A;  1HX9 A;  1N1Z A;  3KRO B;  5ILH A;  3LZ9 A;  5B0J A;  2AZJ A;  3TS7 A;  5DIQ F;  4JYX A;  3N3D A;  1WL0 A;  2OGD A; 
#chains in the Genus database with same CATH topology
 3WCD A;  3WJO A;  3P8L A;  2J1P A;  4F6X A;  2E8V A;  4H5C F;  5B03 A;  4LFG A;  5IMP A;  3ICM A;  5ILZ A;  1YYS A;  4DZW A;  4LUU A;  4DWG A;  2ONG A;  4DHD A;  5HNA A;  3NPR A;  4OKM A;  3B7L A;  5AEL A;  4L2X F;  3P5R A;  3M0G A;  3P41 A;  3WEG A;  5IN8 A;  4HD1 A;  3WCJ A;  5B00 A;  1ZW5 A;  5DJV F;  4XQT F;  4NFI F;  4RXC A;  2E95 A;  2E90 A;  2Z7H A;  5AHU B;  1RQJ A;  3LJI A;  3WJN A;  2PS5 A;  2OPM A;  5JV1 F;  4P0X A;  3LLW A;  4OMH A;  3AE0 A;  4KK2 A;  2EWG A;  1N20 A;  5JUZ F;  4F6V A;  5B02 A;  4KQS A;  2Q9Y A;  3PYB A;  3M01 A;  4GA3 A;  1RQI A;  3WCI A;  1EZF A;  1VG7 A;  2O1O A;  5HN8 A;  5IL8 A;  3TFP A;  5IK0 A;  2E94 A;  4NUA A;  1V4K A;  3N49 F;  1VG2 A;  1YYU A;  2P1C A;  1HXA A;  2DH4 A;  3P8R A;  3SDR A;  5A0K A;  4DI5 A;  3KBK A;  1UBY A;  3LGZ B;  3ZL6 A;  2F8Z F;  4NG6 A;  2ZCO A;  5ILY A;  3CKE A;  4NKF A;  3EZ3 A;  1VG4 A;  5IL3 A;  3Q2Z A;  4EA0 A;  4EA2 A;  3WCF A;  4ZQ8 A;  2Z7I A;  3G4D A;  1HXG A;  5IK6 A;  5DHK A;  3NPK A;  5AFX A;  3CP6 A;  5C05 A;  3V1X A;  5E8H A;  4LTV A;  5I1U A;  4H5D F;  1WL3 A;  4KPJ A;  5A0I A;  5IMN A;  4KUX A;  3RBM A;  4JVJ F;  3SDT A;  2E8U A;  2Z4Y A;  3VJC A;  3WCM A;  3ID0 A;  3WEF A;  4MC8 A;  5JA0 F;  5B0M A;  3N46 F;  1YHM A;  4KVI A;  3WSA A;  2Q58 A;  5HN9 A;  5KSX F;  2ONH A;  5EAS A;  3ICK A;  3LEE A;  1WY0 A;  4RXD A;  3KRO A;  3N3L F;  4RXE A;  3PYA A;  4DXJ A;  3ASX A;  3CC9 A;  3WJK A;  5JV0 F;  3EFQ A;  4LLT A;  4GP2 A;  3WEJ A;  2Z50 A;  2ZY1 A;  4QPF A;  2Q80 A;  2E91 A;  1N1B A;  3WCC A;  1YYQ A;  4GAX A;  2E8X A;  4KQ5 A;  5H9D A;  2RAH A;  3ICZ A;  4KVW A;  3NRI A;  3AQ0 A;  4LFV F;  5ER8 A;  3OAB A;  3V1V A;  1YHL A;  2E92 A;  4FP4 A;  3OAB B;  1HM7 A;  4FJQ A;  5IMI A;  3S9V A;  1YHK A;  4E9U A;  3WCG A;  2F94 F;  3RYE A;  3ZCD A;  3VJE A;  3ZMB A;  3KRF A;  4K10 A;  3WE9 A;  3KRF B;  1DGP A;  1HM4 A;  1V4E A;  4LLS A;  3WSB A;  3IPI A;  3WCH A;  3MAV A;  4KWD A;  2FTZ A;  3PKO A;  5ERO A;  5CG5 A;  2VF6 A;  2OPN A;  2Z52 A;  4RYP A;  4NFK F;  4NKE A;  1JFA