2AZKA

Crystal structure for the mutant w136e of sulfolobus solfataricus hexaprenyl pyrophosphate synthase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
276
structure length
276
Chain Sequence
MSIIEFWLEAKATIDRLIEQFLNSNRDWDLVDISSYILKDGKRFRGTLNMFFTVALGGDIKDSYGGALAIEILHSASLALDDIVDLDATRRGDKAAWVVYGNRKVIFITNYLIPTALRIIQTSYGDDALNTSIELEKDTSVGALRDMYDNSDYIRTIELKTGSLFKLSTVLSAYASKHYNTKQQMLDVGKYLGIIYQVIDDFVDYKTKKVEEIDGSAKQLFKYYREGKLEEYVRSVYLEYKQKYDELISNIPFQSKYLSEIRSLPEFLANGLLKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranylgeranyl pyrophosphate synthetase
publication title Homodimeric hexaprenyl pyrophosphate synthase from the thermoacidophilic crenarchaeon Sulfolobus solfataricus displays asymmetric subunit structures
pubmed doi rcsb
source organism Sulfolobus solfataricus
total genus 113
structure length 276
sequence length 276
chains with identical sequence B
ec nomenclature ec 2.5.1.82: Hexaprenyl diphosphate synthase (geranylgeranyl-diphosphate specific).
pdb deposition date 2005-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 2azkA00
4GP1A 4LUUA 3G4FA 4JZXA 1JFAA 3AQBB 5ILIA 3N6KF 2I19A 5DHKA 4E9UA 2PS6A 4KUXA 3VJEA 3PYAA 3RYEA 2Q58A 4MC0A 2E95A 1YYRA 2Z78A 4LA6A 5IMIA 4F62A 3VJ8A 4MC8A 3V1VA 4RXAA 2F92F 1YQ7A 3DYGA 4KVIA 1UBWA 4UMJA 3ZCDA 2ZCSA 3OACB 4K10A 2E90A 4PVXF 2Z50A 1N1BA 4LXWA 3SDUA 4P0WA 1PS1A 2E8VA 4DI5A 3WCDA 1VG2A 4QPFA 3KROA 3M02A 3BNYA 3M9UA 2E4OA 4OMHA 4KWDA 2ONGA 5IM1A 3N0FA 5AELA 1N22A 4NUAA 1HXGA 2J1PA 3LMDA 4JZBA 3LEEA 2ZCOA 4KVYA 3VJBA 5ILHA 3N46F 5DJRF 1WL3A 5AHUB 3AQ0A 4P0XA 4XQTF 5JA0F 4LPGF 2Z4XA 3M00A 3LLWA 3WCHA 2Q9ZA 1RQIA 2ZCRA 3RBMA 1YHKA 3WE9A 2Z4YA 4GA3A 1VG4A 3WCEA 3LJIA 1V4HA 1HM7A 4E9ZA 2Q9YA 3ICMA 5E8KA 1YYSA 1KIYA 1DGPA 5CG5A 2PS8A 2O1OA 3CKEA 3NPRA 4XQRF 5C05A 5HN8A 4LZ3A 5IL3A 2OPMA 1YYTA 2Z52A 3TFPA 3Q2ZA 4E1EA 1HX9A 1UBVA 5IK6A 4KK2A 4LLSA 1UBYA 5EAUA 3ACYA 3N3LF 5IKAA 3Q2QA 3OABA 3KB9A 4OKMA 2E92A 4NKFA 5B02A 1WL2A 1HXAA 4KQUA 3WJKA 4H5EF 2E93A 4LOBA 3TFNA 3WC9A 4DHDA 3KRPB 5JV1F 1V4KA 2F7MF 3ZMCA 3WCGA 3LZ9A 5ILKA 3P5PA 2Z4VA 3Q1OA 2E8UA 2H8OA 5ILJA 4F6VA 1DI1A 4LIXA 2OGDA 4L2XF 3EGTA 3S9VA 3WEIA 3ACWA 3EZ3A 2OA6A 3B7LA 4KFAA 2Z4ZA 3UCAA 3M0GA 2Z7IA 3MZVA 3AE0A 4LPHF 4LZCA 2ZEVA 3P5RA 4FP4A 3LGKA 3WSBA 3M01A 1YJ4A 3VJ9A 2E91A 3KBKA 5DGMF 5ERNA 1ZW5A 5AYPA 3KRCB 4XQSF 5AFXA 3W7FA 3KRAA 2ONHA 5CG6A 2AETA 2AELA 4OKZA 2E8TA 5IK9A 3KRFB 4KPDA 5ERMA 1HXCA 2QISA 1YV5A 2AZJA 2FORA 3LSNA 5DZ2A 3LDWA 3WEKA 5EASA 5ILYA 3VJDA 4MC3A 1UBXA 3ICKA 1RQJA 3ASXA 5E8HA 5HNAA 1KIZA 2E8XA 2AZLA 3TFVA 4LFVF 3APZA 1JFGA 2FTZA 5IL8A 5I1UA 5IMPA 3PH7A 4DEMF 2VF6A 3NF2A 5JV2F 1VG7A 3PKOA 4RXEA 5A0KA 3N45F 3WEGA 5B0MA 1N24A 3SDQA 2E94A 5DGSF 5B0LA 3Q30A 3LVSA 5DW7A 3ICNA 4EA0A 5E8LA 4KVWA 3WEHA 5IKHA 4KPJA 3KROB 3WCCA 3N1VF 4RNQA 2AEKA 2F8ZF 3RMGA 1HM4A 4JYXA 5DJPF 3EFQA 3RYWA 3G4DA 5HN9A 3WJOA 