3TFNA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with bph-1183
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Dual dehydrosqualene/squalene synthase inhibitors: leads for innate immune system-based therapeutics.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 117
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3tfnA00
4MC0A 4LA5A 4OGUA 1RTRA 3NPRA 3TFNA 2Z78A 4GAXA 4NFJF 3KB9A 3P8LA 3N1VF 2Q58A 2ZEUA 4E9ZA 3VJCA 1N1ZA 2ZEVA 5ILZA 3WJNA 5DIQF 3KRFA 3SAEA 2Z7IA 3ACXA 3OACB 3S4JA 4DHDA 4OKMA 3WCBA 3M00A 1N1BA 4P0XA 5IL3A 3KRCB 3B7LA 1RQIA 3KBKA 3DYGA 3EFQA 3LVSA 3Q1OA 4H5DF 3ZMBA 2E90A 4OKZA 1YJ4A 1HXAA 3UCAA 2E93A 3APZA 1YYSA 4OMHA 4F6XA 3AE0A 5DGSF 4HD1A 4LZ0A 3AQBB 1WL2A 3N5HF 5IL8A 5ILIA 3S9VA 5IMIA 3VJBA 4KFAA 1WY0A 1PS1A 2PS4A 3EZ3A 3MZVA 3RYEA 3QKCA 4LLTA 2PS6A 2ZCSA 3SDVA 3LDWA 3N49F 3OABA 3G4DA 1JFGA 2F9KF 2I19A 5AYPA 1V4KA 5JV0F 1VG3A 4KQSA 3WCJA 3WCFA 3KROB 1WL3A 4LPGF 4Q23A 2F89F 2Z7HA 1JFAA 1WMWA 3ICMA 4LFGA 5B0JA 3WE9A 1YHLA 5HN8A 1N22A 2Z52A 3KRPA 4EA0A 3WEGA 3BNYA 5B0KA 2E8UA 2OGDA 4LA6A 5DJPF 5B0LA 4E1EA 5A0KA 5A0JA 5DHKA 5ERNA 4LXWA 3N6KF 4XQTF 3QQVA 3N5JF 1YV5A 4NG6A 3LMDA 3LLWA 5AFXA 5ILKA 3WJOA 3P41A 2RAHA 4DXJA 4KVYA 3PYAA 5DJRF 5ILDA 4E9UA 1DI1A 4KVIA 3Q30A 2Q9ZA 2ZCRA 3M02A 2F8CF 2FORA 5E8KA 4LIXA 1HM4A 4KUXA 3KRFB 5DW7A 2VF6A 2E4OA 4ZQ8A 1KIYA 3LGZB 1VG7A 3WEKA 3PYBA 4FJQA 1N24A 3ACYA 1EZFA 3LZ9A 4DWBA 4KKMA 3ACWA 4KQUA 1DGPA 3WCAA 3EGTA 3SDRA 3ZL6A 2P1CA 1UBVA 4GA3A 3WCHA 4RXAA 3ICZA 5ILYA 2Z50A 1RQJA 1FPSA 2EWGA 1V4JA 2AEKA 1YYQA 2ONGA 4KVDA 5B02A 3N0GA 5HNAA 4RYPA 5E8LA 3AQCB 3M01A 3TC1A 4H5CF 1V4EA 3PH7A 5IKHA 5EAUA 3OYRA 4OMGA 3ID0A 3IPIA 5C05A 5AELA 5IM1A 1YYUA 5B0IA 3OABB 4KVWA 1N21A 3CKEA 5IVGA 5IK0A 3LG5A 3W7FA 3WCGA 1YHMA 3P5PA 2E8WA 5JV1F 4KPDA 5IN8A 5JUZF 4KQ5A 4KK2A 4PVXF 3SDTA 1YHKA 3WCLA 3KRPB 2FTZA 2E8TA 4NFIF 1WL1A 5IMNA 4MC3A 4DZWA 2Q9YA 5B01A 3TS7A 1KIZA 2O1OA 5ER8A 3RYWA 4QXSF 3DYFA 5A0IA 5CG5A 1YYTA 5I1UA 2DH4A 2OA6A 4QPFA 4DI5A 4WK5A 4JYXA 5DHIA 3LGKA 3PKOA 3WCIA 5IK6A 2F92F 3PDEA 5JA0F 4LFEA 3MAVA 3WCDA 4F62A 2F8ZF 3AQ0A 3N3LF 4H5EF 4P0WA 4LZ3A 4GP1A 5IMPA 2Z4WA 1ZW5A 2J1PA 4KWDA 5IK9A 1VG6A 3RMGA 4DEMF 3P8RA 4F6VA 2AZKA 3CC9A 3N46F 2F94F 3WEHA 4PVYF 3TFPA 3N0FA 3NRIA 3KRAA 3RBMA 4JXYA 3N1WF 4RXDA 3WEIA 1V4IA 4LTVA 1HM7A 5IKAA 2OPNA 3WCMA 3VJ9A 3TFVA 4NKEA 2ONHA 2E91A 2Z4YA 2AELA 4RNQA 5H9DA 3SDUA 4NKFA 3NPKA 3N3DA 3WSAA 1N20A 5DZ2A 4NFKF 4JZXA 3VJDA 2E94A 3WEJA 3WSBA 4FP4A 4KPJA 3G4FA 4LTZA 1VG2A 3WCEA 3V66A 5EROA 3OACA 1YQ7A 3DYHA 3LSNA 