A;  3RMG A;  4DEM F;  5B01 A;  1WMW A;  3LVS A;  3WEK A;  3PDE A;  3WC9 A;  2Z4Z A;  4RXA A;  4JZX A;  4LA6 A;  1YQ7 A;  4LZC A;  4JXY A;  3WCL A;  5ILJ A;  2ZCR A;  2F8C F;  3LMD A;  2QIS A;  2H8O A;  3MZV A;  4N9U A;  2ZEU A;  3DYH A;  5DW7 A;  3V66 A;  5ILI A;  3OYR A;  2E8W A;  5IM1 A;  5ERM A;  2Z4W A;  1KIZ A;  3AQB B;  3W7F A;  1VG6 A;  4OGU A;  5CG6 A;  5JV2 F;  1FPS A;  3ACY A;  2AEK A;  5IKH A;  4N1Z F;  2F92 F;  4OKZ A;  2Z4X A;  1V4H A;  5DJR F;  4LXW A;  3KRP A;  4QXS F;  3KRP B;  1YV5 A;  3N6K F;  1YJ4 A;  3N1V F;  3WCA A;  2E8T A;  5DJP F;  5EAT A;  4KQU A;  3QQV A;  4DWB A;  3WEH A;  3LK5 A;  3EGT A;  2Z78 A;  5IVG A;  4P0V A;  3TFV A;  5E8K A;  2ZEV A;  3N0F A;  3TFN A;  3OAC A;  3VJ9 A;  3OAC B;  2F7M F;  2E93 A;  5E8L A;  3LSN A;  3VJA A;  4LZ0 A;  4KVY A;  3PH7 A;  3LG5 A;  3N5H F;  4JZB A;  5EAU A;  3NF2 A;  5DHI A;  5IKA A;  2OA6 A;  4KKM A;  2PS8 A;  2I19 A;  3Q1O A;  1N22 A;  3ZOU A;  1VG3 A;  1WL2 A;  5DGS F;  4KPD A;  5DGM F;  2J1O A;  3UCA A;  2AZL A;  5DZ2 A;  1WL1 A;  1V4J A;  2PS7 A;  2AET A;  3WCB A;  3ACW A;  3SDU A;  3DYF A;  3SDV A;  5B0L A;  1DI1 A;  1UBV A;  5AYP A;  2PS4 A;  4KFA A;  3IBA A;  4KVD A;  4WK5 A;  1UBW A;  4XQR F;  4EA1 A;  3LOM A;  3LDW A;  3KRC A;  3WCE A;  3KRC B;  2AEL A;  3ACX A;  3N5J F;  4PVX F;  3RYW A;  4H5E F;  4Q23 A;  5HN7 A;  2E4O A;  4E9Z A;  4OMG A;  3VJB A;  1RTR A;  2Q9Z A;  5B0I A;  5ERN A;  4MC3 A;  3BNY A;  1YYT A;  3Q2Q A;  4PVY F;  1N24 A;  2FOR A;  4UMJ A;  3ICN A;  4LPH F;  3KB9 A;  1N21 A;  1PS1 A;  2F9K F;  2PS6 A;  4JXN A;  3QKC A;  4LFE A;  5B0K A;  3N1W F;  4NFJ F;  4F62 A;  3SAE A;  3N45 F;  3M00 A;  4LPG F;  5ILK A;  5IK9 A;  3VJ8 A;  1JFG A;  3TC1 A;  4RNQ A;  3G4F A;  1N23 A;  3SDQ A;  3LGK A;  3ZMC A;  1KIY A;  4E1E A;  4LZ3 A;  1UBX A;  3S4J A;  1YYR A;  5A0J A;  2J5C A;  4MC0 A;  3KRA A;  4GP1 A;  3KRA B;  2ZCS A;  3VJD A;  5ILD A;  4LTZ A;  2ZCQ A;  1HXC A;  3BNX A;  4LIX A;  5DGN F;  2Z4V A;  4XQS F;  3M9U A;  4LA5 A;  2F89 F;  3APZ A;  3M02 A;  1WKZ A;  3WEI A;  4P0W A;  3P5P A;  3DYG A;  4LOB A;  2AZK A;  3ADZ A;  3AQC B;  1V4I A;  3N0G A;  3Q30 A;  1HX9 A;  1N1Z A;  3KRO B;  5ILH A;  3LZ9 A;  5B0J A;  2AZJ A;  3TS7 A;  5DIQ F;  4JYX A;  3N3D A;  1WL0 A;  2OGD A; 