4JVJF 2J1OA 4DWGA 5ILDA 4LFGA 4OGUA 3DYHA 5DJVF 3MAVA 2Z4WA 4KKMA 5DHIA 3AQCB 2Z7HA 4NFJF 3N5JF 1N20A 5HN7A 4HD1A 1VG6A 2PS4A 4RXDA 4QXSF 1V4IA 3ACXA 2PS5A 3PYBA 3QQVA 4JXYA 2F8CF 3LG5A 3IPIA 2AZKA 4LLTA 1WL0A 3BNXA 3OACA 3IBAA 3LGZB 3WJNA 4GAXA 4RYPA 2F9KF 3CP6A 2PS7A 2ZY1A 4DZWA 3N49F 3N0GA 1V4EA 4GP2A 3ZMBA 2J5CA 3DYFA 4ZQ8A 5KSXF 3P8LA 3SDRA 3S4JA 1V4JA 3OABB 5B0JA 1N23A 4KQSA 2ZCQA 1WKZA 2RAHA 4LA5A 2OPNA 3N5HF 4H5CF 4NFKF 5IMNA 3OYRA 2Q80A 3SAEA 5DGNF 5H9DA 3ICZA 4LFEA 5B03A 3VJAA 2F94F 3LOMA 4KVDA 5B00A 4RXCA 3LK5A 4JXNA 5JUZF 1RTRA 1YHLA 3ZOUA 3WCLA 3WCBA 5DIQF 3PDEA 3WCFA 2EWGA 3V1XA 2P1CA 5IK0A 3TS7A 3NPKA 4NFIF 4FJQA 3WEJA 2E8WA 3NRIA 4NG6A 1WL1A 2DH4A 3KRAB 4WK5A 3WCJA 3WCIA 1FPSA 5B0IA 5B0KA 3TC1A 3N3DA 1EZFA 4F6XA 3P8RA 1N21A 1YYQA 4EA2A 4H5DF 3KRPA 5B01A 1YYUA 3SDTA 3SDVA 3WCAA 3ID0A 4LTVA 4LTZA 5IN8A 5ER8A 4P0VA 5A0JA 3ZL6A 4Q23A 4DWBA 4PVYF 4EA1A 3V66A 5IVGA 4N9UA 4DXJA 4N1ZF 4NKEA 5JV0F 3WCMA 4OMGA 5ILZA 3WEFA 5A0IA 1WY0A 3KRCA 3N1WF 1N1ZA 2F89F 5EATA 5EROA 1VG3A 3P41A 3ADZA 2ZEUA 3KRFA 4KQ5A 4LZ0A 1YHMA 3WSAA 3VJCA 3CC9A 3QKCA 1WMWA
chains in the Genus database with same CATH superfamily
4GP1A 4LUUA 3G4FA 4JZXA 1JFAA 3AQBB 5ILIA 3N6KF 2I19A 5DHKA 4E9UA 2PS6A 4KUXA 3VJEA 3PYAA 3RYEA 2Q58A 4MC0A 2E95A 1YYRA 2Z78A 4LA6A 5IMIA 4F62A 3VJ8A 4MC8A 3V1VA 4RXAA 2F92F 1YQ7A 3DYGA 4KVIA 1UBWA 4UMJA 3ZCDA 2ZCSA 3OACB 4K10A 2E90A 4PVXF 2Z50A 1N1BA 4LXWA 3SDUA 4P0WA 1PS1A 2E8VA 4DI5A 3WCDA 1VG2A 4QPFA 3KROA 3M02A 3BNYA 3M9UA 2E4OA 4OMHA 4KWDA 2ONGA 5IM1A 3N0FA 5AELA 1N22A 4NUAA 1HXGA 2J1PA 3LMDA 4JZBA 3LEEA 2ZCOA 4KVYA 3VJBA 5ILHA 3N46F 5DJRF 1WL3A 5AHUB 3AQ0A 4P0XA 4XQTF 5JA0F 4LPGF 2Z4XA 3M00A 3LLWA 3WCHA 2Q9ZA 1RQIA 2ZCRA 3RBMA 1YHKA 3WE9A 2Z4YA 4GA3A 1VG4A 3WCEA 3LJIA 1V4HA 1HM7A 4E9ZA 2Q9YA 3ICMA 5E8KA 1YYSA 1KIYA 1DGPA 5CG5A 2PS8A 2O1OA 3CKEA 3NPRA 4XQRF 5C05A 5HN8A 4LZ3A 5IL3A 2OPMA 1YYTA 2Z52A 3TFPA 3Q2ZA 4E1EA 1HX9A 1UBVA 5IK6A 4KK2A 4LLSA 1UBYA 5EAUA 3ACYA 3N3LF 5IKAA 3Q2QA 3OABA 3KB9A 4OKMA 2E92A 4NKFA 5B02A 1WL2A 1HXAA 4KQUA 3WJKA 4H5EF 2E93A 4LOBA 3TFNA 3WC9A 4DHDA 3KRPB 5JV1F 1V4KA 2F7MF 3ZMCA 3WCGA 3LZ9A 5ILKA 3P5PA 2Z4VA 3Q1OA 2E8UA 2H8OA 5ILJA 4F6VA 1DI1A 4LIXA 2OGDA 4L2XF 3EGTA 3S9VA 3WEIA 3ACWA 3EZ3A 2OA6A 3B7LA 4KFAA 2Z4ZA 3UCAA 3M0GA 2Z7IA 3MZVA 3AE0A 4LPHF 4LZCA 2ZEVA 3P5RA 4FP4A 3LGKA 3WSBA 3M01A 1YJ4A 3VJ9A 2E91A 3KBKA 5DGMF 5ERNA 1ZW5A 5AYPA 3KRCB 4XQSF 5AFXA 3W7FA 3KRAA 2ONHA 5CG6A 2AETA 2AELA 4OKZA 2E8TA 5IK9A 3KRFB 4KPDA 5ERMA 1HXCA 2QISA 1YV5A 2AZJA 2FORA 3LSNA 5DZ2A 3LDWA 3WEKA 5EASA 5ILYA 3VJDA 4MC3A 1UBXA 3ICKA 1RQJA 3ASXA 5E8HA 5HNAA 1KIZA 2E8XA 2AZLA 3TFVA 4LFVF 3APZA 1JFGA 2FTZA 5IL8A 5I1UA 5IMPA 3PH7A 4DEMF 2VF6A 3NF2A 5JV2F 1VG7A 3PKOA 4RXEA 5A0KA 3N45F 3WEGA 5B0MA 1N24A 3SDQA 2E94A 5DGSF 5B0LA 3Q30A 3LVSA 5DW7A 3ICNA 4EA0A 5E8LA 4KVWA 3WEHA 5IKHA 4KPJA 3KROB 3WCCA 3N1VF 4RNQA 2AEKA 2F8ZF 