4P0VA 4LLSA 3WCCA 1YYRA 3KRCA 2PS7A 2PS8A 4N1ZF 2AETA 4RXCA 3WC9A 3LJIA 3IBAA 2AZLA 5HN9A 4MC8A 3BNXA 5AHUB 4LOBA 4EA2A 2ZCOA 5ERMA 3VJEA 4XQRF 3VJAA 4K10A 5E8HA 2PS5A 3ICKA 4GP2A 4L2XF 4EA1A 5EASA 2Z4ZA 1WKZA 3LOMA 5B03A 5DGMF 3ZOUA 2E8VA 3N45F 1HXCA 2E8XA 5DGNF 4JXNA 2ZCQA 1N23A 3WJKA 4NUAA 1HX9A 2J5CA 3M9UA 3Q2QA 3SDQA 3V1XA 4N9UA 3ICNA 5JV2F 3Q2ZA 5B0MA 3WEFA 1UBXA 3KROA 4LFVF 4UMJA 1VG4A 2F7MF 2Z4XA 3LEEA 5HN7A 3P5RA 5ILHA 3ZMCA 3LK5A 3VJ8A 4XQSF 2Q80A 1WL0A 5EATA 2OPMA 3ADZA 4LUUA 2QISA 5DJVF 5CG6A 4DWGA 3V1VA 4RXEA 3NF2A 2E92A 1UBWA 3KRAB 2ZY1A 3ASXA 4LZCA 5ILJA 5B00A 2E95A 2H8OA 5KSXF 4JVJF 3M0GA 1HXGA 2Z4VA 4LPHF 2J1OA 3ZCDA 2AZJA 1UBYA 4JZBA 1V4HA 3CP6A
chains in the Genus database with same CATH superfamily
4MC0A 4LA5A 4OGUA 1RTRA 3NPRA 3TFNA 2Z78A 4GAXA 4NFJF 3KB9A 3P8LA 3N1VF 2Q58A 2ZEUA 4E9ZA 3VJCA 1N1ZA 2ZEVA 5ILZA 3WJNA 5DIQF 3KRFA 3SAEA 2Z7IA 3ACXA 3OACB 3S4JA 4DHDA 4OKMA 3WCBA 3M00A 1N1BA 4P0XA 5IL3A 3KRCB 3B7LA 1RQIA 3KBKA 3DYGA 3EFQA 3LVSA 3Q1OA 4H5DF 3ZMBA 2E90A 4OKZA 1YJ4A 1HXAA 3UCAA 2E93A 3APZA 1YYSA 4OMHA 4F6XA 3AE0A 5DGSF 4HD1A 4LZ0A 3AQBB 1WL2A 3N5HF 5IL8A 5ILIA 3S9VA 5IMIA 3VJBA 4KFAA 1WY0A 1PS1A 2PS4A 3EZ3A 3MZVA 3RYEA 3QKCA 4LLTA 2PS6A 2ZCSA 3SDVA 3LDWA 3N49F 3OABA 3G4DA 1JFGA 2F9KF 2I19A 5AYPA 1V4KA 5JV0F 1VG3A 4KQSA 3WCJA 3WCFA 3KROB 1WL3A 4LPGF 4Q23A 2F89F 2Z7HA 1JFAA 1WMWA 3ICMA 4LFGA 5B0JA 3WE9A 1YHLA 5HN8A 1N22A 2Z52A 3KRPA 4EA0A 3WEGA 3BNYA 5B0KA 2E8UA 2OGDA 4LA6A 5DJPF 5B0LA 4E1EA 5A0KA 5A0JA 5DHKA 5ERNA 4LXWA 3N6KF 4XQTF 3QQVA 3N5JF 1YV5A 4NG6A 3LMDA 3LLWA 5AFXA 5ILKA 3WJOA 3P41A 2RAHA 4DXJA 4KVYA 3PYAA 5DJRF 5ILDA 4E9UA 1DI1A 4KVIA 3Q30A 2Q9ZA 2ZCRA 3M02A 2F8CF 2FORA 5E8KA 4LIXA 1HM4A 4KUXA 3KRFB 5DW7A 2VF6A 2E4OA 4ZQ8A 1KIYA 3LGZB 1VG7A 3WEKA 3PYBA 4FJQA 1N24A 3ACYA 1EZFA 3LZ9A 4DWBA 4KKMA 3ACWA 4KQUA 1DGPA 3WCAA 3EGTA 3SDRA 3ZL6A 2P1CA 1UBVA 4GA3A 3WCHA 4RXAA 3ICZA 5ILYA 2Z50A 1RQJA 1FPSA 2EWGA 1V4JA 2AEKA 1YYQA 2ONGA 4KVDA 5B02A 3N0GA 5HNAA 4RYPA 5E8LA 3AQCB 3M01A 3TC1A 4H5CF 1V4EA 3PH7A 5IKHA 5EAUA 3OYRA 4OMGA 3ID0A 3IPIA 5C05A 5AELA 5IM1A 1YYUA 5B0IA 3OABB 4KVWA 1N21A 3CKEA 5IVGA 5IK0A 3LG5A 3W7FA 3WCGA 1YHMA 3P5PA 2E8WA 5JV1F 4KPDA 5IN8A 5JUZF 4KQ5A 4KK2A 4PVXF 3SDTA 1YHKA 3WCLA 3KRPB 2FTZA 2E8TA 4NFIF 1WL1A 5IMNA 4MC3A 4DZWA 2Q9YA 5B01A 3TS7A 1KIZA 2O1OA 5ER8A 3RYWA 4QXSF 3DYFA 5A0IA 5CG5A 1YYTA 5I1UA 2DH4A 2OA6A 4QPFA 4DI5A 4WK5A 4JYXA 5DHIA 3LGKA 3PKOA 3WCIA 5IK6A 2F92F 3PDEA 5JA0F 4LFEA 3MAVA 3WCDA 4F62A 2F8ZF 3AQ0A 3N3LF 4H5EF 4P0WA 4LZ3A 4GP1A 5IMPA 2Z4WA 