#chains in the Genus database with same CATH homology
 3WCD A;  3WJO A;  3P8L A;  2J1P A;  4F6X A;  2E8V A;  4H5C F;  5B03 A;  4LFG A;  5IMP A;  3ICM A;  5ILZ A;  1YYS A;  4DZW A;  4LUU A;  4DWG A;  2ONG A;  4DHD A;  5HNA A;  3NPR A;  4OKM A;  3B7L A;  5AEL A;  4L2X F;  3P5R A;  3M0G A;  3P41 A;  3WEG A;  5IN8 A;  4HD1 A;  3WCJ A;  5B00 A;  1ZW5 A;  5DJV F;  4XQT F;  4NFI F;  4RXC A;  2E95 A;  2E90 A;  2Z7H A;  5AHU B;  1RQJ A;  3LJI A;  3WJN A;  2PS5 A;  2OPM A;  5JV1 F;  4P0X A;  3LLW A;  4OMH A;  3AE0 A;  4KK2 A;  2EWG A;  1N20 A;  5JUZ F;  4F6V A;  5B02 A;  4KQS A;  2Q9Y A;  3PYB A;  3M01 A;  4GA3 A;  1RQI A;  3WCI A;  1EZF A;  1VG7 A;  2O1O A;  5HN8 A;  5IL8 A;  3TFP A;  5IK0 A;  2E94 A;  4NUA A;  1V4K A;  3N49 F;  1VG2 A;  1YYU A;  2P1C A;  1HXA A;  2DH4 A;  3P8R A;  3SDR A;  5A0K A;  4DI5 A;  3KBK A;  1UBY A;  3LGZ B;  3ZL6 A;  2F8Z F;  4NG6 A;  2ZCO A;  5ILY A;  3CKE A;  4NKF A;  3EZ3 A;  1VG4 A;  5IL3 A;  3Q2Z A;  4EA0 A;  4EA2 A;  3WCF A;  4ZQ8 A;  2Z7I A;  3G4D A;  1HXG A;  5IK6 A;  5DHK A;  3NPK A;  5AFX A;  3CP6 A;  5C05 A;  3V1X A;  5E8H A;  4LTV A;  5I1U A;  4H5D F;  1WL3 A;  4KPJ A;  5A0I A;  5IMN A;  4KUX A;  3RBM A;  4JVJ F;  3SDT A;  2E8U A;  2Z4Y A;  3VJC A;  3WCM A;  3ID0 A;  3WEF A;  4MC8 A;  5JA0 F;  5B0M A;  3N46 F;  1YHM A;  4KVI A;  3WSA A;  2Q58 A;  5HN9 A;  5KSX F;  2ONH A;  5EAS A;  3ICK A;  3LEE A;  1WY0 A;  4RXD A;  3KRO A;  3N3L F;  4RXE A;  3PYA A;  4DXJ A;  3ASX A;  3CC9 A;  3WJK A;  5JV0 F;  3EFQ A;  4LLT A;  4GP2 A;  3WEJ A;  2Z50 A;  2ZY1 A;  4QPF A;  2Q80 A;  2E91 A;  1N1B A;  3WCC A;  1YYQ A;  4GAX A;  2E8X A;  4KQ5 A;  5H9D A;  2RAH A;  3ICZ A;  4KVW A;  3NRI A;  3AQ0 A;  4LFV F;  5ER8 A;  3OAB A;  3V1V A;  1YHL A;  2E92 A;  4FP4 A;  3OAB B;  1HM7 A;  4FJQ A;  5IMI A;  3S9V A;  1YHK A;  4E9U A;  3WCG A;  2F94 F;  3RYE A;  3ZCD A;  3VJE A;  3ZMB A;  3KRF A;  4K10 A;  3WE9 A;  3KRF B;  1DGP A;  1HM4 A;  1V4E A;  4LLS A;  3WSB A;  3IPI A;  3WCH A;  3MAV A;  4KWD A;  2FTZ A;  3PKO A;  5ERO A;  5CG5 A;  2VF6 A;  2OPN A;  2Z52 A;  4RYP A;  4NFK F;  4NKE A;  1JFA A;  3RMG A;  4DEM F;  5B01 A;  1WMW A;  3LVS A;  3WEK A;  3PDE A;  3WC9 A;  2Z4Z A;  4RXA