3RMGA 1HM4A 4JYXA 5DJPF 3EFQA 3RYWA 3G4DA 5HN9A 3WJOA 4JVJF 2J1OA 4DWGA 5ILDA 4LFGA 4OGUA 3DYHA 5DJVF 3MAVA 2Z4WA 4KKMA 5DHIA 3AQCB 2Z7HA 4NFJF 3N5JF 1N20A 5HN7A 4HD1A 1VG6A 2PS4A 4RXDA 4QXSF 1V4IA 3ACXA 2PS5A 3PYBA 3QQVA 4JXYA 2F8CF 3LG5A 3IPIA 2AZKA 4LLTA 1WL0A 3BNXA 3OACA 3IBAA 3LGZB 3WJNA 4GAXA 4RYPA 2F9KF 3CP6A 2PS7A 2ZY1A 4DZWA 3N49F 3N0GA 1V4EA 4GP2A 3ZMBA 2J5CA 3DYFA 4ZQ8A 5KSXF 3P8LA 3SDRA 3S4JA 1V4JA 3OABB 5B0JA 1N23A 4KQSA 2ZCQA 1WKZA 2RAHA 4LA5A 2OPNA 3N5HF 4H5CF 4NFKF 5IMNA 3OYRA 2Q80A 3SAEA 5DGNF 5H9DA 3ICZA 4LFEA 5B03A 3VJAA 2F94F 3LOMA 4KVDA 5B00A 4RXCA 3LK5A 4JXNA 5JUZF 1RTRA 1YHLA 3ZOUA 3WCLA 3WCBA 5DIQF 3PDEA 3WCFA 2EWGA 3V1XA 2P1CA 5IK0A 3TS7A 3NPKA 4NFIF 4FJQA 3WEJA 2E8WA 3NRIA 4NG6A 1WL1A 2DH4A 3KRAB 4WK5A 3WCJA 3WCIA 1FPSA 5B0IA 5B0KA 3TC1A 3N3DA 1EZFA 4F6XA 3P8RA 1N21A 1YYQA 4EA2A 4H5DF 3KRPA 5B01A 1YYUA 3SDTA 3SDVA 3WCAA 3ID0A 4LTVA 4LTZA 5IN8A 5ER8A 4P0VA 5A0JA 3ZL6A 4Q23A 4DWBA 4PVYF 4EA1A 3V66A 5IVGA 4N9UA 4DXJA 4N1ZF 4NKEA 5JV0F 3WCMA 4OMGA 5ILZA 3WEFA 5A0IA 1WY0A 3KRCA 3N1WF 1N1ZA 2F89F 5EATA 5EROA 1VG3A 3P41A 3ADZA 2ZEUA 3KRFA 4KQ5A 4LZ0A 1YHMA 3WSAA 3VJCA 3CC9A 3QKCA 1WMWA
chains in the Genus database with same CATH topology
4GP1A 4LUUA 3G4FA 4JZXA 1JFAA 3AQBB 5ILIA 3N6KF 2I19A 5DHKA 4E9UA 2PS6A 4KUXA 3VJEA 3PYAA 3RYEA 2Q58A 4MC0A 2E95A 1YYRA 2Z78A 4LA6A 5IMIA 4F62A 3VJ8A 4MC8A 3V1VA 4RXAA 2F92F 1YQ7A 3DYGA 4KVIA 1UBWA 4UMJA 3ZCDA 2ZCSA 3OACB 4K10A 2E90A 4PVXF 2Z50A 1N1BA 4LXWA 3SDUA 4P0WA 1PS1A 2E8VA 4DI5A 3WCDA 1VG2A 4QPFA 3KROA 3M02A 3BNYA 3M9UA 2E4OA 4OMHA 4KWDA 2ONGA 5IM1A 3N0FA 5AELA 1N22A 4NUAA 1HXGA 2J1PA 3LMDA 4JZBA 3LEEA 2ZCOA 4KVYA 3VJBA 5ILHA 3N46F 5DJRF 1WL3A 5AHUB 3AQ0A 4P0XA 4XQTF 5JA0F 4LPGF 2Z4XA 3M00A 3LLWA 3WCHA 2Q9ZA 1RQIA 2ZCRA 3RBMA 1YHKA 3WE9A 2Z4YA 4GA3A 1VG4A 3WCEA 3LJIA 1V4HA 1HM7A 4E9ZA 2Q9YA 3ICMA 5E8KA 1YYSA 1KIYA 1DGPA 5CG5A 2PS8A 2O1OA 3CKEA 3NPRA 4XQRF 5C05A 5HN8A 4LZ3A 5IL3A 2OPMA 1YYTA 2Z52A 3TFPA 3Q2ZA 4E1EA 1HX9A 1UBVA 5IK6A 4KK2A 4LLSA 1UBYA 5EAUA 3ACYA 3N3LF 5IKAA 3Q2QA 3OABA 3KB9A 4OKMA 2E92A 4NKFA 5B02A 1WL2A 1HXAA 4KQUA 3WJKA 4H5EF 2E93A 4LOBA 3TFNA 3WC9A 4DHDA 3KRPB 5JV1F 1V4KA 2F7MF 3ZMCA 3WCGA 3LZ9A 5ILKA 3P5PA 2Z4VA 3Q1OA 2E8UA 2H8OA 5ILJA 4F6VA 1DI1A 4LIXA 2OGDA 4L2XF 3EGTA 3S9VA 3WEIA 3ACWA 3EZ3A 2OA6A 3B7LA 4KFAA 2Z4ZA 3UCAA 3M0GA 2Z7IA 3MZVA 3AE0A 4LPHF 4LZCA 2ZEVA 3P5RA 4FP4A 3LGKA 3WSBA 3M01A 1YJ4A 3VJ9A 2E91A 3KBKA 5DGMF 5ERNA 1ZW5A 5AYPA 3KRCB 4XQSF 5AFXA 3W7FA 3KRAA 2ONHA 5CG6A 2AETA 2AELA 4OKZA 2E8TA 5IK9A 3KRFB 4KPDA 5ERMA 1HXCA 2QISA 1YV5A 2AZJA 2FORA 3LSNA 5DZ2A 3LDWA 3WEKA 5EASA 5ILYA 3VJDA 4MC3A 1UBXA 3ICKA 1RQJA 3ASXA 5E8HA 5HNAA 1KIZA 2E8XA 2AZLA 3TFVA 4LFVF 3APZA 1JFGA 2FTZA 5IL8A 5I1UA 5IMPA 3PH7A 4DEMF 2VF6A 3NF2A 5JV2F 1VG7A 3PKOA 4RXEA 5A0KA 3N45F 3WEGA 5B0MA 1N24A 3SDQA 2E94A 5DGSF 5B0LA 3Q30A 3LVSA 5DW7A 3ICNA 4EA0A 5E8LA 4KVWA 