1ZW5A 2J1PA 4KWDA 5IK9A 1VG6A 3RMGA 4DEMF 3P8RA 4F6VA 2AZKA 3CC9A 3N46F 2F94F 3WEHA 4PVYF 3TFPA 3N0FA 3NRIA 3KRAA 3RBMA 4JXYA 3N1WF 4RXDA 3WEIA 1V4IA 4LTVA 1HM7A 5IKAA 2OPNA 3WCMA 3VJ9A 3TFVA 4NKEA 2ONHA 2E91A 2Z4YA 2AELA 4RNQA 5H9DA 3SDUA 4NKFA 3NPKA 3N3DA 3WSAA 1N20A 5DZ2A 4NFKF 4JZXA 3VJDA 2E94A 3WEJA 3WSBA 4FP4A 4KPJA 3G4FA 4LTZA 1VG2A 3WCEA 3V66A 5EROA 3OACA 1YQ7A 3DYHA 3LSNA 4P0VA 4LLSA 3WCCA 1YYRA 3KRCA 2PS7A 2PS8A 4N1ZF 2AETA 4RXCA 3WC9A 3LJIA 3IBAA 2AZLA 5HN9A 4MC8A 3BNXA 5AHUB 4LOBA 4EA2A 2ZCOA 5ERMA 3VJEA 4XQRF 3VJAA 4K10A 5E8HA 2PS5A 3ICKA 4GP2A 4L2XF 4EA1A 5EASA 2Z4ZA 1WKZA 3LOMA 5B03A 5DGMF 3ZOUA 2E8VA 3N45F 1HXCA 2E8XA 5DGNF 4JXNA 2ZCQA 1N23A 3WJKA 4NUAA 1HX9A 2J5CA 3M9UA 3Q2QA 3SDQA 3V1XA 4N9UA 3ICNA 5JV2F 3Q2ZA 5B0MA 3WEFA 1UBXA 3KROA 4LFVF 4UMJA 1VG4A 2F7MF 2Z4XA 3LEEA 5HN7A 3P5RA 5ILHA 3ZMCA 3LK5A 3VJ8A 4XQSF 2Q80A 1WL0A 5EATA 2OPMA 3ADZA 4LUUA 2QISA 5DJVF 5CG6A 4DWGA 3V1VA 4RXEA 3NF2A 2E92A 1UBWA 3KRAB 2ZY1A 3ASXA 4LZCA 5ILJA 5B00A 2E95A 2H8OA 5KSXF 4JVJF 3M0GA 1HXGA 2Z4VA 4LPHF 2J1OA 3ZCDA 2AZJA 1UBYA 4JZBA 1V4HA 3CP6A
chains in the Genus database with same CATH topology
4MC0A 4LA5A 4OGUA 1RTRA 3NPRA 3TFNA 2Z78A 4GAXA 4NFJF 3KB9A 3P8LA 3N1VF 2Q58A 2ZEUA 4E9ZA 3VJCA 1N1ZA 2ZEVA 5ILZA 3WJNA 5DIQF 3KRFA 3SAEA 2Z7IA 3ACXA 3OACB 3S4JA 4DHDA 4OKMA 3WCBA 3M00A 1N1BA 4P0XA 5IL3A 3KRCB 3B7LA 1RQIA 3KBKA 3DYGA 3EFQA 3LVSA 3Q1OA 4H5DF 3ZMBA 2E90A 4OKZA 1YJ4A 1HXAA 3UCAA 2E93A 3APZA 1YYSA 4OMHA 4F6XA 3AE0A 5DGSF 4HD1A 4LZ0A 3AQBB 1WL2A 3N5HF 5IL8A 5ILIA 3S9VA 5IMIA 3VJBA 4KFAA 1WY0A 1PS1A 2PS4A 3EZ3A 3MZVA 3RYEA 3QKCA 4LLTA 2PS6A 2ZCSA 3SDVA 3LDWA 3N49F 3OABA 3G4DA 1JFGA 2F9KF 2I19A 5AYPA 1V4KA 5JV0F 1VG3A 4KQSA 3WCJA 3WCFA 3KROB 1WL3A 4LPGF 4Q23A 2F89F 2Z7HA 1JFAA 1WMWA 3ICMA 4LFGA 5B0JA 3WE9A 1YHLA 5HN8A 1N22A 2Z52A 3KRPA 4EA0A 3WEGA 3BNYA 5B0KA 2E8UA 2OGDA 4LA6A 5DJPF 5B0LA 4E1EA 5A0KA 5A0JA 5DHKA 5ERNA 4LXWA 3N6KF 4XQTF 3QQVA 3N5JF 1YV5A 4NG6A 3LMDA 3LLWA 5AFXA 5ILKA 3WJOA 3P41A 2RAHA 4DXJA 4KVYA 3PYAA 5DJRF 5ILDA 4E9UA 1DI1A 4KVIA 3Q30A 2Q9ZA 2ZCRA 3M02A 2F8CF 2FORA 5E8KA 4LIXA 1HM4A 4KUXA 3KRFB 5DW7A 2VF6A 2E4OA 4ZQ8A 1KIYA 3LGZB 1VG7A 3WEKA 3PYBA 4FJQA 1N24A 3ACYA 1EZFA 3LZ9A 4DWBA 4KKMA 3ACWA 4KQUA 1DGPA 3WCAA 3EGTA 3SDRA 3ZL6A 2P1CA 1UBVA 4GA3A 3WCHA 4RXAA 3ICZA 5ILYA 2Z50A 1RQJA 1FPSA 2EWGA 1V4JA 2AEKA 1YYQA 2ONGA 4KVDA 5B02A 3N0GA 5HNAA 4RYPA 5E8LA 3AQCB 3M01A 3TC1A 4H5CF 1V4EA 3PH7A 5IKHA 5EAUA 3OYRA 4OMGA 3ID0A 3IPIA 5C05A 5AELA 5IM1A 1YYUA 5B0IA 3OABB 4KVWA 1N21A 3CKEA 5IVGA 5IK0A 