A;  4JZX A;  4LA6 A;  1YQ7 A;  4LZC A;  4JXY A;  3WCL A;  5ILJ A;  2ZCR A;  2F8C F;  3LMD A;  2QIS A;  2H8O A;  3MZV A;  4N9U A;  2ZEU A;  3DYH A;  5DW7 A;  3V66 A;  5ILI A;  3OYR A;  2E8W A;  5IM1 A;  5ERM A;  2Z4W A;  1KIZ A;  3AQB B;  3W7F A;  1VG6 A;  4OGU A;  5CG6 A;  5JV2 F;  1FPS A;  3ACY A;  2AEK A;  5IKH A;  4N1Z F;  2F92 F;  4OKZ A;  2Z4X A;  1V4H A;  5DJR F;  4LXW A;  3KRP A;  4QXS F;  3KRP B;  1YV5 A;  3N6K F;  1YJ4 A;  3N1V F;  3WCA A;  2E8T A;  5DJP F;  5EAT A;  4KQU A;  3QQV A;  4DWB A;  3WEH A;  3LK5 A;  3EGT A;  2Z78 A;  5IVG A;  4P0V A;  3TFV A;  5E8K A;  2ZEV A;  3N0F A;  3TFN A;  3OAC A;  3VJ9 A;  3OAC B;  2F7M F;  2E93 A;  5E8L A;  3LSN A;  3VJA A;  4LZ0 A;  4KVY A;  3PH7 A;  3LG5 A;  3N5H F;  4JZB A;  5EAU A;  3NF2 A;  5DHI A;  5IKA A;  2OA6 A;  4KKM A;  2PS8 A;  2I19 A;  3Q1O A;  1N22 A;  3ZOU A;  1VG3 A;  1WL2 A;  5DGS F;  4KPD A;  5DGM F;  2J1O A;  3UCA A;  2AZL A;  5DZ2 A;  1WL1 A;  1V4J A;  2PS7 A;  2AET A;  3WCB A;  3ACW A;  3SDU A;  3DYF A;  3SDV A;  5B0L A;  1DI1 A;  1UBV A;  5AYP A;  2PS4 A;  4KFA A;  3IBA A;  4KVD A;  4WK5 A;  1UBW A;  4XQR F;  4EA1 A;  3LOM A;  3LDW A;  3KRC A;  3WCE A;  3KRC B;  2AEL A;  3ACX A;  3N5J F;  4PVX F;  3RYW A;  4H5E F;  4Q23 A;  5HN7 A;  2E4O A;  4E9Z A;  4OMG A;  3VJB A;  1RTR A;  2Q9Z A;  5B0I A;  5ERN A;  4MC3 A;  3BNY A;  1YYT A;  3Q2Q A;  4PVY F;  1N24 A;  2FOR A;  4UMJ A;  3ICN A;  4LPH F;  3KB9 A;  1N21 A;  1PS1 A;  2F9K F;  2PS6 A;  4JXN A;  3QKC A;  4LFE A;  5B0K A;  3N1W F;  4NFJ F;  4F62 A;  3SAE A;  3N45 F;  3M00 A;  4LPG F;  5ILK A;  5IK9 A;  3VJ8 A;  1JFG A;  3TC1 A;  4RNQ A;  3G4F A;  1N23 A;  3SDQ A;  3LGK A;  3ZMC A;  1KIY A;  4E1E A;  4LZ3 A;  1UBX A;  3S4J A;  1YYR A;  5A0J A;  2J5C A;  4MC0 A;  3KRA A;  4GP1 A;  3KRA B;  2ZCS A;  3VJD A;  5ILD A;  4LTZ A;  2ZCQ A;  1HXC A;  3BNX A;  4LIX A;  5DGN F;  2Z4V A;  4XQS F;  3M9U A;  4LA5 A;  2F89 F;  3APZ A;  3M02 A;  1WKZ A;  3WEI A;  4P0W A;  3P5P A;  3DYG A;  4LOB A;  2AZK A;  3ADZ A;  3AQC B;  1V4I A;  3N0G A;  3Q30 A;  1HX9 A;  1N1Z A;  3KRO B;  5ILH A;  3LZ9 A;  5B0J A;  2AZJ A;  3TS7 A;  5DIQ F;  4JYX A;  3N3D A;  1WL0 A;  2OGD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...