3WEHA 5IKHA 4KPJA 3KROB 3WCCA 3N1VF 4RNQA 2AEKA 2F8ZF 3RMGA 1HM4A 4JYXA 5DJPF 3EFQA 3RYWA 3G4DA 5HN9A 3WJOA 4JVJF 2J1OA 4DWGA 5ILDA 4LFGA 4OGUA 3DYHA 5DJVF 3MAVA 2Z4WA 4KKMA 5DHIA 3AQCB 2Z7HA 4NFJF 3N5JF 1N20A 5HN7A 4HD1A 1VG6A 2PS4A 4RXDA 4QXSF 1V4IA 3ACXA 2PS5A 3PYBA 3QQVA 4JXYA 2F8CF 3LG5A 3IPIA 2AZKA 4LLTA 1WL0A 3BNXA 3OACA 3IBAA 3LGZB 3WJNA 4GAXA 4RYPA 2F9KF 3CP6A 2PS7A 2ZY1A 4DZWA 3N49F 3N0GA 1V4EA 4GP2A 3ZMBA 2J5CA 3DYFA 4ZQ8A 5KSXF 3P8LA 3SDRA 3S4JA 1V4JA 3OABB 5B0JA 1N23A 4KQSA 2ZCQA 1WKZA 2RAHA 4LA5A 2OPNA 3N5HF 4H5CF 4NFKF 5IMNA 3OYRA 2Q80A 3SAEA 5DGNF 5H9DA 3ICZA 4LFEA 5B03A 3VJAA 2F94F 3LOMA 4KVDA 5B00A 4RXCA 3LK5A 4JXNA 5JUZF 1RTRA 1YHLA 3ZOUA 3WCLA 3WCBA 5DIQF 3PDEA 3WCFA 2EWGA 3V1XA 2P1CA 5IK0A 3TS7A 3NPKA 4NFIF 4FJQA 3WEJA 2E8WA 3NRIA 4NG6A 1WL1A 2DH4A 3KRAB 4WK5A 3WCJA 3WCIA 1FPSA 5B0IA 5B0KA 3TC1A 3N3DA 1EZFA 4F6XA 3P8RA 1N21A 1YYQA 4EA2A 4H5DF 3KRPA 5B01A 1YYUA 3SDTA 3SDVA 3WCAA 3ID0A 4LTVA 4LTZA 5IN8A 5ER8A 4P0VA 5A0JA 3ZL6A 4Q23A 4DWBA 4PVYF 4EA1A 3V66A 5IVGA 4N9UA 4DXJA 4N1ZF 4NKEA 5JV0F 3WCMA 4OMGA 5ILZA 3WEFA 5A0IA 1WY0A 3KRCA 3N1WF 1N1ZA 2F89F 5EATA 5EROA 1VG3A 3P41A 3ADZA 2ZEUA 3KRFA 4KQ5A 4LZ0A 1YHMA 3WSAA 3VJCA 3CC9A 3QKCA 1WMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GP1 A;  4LUU A;  3G4F A;  4JZX A;  1JFA A;  3AQB B;  5ILI A;  3N6K F;  2I19 A;  5DHK A;  4E9U A;  2PS6 A;  4KUX A;  3VJE A;  3PYA A;  3RYE A;  2Q58 A;  4MC0 A;  2E95 A;  1YYR A;  2Z78 A;  4LA6 A;  5IMI A;  4F62 A;  3VJ8 A;  4MC8 A;  3V1V A;  4RXA A;  2F92 F;  1YQ7 A;  3DYG A;  4KVI A;  1UBW A;  4UMJ A;  3ZCD A;  2ZCS A;  3OAC B;  4K10 A;  2E90 A;  4PVX F;  2Z50 A;  1N1B A;  4LXW A;  3SDU A;  4P0W A;  1PS1 A;  2E8V A;  4DI5 A;  3WCD A;  1VG2 A;  4QPF A;  3KRO A;  3M02 A;  3BNY A;  3M9U A;  2E4O A;  4OMH A;  4KWD A;  2ONG A;  5IM1 A;  3N0F A;  5AEL A;  1N22 A;  4NUA A;  1HXG A;  2J1P A;  3LMD A;  4JZB A;  3LEE A;  2ZCO A;  4KVY A;  3VJB A;  5ILH A;  3N46 F;  5DJR F;  1WL3 A;  5AHU B;  3AQ0 A;  4P0X A;  4XQT F;  5JA0 F;  4LPG F;  2Z4X A;  3M00 A;  3LLW A;  3WCH A;  2Q9Z A;  1RQI A;  2ZCR A;  3RBM A;  1YHK A;  3WE9 A;  2Z4Y A;  4GA3 A;  1VG4 A;  3WCE A;  3LJI A;  1V4H A;  1HM7 A;  4E9Z A;  2Q9Y A;  3ICM A;  5E8K A;  1YYS A;  1KIY A;  1DGP A;  5CG5 A;  2PS8 A;  2O1O A;  3CKE A;  3NPR A;  4XQR F;  5C05 A;  5HN8 A;  4LZ3 A;  5IL3 A;  2OPM A;  1YYT A;  2Z52 A;  3TFP A;  3Q2Z A;  4E1E A;  1HX9 A;  1UBV A;  5IK6 A;  4KK2 A;  4LLS A;  1UBY A;  5EAU A;  3ACY A;  3N3L F;  5IKA A;  3Q2Q A;  3OAB A;  3KB9 A;  4OKM A;  2E92 A;  4NKF A;  5B02 A;  1WL2 A;  1HXA A;  4KQU A;  3WJK A;  4H5E F;  2E93 A;  4LOB A;  3TFN A;  3WC9 A;  4DHD A;  3KRP B;  5JV1 F;  1V4K A;  2F7M F;  3ZMC A;  3WCG A;  3LZ9 A;  5ILK A;  3P5P A;  2Z4V A;  3Q1O A;  2E8U A;  2H8O A;  5ILJ A;  4F6V A;  1DI1 A;  4LIX A;  2OGD A;  4L2X F;  3EGT A;  3S9V A;  3WEI A;  3ACW A;  3EZ3 