3LG5A 3W7FA 3WCGA 1YHMA 3P5PA 2E8WA 5JV1F 4KPDA 5IN8A 5JUZF 4KQ5A 4KK2A 4PVXF 3SDTA 1YHKA 3WCLA 3KRPB 2FTZA 2E8TA 4NFIF 1WL1A 5IMNA 4MC3A 4DZWA 2Q9YA 5B01A 3TS7A 1KIZA 2O1OA 5ER8A 3RYWA 4QXSF 3DYFA 5A0IA 5CG5A 1YYTA 5I1UA 2DH4A 2OA6A 4QPFA 4DI5A 4WK5A 4JYXA 5DHIA 3LGKA 3PKOA 3WCIA 5IK6A 2F92F 3PDEA 5JA0F 4LFEA 3MAVA 3WCDA 4F62A 2F8ZF 3AQ0A 3N3LF 4H5EF 4P0WA 4LZ3A 4GP1A 5IMPA 2Z4WA 1ZW5A 2J1PA 4KWDA 5IK9A 1VG6A 3RMGA 4DEMF 3P8RA 4F6VA 2AZKA 3CC9A 3N46F 2F94F 3WEHA 4PVYF 3TFPA 3N0FA 3NRIA 3KRAA 3RBMA 4JXYA 3N1WF 4RXDA 3WEIA 1V4IA 4LTVA 1HM7A 5IKAA 2OPNA 3WCMA 3VJ9A 3TFVA 4NKEA 2ONHA 2E91A 2Z4YA 2AELA 4RNQA 5H9DA 3SDUA 4NKFA 3NPKA 3N3DA 3WSAA 1N20A 5DZ2A 4NFKF 4JZXA 3VJDA 2E94A 3WEJA 3WSBA 4FP4A 4KPJA 3G4FA 4LTZA 1VG2A 3WCEA 3V66A 5EROA 3OACA 1YQ7A 3DYHA 3LSNA 4P0VA 4LLSA 3WCCA 1YYRA 3KRCA 2PS7A 2PS8A 4N1ZF 2AETA 4RXCA 3WC9A 3LJIA 3IBAA 2AZLA 5HN9A 4MC8A 3BNXA 5AHUB 4LOBA 4EA2A 2ZCOA 5ERMA 3VJEA 4XQRF 3VJAA 4K10A 5E8HA 2PS5A 3ICKA 4GP2A 4L2XF 4EA1A 5EASA 2Z4ZA 1WKZA 3LOMA 5B03A 5DGMF 3ZOUA 2E8VA 3N45F 1HXCA 2E8XA 5DGNF 4JXNA 2ZCQA 1N23A 3WJKA 4NUAA 1HX9A 2J5CA 3M9UA 3Q2QA 3SDQA 3V1XA 4N9UA 3ICNA 5JV2F 3Q2ZA 5B0MA 3WEFA 1UBXA 3KROA 4LFVF 4UMJA 1VG4A 2F7MF 2Z4XA 3LEEA 5HN7A 3P5RA 5ILHA 3ZMCA 3LK5A 3VJ8A 4XQSF 2Q80A 1WL0A 5EATA 2OPMA 3ADZA 4LUUA 2QISA 5DJVF 5CG6A 4DWGA 3V1VA 4RXEA 3NF2A 2E92A 1UBWA 3KRAB 2ZY1A 3ASXA 4LZCA 5ILJA 5B00A 2E95A 2H8OA 5KSXF 4JVJF 3M0GA 1HXGA 2Z4VA 4LPHF 2J1OA 3ZCDA 2AZJA 1UBYA 4JZBA 1V4HA 3CP6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MC0 A;  4LA5 A;  4OGU A;  1RTR A;  3NPR A;  3TFN A;  2Z78 A;  4GAX A;  4NFJ F;  3KB9 A;  3P8L A;  3N1V F;  2Q58 A;  2ZEU A;  4E9Z A;  3VJC A;  1N1Z A;  2ZEV A;  5ILZ A;  3WJN A;  5DIQ F;  3KRF A;  3SAE A;  2Z7I A;  3ACX A;  3OAC B;  3S4J A;  4DHD A;  4OKM A;  3WCB A;  3M00 A;  1N1B A;  4P0X A;  5IL3 A;  3KRC B;  3B7L A;  1RQI A;  3KBK A;  3DYG A;  3EFQ A;  3LVS A;  3Q1O A;  4H5D F;  3ZMB A;  2E90 A;  4OKZ A;  1YJ4 A;  1HXA A;  3UCA A;  2E93 A;  3APZ A;  1YYS A;  4OMH A;  4F6X A;  3AE0 A;  5DGS F;  4HD1 A;  4LZ0 A;  3AQB B;  1WL2 A;  3N5H F;  5IL8 A;  5ILI A;  3S9V A;  5IMI A;  3VJB A;  4KFA A;  1WY0 A;  1PS1 A;  2PS4 A;  3EZ3 A;  3MZV A;  3RYE A;  3QKC A;  4LLT A;  2PS6 A;  2ZCS A;  3SDV A;  3LDW A;  3N49 F;  3OAB A;  3G4D A;  1JFG A;  2F9K F;  2I19 A;  5AYP A;  1V4K A;  5JV0 F;  1VG3 A;  4KQS A;  3WCJ A;  3WCF A;  3KRO B;  1WL3 A;  4LPG F;  4Q23 A;  2F89 F;  2Z7H A;  1JFA A;  1WMW A;  3ICM A;  4LFG A;  5B0J A;  3WE9 A;  1YHL A;  5HN8 A;  1N22 A;  2Z52 A;  3KRP A;  4EA0 A;  3WEG A;  3BNY A;  5B0K A;  2E8U A;  2OGD A;  4LA6 A;  5DJP F;  5B0L A;  4E1E A;  5A0K A;  5A0J A;  5DHK A;  5ERN A;  4LXW A;  3N6K F;  4XQT F;  3QQV A;  3N5J F;  1YV5 A;  4NG6 A;  3LMD A;  3LLW A;  5AFX A;  5ILK A;  3WJO A;  3P41 A;  2RAH A;  4DXJ A;  4KVY A;  3PYA A;  5DJR F;  5ILD A;  4E9U A;  1DI1 A;  4KVI A;  3Q30 A;  2Q9Z A;  2ZCR A;  3M02 A;  2F8C F;  2FOR A;  5E8K A;  4LIX A;  1HM4 A;  4KUX A;  3KRF B;  5DW7 A;  2VF6 A;  2E4O A;  4ZQ8 A;  1KIY A;  3LGZ B;  1VG7 A;  3WEK A;  3PYB A;  4FJQ A;  1N24 A;  3ACY A;  1EZF A;  3LZ9 A;  4DWB A;  4KKM A;  3ACW A;  4KQU A;  1DGP A;  3WCA A;  3EGT A;  3SDR A;  3ZL6 A;  2P1C A;  1UBV A;  4GA3 A;  3WCH A;  4RXA A;  3ICZ A;  5ILY A;  2Z50 A;  1RQJ A;  1FPS A;  2EWG A;  1V4J A;  2AEK A;  1YYQ A;  2ONG A;  4KVD A;  5B02 A;  3N0G A;  5HNA A;  4RYP A;  5E8L A;  3AQC B;  3M01 A;  3TC1 A;  4H5C F;  1V4E A;  3PH7 A;  5IKH A;  5EAU A;  3OYR A;  4OMG A;  3ID0 A;  3IPI A;  5C05 A;  5AEL A;  5IM1 A;  1YYU A;  5B0I A;  3OAB B;  4KVW A;  1N21 A;  3CKE A;  5IVG A;  5IK0 A;  3LG5 A;  3W7F A;  3WCG A;  1YHM A;  3P5P A;  2E8W A;  5JV1 F;  4KPD A;  5IN8 A;  5JUZ F;  4KQ5 A;  4KK2 A;  4PVX F;  3SDT A;  1YHK A;  3WCL A;  3KRP B;  2FTZ A;  2E8T A;  4NFI F;  1WL1 A;  5IMN A;  4MC3 A;  4DZW A;  2Q9Y A;  5B01 A;  3TS7 A;  1KIZ A;  2O1O A;  5ER8 A;  3RYW A;  4QXS F;  3DYF A;  5A0I A;  5CG5 A;  1YYT A;  5I1U A;  2DH4 A;  2OA6 A;  4QPF A;  4DI5 A;  4WK5 A;  4JYX A;  5DHI A;  3LGK A;  3PKO A;  3WCI A;  5IK6 A;  2F92 F;  3PDE A;  5JA0 F;  4LFE A;  3MAV A;  3WCD A;  4F62 A;  2F8Z F;  3AQ0 A;  3N3L F;  4H5E F;  4P0W A;  4LZ3 A;  4GP1 A;  5IMP A;  2Z4W A;  1ZW5 A;  2J1P A;  4KWD A;  5IK9 A;  1VG6 A;  3RMG A;  4DEM F;  3P8R A;  4F6V A;  2AZK A;  3CC9 A;  3N46 F;  2F94 F;  3WEH A;  4PVY F;  3TFP A;  3N0F A;  3NRI A;  3KRA A;  3RBM A;  4JXY A;  3N1W F;  4RXD A;  3WEI A;  1V4I A;  4LTV A;  1HM7 A;  5IKA A;  2OPN A;  3WCM A;  3VJ9 A;  3TFV A;  4NKE A;  2ONH A;  2E91 A;  2Z4Y A;  2AEL A;  4RNQ A;  5H9D A;  3SDU A;  4NKF A;  3NPK A;  3N3D A;  3WSA A;  1N20 A;  5DZ2 A;  4NFK F;  4JZX A;  3VJD A;  2E94 A;  3WEJ A;  3WSB A;  4FP4 A;  4KPJ A;  3G4F A;  4LTZ A;  1VG2 A;  3WCE A;  3V66 A;  5ERO A;  3OAC A;  1YQ7 A;  3DYH A;  3LSN A;  4P0V A;  4LLS A;  3WCC A;  1YYR A;  3KRC A;  2PS7 A;  2PS8 A;  4N1Z F;  2AET A;  4RXC A;  3WC9 A;  3LJI A;  3IBA A;  2AZL A;  5HN9 A;  4MC8 A;  3BNX A;  5AHU B;  4LOB A;  4EA2 A;  2ZCO A;  5ERM A;  3VJE A;  4XQR F;  3VJA A;  4K10 A;  5E8H A;  2PS5 