A;  2OA6 A;  3B7L A;  4KFA A;  2Z4Z A;  3UCA A;  3M0G A;  2Z7I A;  3MZV A;  3AE0 A;  4LPH F;  4LZC A;  2ZEV A;  3P5R A;  4FP4 A;  3LGK A;  3WSB A;  3M01 A;  1YJ4 A;  3VJ9 A;  2E91 A;  3KBK A;  5DGM F;  5ERN A;  1ZW5 A;  5AYP A;  3KRC B;  4XQS F;  5AFX A;  3W7F A;  3KRA A;  2ONH A;  5CG6 A;  2AET A;  2AEL A;  4OKZ A;  2E8T A;  5IK9 A;  3KRF B;  4KPD A;  5ERM A;  1HXC A;  2QIS A;  1YV5 A;  2AZJ A;  2FOR A;  3LSN A;  5DZ2 A;  3LDW A;  3WEK A;  5EAS A;  5ILY A;  3VJD A;  4MC3 A;  1UBX A;  3ICK A;  1RQJ A;  3ASX A;  5E8H A;  5HNA A;  1KIZ A;  2E8X A;  2AZL A;  3TFV A;  4LFV F;  3APZ A;  1JFG A;  2FTZ A;  5IL8 A;  5I1U A;  5IMP A;  3PH7 A;  4DEM F;  2VF6 A;  3NF2 A;  5JV2 F;  1VG7 A;  3PKO A;  4RXE A;  5A0K A;  3N45 F;  3WEG A;  5B0M A;  1N24 A;  3SDQ A;  2E94 A;  5DGS F;  5B0L A;  3Q30 A;  3LVS A;  5DW7 A;  3ICN A;  4EA0 A;  5E8L A;  4KVW A;  3WEH A;  5IKH A;  4KPJ A;  3KRO B;  3WCC A;  3N1V F;  4RNQ A;  2AEK A;  2F8Z F;  3RMG A;  1HM4 A;  4JYX A;  5DJP F;  3EFQ A;  3RYW A;  3G4D A;  5HN9 A;  3WJO A;  4JVJ F;  2J1O A;  4DWG A;  5ILD A;  4LFG A;  4OGU A;  3DYH A;  5DJV F;  3MAV A;  2Z4W A;  4KKM A;  5DHI A;  3AQC B;  2Z7H A;  4NFJ F;  3N5J F;  1N20 A;  5HN7 A;  4HD1 A;  1VG6 A;  2PS4 A;  4RXD A;  4QXS F;  1V4I A;  3ACX A;  2PS5 A;  3PYB A;  3QQV A;  4JXY A;  2F8C F;  3LG5 A;  3IPI A;  2AZK A;  4LLT A;  1WL0 A;  3BNX A;  3OAC A;  3IBA A;  3LGZ B;  3WJN A;  4GAX A;  4RYP A;  2F9K F;  3CP6 A;  2PS7 A;  2ZY1 A;  4DZW A;  3N49 F;  3N0G A;  1V4E A;  4GP2 A;  3ZMB A;  2J5C A;  3DYF A;  4ZQ8 A;  5KSX F;  3P8L A;  3SDR A;  3S4J A;  1V4J A;  3OAB B;  5B0J A;  1N23 A;  4KQS A;  2ZCQ A;  1WKZ A;  2RAH A;  4LA5 A;  2OPN A;  3N5H F;  4H5C F;  4NFK F;  5IMN A;  3OYR A;  2Q80 A;  3SAE A;  5DGN F;  5H9D A;  3ICZ A;  4LFE A;  5B03 A;  3VJA A;  2F94 F;  3LOM A;  4KVD A;  5B00 A;  4RXC A;  3LK5 A;  4JXN A;  5JUZ F;  1RTR A;  1YHL A;  3ZOU A;  3WCL A;  3WCB A;  5DIQ F;  3PDE A;  3WCF A;  2EWG A;  3V1X A;  2P1C A;  5IK0 A;  3TS7 A;  3NPK A;  4NFI F;  4FJQ A;  3WEJ A;  2E8W A;  3NRI A;  4NG6 A;  1WL1 A;  2DH4 A;  3KRA B;  4WK5 A;  3WCJ A;  3WCI A;  1FPS A;  5B0I A;  5B0K A;  3TC1 A;  3N3D A;  1EZF A;  4F6X A;  3P8R A;  1N21 A;  1YYQ A;  4EA2 A;  4H5D F;  3KRP A;  5B01 A;  1YYU A;  3SDT A;  3SDV A;  3WCA A;  3ID0 A;  4LTV A;  4LTZ A;  5IN8 A;  5ER8 A;  4P0V A;  5A0J A;  3ZL6 A;  4Q23 A;  4DWB A;  4PVY F;  4EA1 A;  3V66 A;  5IVG A;  4N9U A;  4DXJ A;  4N1Z F;  4NKE A;  5JV0 F;  3WCM A;  4OMG A;  5ILZ A;  3WEF A;  5A0I A;  1WY0 A;  3KRC A;  3N1W F;  1N1Z A;  2F89 F;  5EAT A;  5ERO A;  1VG3 A;  3P41 A;  3ADZ A;  2ZEU A;  3KRF A;  4KQ5 A;  4LZ0 A;  1YHM A;  3WSA A;  3VJC A;  3CC9 A;  3QKC A;  1WMW A; 
#chains in the Genus database with same CATH topology
 4GP1 A;  4LUU A;  3G4F A;  4JZX A;  1JFA A;  3AQB B;  5ILI A;  3N6K F;  2I19 A;  5DHK A;  4E9U A;  2PS6 A;  4KUX A;  3VJE A;  3PYA A;  3RYE A;  2Q58 A;  4MC0 A;  2E95 A;  1YYR A;  2Z78 A;  4LA6 A;  5IMI A;  4F62 A;  3VJ8 A;  4MC8 A;  3V1V A;  4RXA A;  2F92 F;  1YQ7 A;  3DYG A;  4KVI A;  1UBW A;  4UMJ A;  3ZCD A;  2ZCS A;  3OAC B;  4K10 A;  2E90 A;  4PVX F;  2Z50 A;  1N1B A;  4LXW A;  3SDU A;  4P0W A;  1PS1 A;  2E8V A;  4DI5 A;  3WCD A;  1VG2 A;  4QPF A;  3KRO A;  3M02 A;  3BNY A;  3M9U A;  2E4O A;  4OMH A;  4KWD A;  2ONG A;  5IM1 A;  3N0F A;  5AEL A;  1N22 A;  4NUA A;  1HXG A;  2J1P A;  3LMD A;  4JZB A;  3LEE A;  2ZCO A;  4KVY A;  3VJB A;  5ILH A;  3N46 F;  5DJR F;  1WL3 A;  5AHU B;  3AQ0 A;  4P0X A;  4XQT F;  5JA0 F;  4LPG F;  2Z4X A;  3M00 A;  3LLW A;  3WCH A;  2Q9Z A;  1RQI A;  2ZCR A;  3RBM A;  1YHK A;  3WE9 A;  2Z4Y A;  4GA3 A;  1VG4 A;  3WCE A;  3LJI A;  1V4H A;  1HM7 A;  4E9Z A;  2Q9Y A;  3ICM A;  5E8K A;  1YYS A;  1KIY A;  1DGP A;  5CG5 A;  2PS8 A;  2O1O A;  3CKE A;  3NPR A;  4XQR F;  5C05 A;  5HN8 A;  4LZ3 A;  5IL3 A;  2OPM A;  1YYT A;  2Z52 A;  3TFP A;  3Q2Z A;  4E1E A;  1HX9 A;  1UBV A;  5IK6 A;  4KK2 A;  4LLS A;  1UBY A;  5EAU A;  3ACY A;  3N3L F;  5IKA A;  3Q2Q A;  3OAB A;  3KB9 A;  4OKM A;  2E92 A;  4NKF A;  5B02 A;  1WL2 A;  1HXA A;  4KQU A;  3WJK A;  4H5E F;  2E93 A;  4LOB A;  3TFN A;  3WC9 A;  4DHD A;  3KRP B;  5JV1 F;  1V4K A;  2F7M F;  3ZMC A;  3WCG A;  3LZ9 A;  5ILK A;  3P5P A;  2Z4V A;  3Q1O A;  2E8U A;  2H8O A;  5ILJ A;  4F6V A;  1DI1 A;  4LIX A;  2OGD A;  4L2X F;  3EGT A;  3S9V A;  3WEI A;  3ACW A;  3EZ3 A;  2OA6 A;  3B7L A;  4KFA A;  2Z4Z A;  3UCA A;  3M0G A;  2Z7I A;  3MZV A;  3AE0 A;  4LPH F;  4LZC A;  2ZEV A;  3P5R A;  4FP4 A;  3LGK A;  3WSB A;  3M01 A;  1YJ4 A;  3VJ9 A;  2E91 A;  3KBK A;  5DGM F;  5ERN A;  1ZW5 A;  5AYP A;  3KRC B;  4XQS F;  5AFX A;  3W7F A;  3KRA A;  2ONH A;  5CG6 A;  2AET A;  2AEL A;  4OKZ A;  2E8T A;  5IK9 A;  3KRF B;  4KPD A;  5ERM A;  1HXC A;  2QIS A;  1YV5 A;  2AZJ A;  2FOR A;  3LSN A;  5DZ2 A;  3LDW A;  3WEK A;  5EAS A;  5ILY A;  3VJD A;  4MC3 A;  1UBX A;  3ICK A;  1RQJ A;  3ASX A;  5E8H A;  5HNA A;  1KIZ A;  2E8X A;  2AZL A;  3TFV A;  4LFV F;  3APZ A;  1JFG A;  2FTZ A;  5IL8 A;  5I1U A;  5IMP A;  3PH7 A;  4DEM F;  2VF6 A;  3NF2 A;  5JV2 F;  1VG7 A;  3PKO A;  4RXE A;  5A0K A;  3N45 F;  3WEG A;  5B0M A;  1N24 A;  3SDQ A;  2E94 A;  5DGS F;  5B0L A;  3Q30 A;  3LVS A;  5DW7 A;  3ICN A;  4EA0 A;  5E8L A;  4KVW A;  3WEH A;  5IKH A;  4KPJ A;  3KRO B;  3WCC A;  3N1V F;  4RNQ A;  2AEK A;  2F8Z F;  3RMG A;  1HM4 A;  4JYX A;  5DJP F;  3EFQ A;  3RYW A;  3G4D A;  5HN9 A;  3WJO A;  4JVJ F;  2J1O A;  4DWG A;  5ILD A;  4LFG A;  4OGU A;  3DYH A;  5DJV F;  3MAV A;  2Z4W A;  4KKM A;  5DHI A;  3AQC B;  2Z7H A;  4NFJ F;  3N5J F;  1N20 A;  5HN7 A;  4HD1 A;  1VG6 A;  2PS4 A;  4RXD A;  4QXS F;  1V4I A;  3ACX A;  2PS5 A;  3PYB A;  3QQV A;  4JXY A;  2F8C F;  3LG5 A;  3IPI A;  2AZK A;  4LLT A;  1WL0 A;  3BNX