A;  3ICK A;  4GP2 A;  4L2X F;  4EA1 A;  5EAS A;  2Z4Z A;  1WKZ A;  3LOM A;  5B03 A;  5DGM F;  3ZOU A;  2E8V A;  3N45 F;  1HXC A;  2E8X A;  5DGN F;  4JXN A;  2ZCQ A;  1N23 A;  3WJK A;  4NUA A;  1HX9 A;  2J5C A;  3M9U A;  3Q2Q A;  3SDQ A;  3V1X A;  4N9U A;  3ICN A;  5JV2 F;  3Q2Z A;  5B0M A;  3WEF A;  1UBX A;  3KRO A;  4LFV F;  4UMJ A;  1VG4 A;  2F7M F;  2Z4X A;  3LEE A;  5HN7 A;  3P5R A;  5ILH A;  3ZMC A;  3LK5 A;  3VJ8 A;  4XQS F;  2Q80 A;  1WL0 A;  5EAT A;  2OPM A;  3ADZ A;  4LUU A;  2QIS A;  5DJV F;  5CG6 A;  4DWG A;  3V1V A;  4RXE A;  3NF2 A;  2E92 A;  1UBW A;  3KRA B;  2ZY1 A;  3ASX A;  4LZC A;  5ILJ A;  5B00 A;  2E95 A;  2H8O A;  5KSX F;  4JVJ F;  3M0G A;  1HXG A;  2Z4V A;  4LPH F;  2J1O A;  3ZCD A;  2AZJ A;  1UBY A;  4JZB A;  1V4H A;  3CP6 A; 
#chains in the Genus database with same CATH topology
 4MC0 A;  4LA5 A;  4OGU A;  1RTR A;  3NPR A;  3TFN A;  2Z78 A;  4GAX A;  4NFJ F;  3KB9 A;  3P8L A;  3N1V F;  2Q58 A;  2ZEU A;  4E9Z A;  3VJC A;  1N1Z A;  2ZEV A;  5ILZ A;  3WJN A;  5DIQ F;  3KRF A;  3SAE A;  2Z7I A;  3ACX A;  3OAC B;  3S4J A;  4DHD A;  4OKM A;  3WCB A;  3M00 A;  1N1B A;  4P0X A;  5IL3 A;  3KRC B;  3B7L A;  1RQI A;  3KBK A;  3DYG A;  3EFQ A;  3LVS A;  3Q1O A;  4H5D F;  3ZMB A;  2E90 A;  4OKZ A;  1YJ4 A;  1HXA A;  3UCA A;  2E93 A;  3APZ A;  1YYS A;  4OMH A;  4F6X A;  3AE0 A;  5DGS F;  4HD1 A;  4LZ0 A;  3AQB B;  1WL2 A;  3N5H F;  5IL8 A;  5ILI A;  3S9V A;  5IMI A;  3VJB A;  4KFA A;  1WY0 A;  1PS1 A;  2PS4 A;  3EZ3 A;  3MZV A;  3RYE A;  3QKC A;  4LLT A;  2PS6 A;  2ZCS A;  3SDV A;  3LDW A;  3N49 F;  3OAB A;  3G4D A;  1JFG A;  2F9K F;  2I19 A;  5AYP A;  1V4K A;  5JV0 F;  1VG3 A;  4KQS A;  3WCJ A;  3WCF A;  3KRO B;  1WL3 A;  4LPG F;  4Q23 A;  2F89 F;  2Z7H A;  1JFA A;  1WMW A;  3ICM A;  4LFG A;  5B0J A;  3WE9 A;  1YHL A;  5HN8 A;  1N22 A;  2Z52 A;  3KRP A;  4EA0 A;  3WEG A;  3BNY A;  5B0K A;  2E8U A;  2OGD A;  4LA6 A;  5DJP F;  5B0L A;  4E1E A;  5A0K A;  5A0J A;  5DHK A;  5ERN A;  4LXW A;  3N6K F;  4XQT F;  3QQV A;  3N5J F;  1YV5 A;  4NG6 A;  3LMD A;  3LLW A;  5AFX A;  5ILK A;  3WJO A;  3P41 A;  2RAH A;  4DXJ A;  4KVY A;  3PYA A;  5DJR F;  5ILD A;  4E9U A;  1DI1 A;  4KVI A;  3Q30 A;  2Q9Z A;  2ZCR A;  3M02 A;  2F8C F;  2FOR A;  5E8K A;  4LIX A;  1HM4 A;  4KUX A;  3KRF B;  5DW7 A;  2VF6 A;  2E4O A;  4ZQ8 A;  1KIY A;  3LGZ B;  1VG7 A;  3WEK A;  3PYB A;  4FJQ A;  1N24 A;  3ACY A;  1EZF A;  3LZ9 A;  4DWB A;  4KKM A;  3ACW A;  4KQU A;  1DGP A;  3WCA A;  3EGT A;  3SDR A;  3ZL6 A;  2P1C A;  1UBV A;  4GA3 