A;  3OAC A;  3IBA A;  3LGZ B;  3WJN A;  4GAX A;  4RYP A;  2F9K F;  3CP6 A;  2PS7 A;  2ZY1 A;  4DZW A;  3N49 F;  3N0G A;  1V4E A;  4GP2 A;  3ZMB A;  2J5C A;  3DYF A;  4ZQ8 A;  5KSX F;  3P8L A;  3SDR A;  3S4J A;  1V4J A;  3OAB B;  5B0J A;  1N23 A;  4KQS A;  2ZCQ A;  1WKZ A;  2RAH A;  4LA5 A;  2OPN A;  3N5H F;  4H5C F;  4NFK F;  5IMN A;  3OYR A;  2Q80 A;  3SAE A;  5DGN F;  5H9D A;  3ICZ A;  4LFE A;  5B03 A;  3VJA A;  2F94 F;  3LOM A;  4KVD A;  5B00 A;  4RXC A;  3LK5 A;  4JXN A;  5JUZ F;  1RTR A;  1YHL A;  3ZOU A;  3WCL A;  3WCB A;  5DIQ F;  3PDE A;  3WCF A;  2EWG A;  3V1X A;  2P1C A;  5IK0 A;  3TS7 A;  3NPK A;  4NFI F;  4FJQ A;  3WEJ A;  2E8W A;  3NRI A;  4NG6 A;  1WL1 A;  2DH4 A;  3KRA B;  4WK5 A;  3WCJ A;  3WCI A;  1FPS A;  5B0I A;  5B0K A;  3TC1 A;  3N3D A;  1EZF A;  4F6X A;  3P8R A;  1N21 A;  1YYQ A;  4EA2 A;  4H5D F;  3KRP A;  5B01 A;  1YYU A;  3SDT A;  3SDV A;  3WCA A;  3ID0 A;  4LTV A;  4LTZ A;  5IN8 A;  5ER8 A;  4P0V A;  5A0J A;  3ZL6 A;  4Q23 A;  4DWB A;  4PVY F;  4EA1 A;  3V66 A;  5IVG A;  4N9U A;  4DXJ A;  4N1Z F;  4NKE A;  5JV0 F;  3WCM A;  4OMG A;  5ILZ A;  3WEF A;  5A0I A;  1WY0 A;  3KRC A;  3N1W F;  1N1Z A;  2F89 F;  5EAT A;  5ERO A;  1VG3 A;  3P41 A;  3ADZ A;  2ZEU A;  3KRF A;  4KQ5 A;  4LZ0 A;  1YHM A;  3WSA A;  3VJC A;  3CC9 A;  3QKC A;  1WMW A; 
#chains in the Genus database with same CATH homology
 4GP1 A;  4LUU A;  3G4F A;  4JZX A;  1JFA A;  3AQB B;  5ILI A;  3N6K F;  2I19 A;  5DHK A;  4E9U A;  2PS6 A;  4KUX A;  3VJE A;  3PYA A;  3RYE A;  2Q58 A;  4MC0 A;  2E95 A;  1YYR A;  2Z78 A;  4LA6 A;  5IMI A;  4F62 A;  3VJ8 A;  4MC8 A;  3V1V A;  4RXA A;  2F92 F;  1YQ7 A;  3DYG A;  4KVI A;  1UBW A;  4UMJ A;  3ZCD A;  2ZCS A;  3OAC B;  4K10 A;  2E90 A;  4PVX F;  2Z50 A;  1N1B A;  4LXW A;  3SDU A;  4P0W A;  1PS1 A;  2E8V A;  4DI5 A;  3WCD A;  1VG2 A;  4QPF A;  3KRO A;  3M02 A;  3BNY A;  3M9U A;  2E4O A;  4OMH A;  4KWD A;  2ONG A;  5IM1 A;  3N0F A;  5AEL A;  1N22 A;  4NUA A;  1HXG A;  2J1P A;  3LMD A;  4JZB A;  3LEE A;  2ZCO A;  4KVY A;  3VJB A;  5ILH A;  3N46 F;  5DJR F;  1WL3 A;  5AHU B;  3AQ0 A;  4P0X A;  4XQT F;  5JA0 F;  4LPG F;  2Z4X A;  3M00 A;  3LLW A;  3WCH A;  2Q9Z A;  1RQI A;  2ZCR A;  3RBM A;  1YHK A;  3WE9 A;  2Z4Y A;  4GA3 A;  1VG4 A;  3WCE A;  3LJI A;  1V4H A;  1HM7 A;  4E9Z A;  2Q9Y A;  3ICM A;  5E8K A;  1YYS A;  1KIY A;  1DGP A;  5CG5 A;  2PS8 A;  2O1O A;  3CKE A;  3NPR A;  4XQR F;  5C05 A;  5HN8 A;  4LZ3 A;  5IL3 A;  2OPM A;  1YYT A;  2Z52 A;  3TFP A;  3Q2Z A;  4E1E A;  1HX9 A;  1UBV A;  5IK6 A;  4KK2 A;  4LLS A;  1UBY A;  5EAU A;  3ACY A;  3N3L F;  5IKA A;  3Q2Q A;  3OAB A;  3KB9 A;  4OKM A;  2E92 A;  4NKF A;  5B02 A;  1WL2 A;  1HXA A;  4KQU A;  3WJK A;  4H5E F;  2E93 A;  4LOB A;  3TFN A;  3WC9 A;  4DHD A;  3KRP B;  5JV1 F;  1V4K A;  2F7M F;  3ZMC A;  3WCG A;  3LZ9 A;  5ILK A;  3P5P A;  2Z4V A;  3Q1O A;  