A;  3WCH A;  4RXA A;  3ICZ A;  5ILY A;  2Z50 A;  1RQJ A;  1FPS A;  2EWG A;  1V4J A;  2AEK A;  1YYQ A;  2ONG A;  4KVD A;  5B02 A;  3N0G A;  5HNA A;  4RYP A;  5E8L A;  3AQC B;  3M01 A;  3TC1 A;  4H5C F;  1V4E A;  3PH7 A;  5IKH A;  5EAU A;  3OYR A;  4OMG A;  3ID0 A;  3IPI A;  5C05 A;  5AEL A;  5IM1 A;  1YYU A;  5B0I A;  3OAB B;  4KVW A;  1N21 A;  3CKE A;  5IVG A;  5IK0 A;  3LG5 A;  3W7F A;  3WCG A;  1YHM A;  3P5P A;  2E8W A;  5JV1 F;  4KPD A;  5IN8 A;  5JUZ F;  4KQ5 A;  4KK2 A;  4PVX F;  3SDT A;  1YHK A;  3WCL A;  3KRP B;  2FTZ A;  2E8T A;  4NFI F;  1WL1 A;  5IMN A;  4MC3 A;  4DZW A;  2Q9Y A;  5B01 A;  3TS7 A;  1KIZ A;  2O1O A;  5ER8 A;  3RYW A;  4QXS F;  3DYF A;  5A0I A;  5CG5 A;  1YYT A;  5I1U A;  2DH4 A;  2OA6 A;  4QPF A;  4DI5 A;  4WK5 A;  4JYX A;  5DHI A;  3LGK A;  3PKO A;  3WCI A;  5IK6 A;  2F92 F;  3PDE A;  5JA0 F;  4LFE A;  3MAV A;  3WCD A;  4F62 A;  2F8Z F;  3AQ0 A;  3N3L F;  4H5E F;  4P0W A;  4LZ3 A;  4GP1 A;  5IMP A;  2Z4W A;  1ZW5 A;  2J1P A;  4KWD A;  5IK9 A;  1VG6 A;  3RMG A;  4DEM F;  3P8R A;  4F6V A;  2AZK A;  3CC9 A;  3N46 F;  2F94 F;  3WEH A;  4PVY F;  3TFP A;  3N0F A;  3NRI A;  3KRA A;  3RBM A;  4JXY A;  3N1W F;  4RXD A;  3WEI A;  1V4I A;  4LTV A;  1HM7 A;  5IKA A;  2OPN A;  3WCM A;  3VJ9 A;  3TFV A;  4NKE A;  2ONH A;  2E91 A;  2Z4Y A;  2AEL A;  4RNQ A;  5H9D A;  3SDU A;  4NKF A;  3NPK A;  3N3D A;  3WSA A;  1N20 A;  5DZ2 A;  4NFK F;  4JZX A;  3VJD A;  2E94 A;  3WEJ A;  3WSB A;  4FP4 A;  4KPJ A;  3G4F A;  4LTZ A;  1VG2 A;  3WCE A;  3V66 A;  5ERO A;  3OAC A;  1YQ7 A;  3DYH A;  3LSN A;  4P0V A;  4LLS A;  3WCC A;  1YYR A;  3KRC A;  2PS7 A;  2PS8 A;  4N1Z F;  2AET A;  4RXC A;  3WC9 A;  3LJI A;  3IBA A;  2AZL A;  5HN9 A;  4MC8 A;  3BNX A;  5AHU B;  4LOB A;  4EA2 A;  2ZCO A;  5ERM A;  3VJE A;  4XQR F;  3VJA A;  4K10 A;  5E8H A;  2PS5 A;  3ICK A;  4GP2 A;  4L2X F;  4EA1 A;  5EAS A;  2Z4Z A;  1WKZ A;  3LOM A;  5B03 A;  5DGM F;  3ZOU A;  2E8V A;  3N45 F;  1HXC A;  2E8X A;  5DGN F;  4JXN A;  2ZCQ A;  1N23 A;  3WJK A;  4NUA A;  1HX9 A;  2J5C A;  3M9U A;  3Q2Q A;  3SDQ A;  3V1X A;  4N9U A;  3ICN A;  5JV2 F;  3Q2Z A;  5B0M A;  3WEF A;  1UBX A;  3KRO A;  4LFV F;  4UMJ A;  1VG4 A;  2F7M F;  2Z4X A;  3LEE A;  5HN7 A;  3P5R A;  5ILH A;  3ZMC A;  3LK5 A;  3VJ8 A;  4XQS F;  2Q80 A;  1WL0 A;  5EAT A;  2OPM A;  3ADZ A;  4LUU A;  2QIS A;  5DJV F;  5CG6 A;  4DWG A;  3V1V A;  4RXE A;  3NF2 A;  2E92 A;  1UBW A;  3KRA B;  2ZY1 A;  3ASX A;  4LZC A;  5ILJ A;  5B00 A;  2E95 A;  2H8O A;  5KSX F;  4JVJ F;  3M0G A;  1HXG A;  2Z4V A;  4LPH F;  2J1O A;  3ZCD A;  2AZJ A;  1UBY A;  4JZB A;  1V4H A;  3CP6 A; 