2E8U A;  2H8O A;  5ILJ A;  4F6V A;  1DI1 A;  4LIX A;  2OGD A;  4L2X F;  3EGT A;  3S9V A;  3WEI A;  3ACW A;  3EZ3 A;  2OA6 A;  3B7L A;  4KFA A;  2Z4Z A;  3UCA A;  3M0G A;  2Z7I A;  3MZV A;  3AE0 A;  4LPH F;  4LZC A;  2ZEV A;  3P5R A;  4FP4 A;  3LGK A;  3WSB A;  3M01 A;  1YJ4 A;  3VJ9 A;  2E91 A;  3KBK A;  5DGM F;  5ERN A;  1ZW5 A;  5AYP A;  3KRC B;  4XQS F;  5AFX A;  3W7F A;  3KRA A;  2ONH A;  5CG6 A;  2AET A;  2AEL A;  4OKZ A;  2E8T A;  5IK9 A;  3KRF B;  4KPD A;  5ERM A;  1HXC A;  2QIS A;  1YV5 A;  2AZJ A;  2FOR A;  3LSN A;  5DZ2 A;  3LDW A;  3WEK A;  5EAS A;  5ILY A;  3VJD A;  4MC3 A;  1UBX A;  3ICK A;  1RQJ A;  3ASX A;  5E8H A;  5HNA A;  1KIZ A;  2E8X A;  2AZL A;  3TFV A;  4LFV F;  3APZ A;  1JFG A;  2FTZ A;  5IL8 A;  5I1U A;  5IMP A;  3PH7 A;  4DEM F;  2VF6 A;  3NF2 A;  5JV2 F;  1VG7 A;  3PKO A;  4RXE A;  5A0K A;  3N45 F;  3WEG A;  5B0M A;  1N24 A;  3SDQ A;  2E94 A;  5DGS F;  5B0L A;  3Q30 A;  3LVS A;  5DW7 A;  3ICN A;  4EA0 A;  5E8L A;  4KVW A;  3WEH A;  5IKH A;  4KPJ A;  3KRO B;  3WCC A;  3N1V F;  4RNQ A;  2AEK A;  2F8Z F;  3RMG A;  1HM4 A;  4JYX A;  5DJP F;  3EFQ A;  3RYW A;  3G4D A;  5HN9 A;  3WJO A;  4JVJ F;  2J1O A;  4DWG A;  5ILD A;  4LFG A;  4OGU A;  3DYH A;  5DJV F;  3MAV A;  2Z4W A;  4KKM A;  5DHI A;  3AQC B;  2Z7H A;  4NFJ F;  3N5J F;  1N20 A;  5HN7 A;  4HD1 A;  1VG6 A;  2PS4 A;  4RXD A;  4QXS F;  1V4I A;  3ACX A;  2PS5 A;  3PYB A;  3QQV A;  4JXY A;  2F8C F;  3LG5 A;  3IPI A;  2AZK A;  4LLT A;  1WL0 A;  3BNX A;  3OAC A;  3IBA A;  3LGZ B;  3WJN A;  4GAX A;  4RYP A;  2F9K F;  3CP6 A;  2PS7 A;  2ZY1 A;  4DZW A;  3N49 F;  3N0G A;  1V4E A;  4GP2 A;  3ZMB A;  2J5C A;  3DYF A;  4ZQ8 A;  5KSX F;  3P8L A;  3SDR A;  3S4J A;  1V4J A;  3OAB B;  5B0J A;  1N23 A;  4KQS A;  2ZCQ A;  1WKZ A;  2RAH A;  4LA5 A;  2OPN A;  3N5H F;  4H5C F;  4NFK F;  5IMN A;  3OYR A;  2Q80 A;  3SAE A;  5DGN F;  5H9D A;  3ICZ A;  4LFE A;  5B03 A;  3VJA A;  2F94 F;  3LOM A;  4KVD A;  5B00 A;  4RXC A;  3LK5 A;  4JXN A;  5JUZ F;  1RTR A;  1YHL A;  3ZOU A;  3WCL A;  3WCB A;  5DIQ F;  3PDE A;  3WCF A;  2EWG A;  3V1X A;  2P1C A;  5IK0 A;  3TS7 A;  3NPK A;  4NFI F;  4FJQ A;  3WEJ A;  2E8W A;  3NRI A;  4NG6 A;  1WL1 A;  2DH4 A;  3KRA B;  4WK5 A;  3WCJ A;  3WCI A;  1FPS A;  5B0I A;  5B0K A;  3TC1 A;  3N3D A;  1EZF A;  4F6X A;  3P8R A;  1N21 A;  1YYQ A;  4EA2 A;  4H5D F;  3KRP A;  5B01 A;  1YYU A;  3SDT A;  3SDV A;  3WCA A;  3ID0 A;  4LTV A;  4LTZ A;  5IN8 A;  5ER8 A;  4P0V A;  5A0J A;  3ZL6 A;  4Q23 A;  4DWB A;  4PVY F;  4EA1 A;  3V66 A;  5IVG A;  4N9U A;  4DXJ A;  4N1Z F;  4NKE A;  5JV0 F;  3WCM A;  4OMG A;  5ILZ A;  3WEF A;  5A0I A;  1WY0 A;  3KRC A;  3N1W F;  1N1Z A;  2F89 F;  5EAT A;  5ERO A;  1VG3 A;  3P41 A;  3ADZ A;  2ZEU A;  3KRF A;  4KQ5 A;  4LZ0 A;  1YHM A;  3WSA A;  3VJC A;  3CC9 A;  3QKC A;  1WMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...