#chains in the Genus database with same CATH homology
 4MC0 A;  4LA5 A;  4OGU A;  1RTR A;  3NPR A;  3TFN A;  2Z78 A;  4GAX A;  4NFJ F;  3KB9 A;  3P8L A;  3N1V F;  2Q58 A;  2ZEU A;  4E9Z A;  3VJC A;  1N1Z A;  2ZEV A;  5ILZ A;  3WJN A;  5DIQ F;  3KRF A;  3SAE A;  2Z7I A;  3ACX A;  3OAC B;  3S4J A;  4DHD A;  4OKM A;  3WCB A;  3M00 A;  1N1B A;  4P0X A;  5IL3 A;  3KRC B;  3B7L A;  1RQI A;  3KBK A;  3DYG A;  3EFQ A;  3LVS A;  3Q1O A;  4H5D F;  3ZMB A;  2E90 A;  4OKZ A;  1YJ4 A;  1HXA A;  3UCA A;  2E93 A;  3APZ A;  1YYS A;  4OMH A;  4F6X A;  3AE0 A;  5DGS F;  4HD1 A;  4LZ0 A;  3AQB B;  1WL2 A;  3N5H F;  5IL8 A;  5ILI A;  3S9V A;  5IMI A;  3VJB A;  4KFA A;  1WY0 A;  1PS1 A;  2PS4 A;  3EZ3 A;  3MZV A;  3RYE A;  3QKC A;  4LLT A;  2PS6 A;  2ZCS A;  3SDV A;  3LDW A;  3N49 F;  3OAB A;  3G4D A;  1JFG A;  2F9K F;  2I19 A;  5AYP A;  1V4K A;  5JV0 F;  1VG3 A;  4KQS A;  3WCJ A;  3WCF A;  3KRO B;  1WL3 A;  4LPG F;  4Q23 A;  2F89 F;  2Z7H A;  1JFA A;  1WMW A;  3ICM A;  4LFG A;  5B0J A;  3WE9 A;  1YHL A;  5HN8 A;  1N22 A;  2Z52 A;  3KRP A;  4EA0 A;  3WEG A;  3BNY A;  5B0K A;  2E8U A;  2OGD A;  4LA6 A;  5DJP F;  5B0L A;  4E1E A;  5A0K A;  5A0J A;  5DHK A;  5ERN A;  4LXW A;  3N6K F;  4XQT F;  3QQV A;  3N5J F;  1YV5 A;  4NG6 A;  3LMD A;  3LLW A;  5AFX A;  5ILK A;  3WJO A;  3P41 A;  2RAH A;  4DXJ A;  4KVY A;  3PYA A;  5DJR F;  5ILD A;  4E9U A;  1DI1 A;  4KVI A;  3Q30 A;  2Q9Z A;  2ZCR A;  3M02 A;  2F8C F;  2FOR A;  5E8K A;  4LIX A;  1HM4 A;  4KUX A;  3KRF B;  5DW7 A;  2VF6 A;  2E4O A;  4ZQ8 A;  1KIY A;  3LGZ B;  1VG7 A;  3WEK A;  3PYB A;  4FJQ A;  1N24 A;  3ACY A;  1EZF A;  3LZ9 A;  4DWB A;  4KKM A;  3ACW A;  4KQU A;  1DGP A;  3WCA A;  3EGT A;  3SDR A;  3ZL6 A;  2P1C A;  1UBV A;  4GA3 A;  3WCH A;  4RXA A;  3ICZ A;  5ILY A;  2Z50 A;  1RQJ A;  1FPS A;  2EWG A;  1V4J A;  2AEK A;  1YYQ A;  2ONG A;  4KVD A;  5B02 A;  3N0G A;  5HNA A;  4RYP A;  5E8L A;  3AQC B;  3M01 A;  3TC1 A;  4H5C F;  1V4E A;  3PH7 A;  5IKH A;  5EAU A;  3OYR A;  4OMG A;  3ID0 A;  3IPI A;  5C05 A;  5AEL A;  5IM1 A;  1YYU A;  5B0I A;  3OAB B;  4KVW A;  1N21 A;  3CKE A;  5IVG A;  5IK0 A;  3LG5 A;  3W7F A;  3WCG A;  1YHM A;  3P5P A;  2E8W A;  5JV1 F;  4KPD A;  5IN8 A;  5JUZ F;  4KQ5 A;  4KK2 A;  4PVX F;  3SDT A;  1YHK A;  3WCL A;  3KRP B;  2FTZ A;  2E8T A;  4NFI F;  1WL1 A;  5IMN A;  4MC3 A;  4DZW A;  2Q9Y A;  5B01 A;  3TS7 A;  1KIZ A;  2O1O A;  5ER8 A;  3RYW A;  4QXS F;  3DYF A;  5A0I A;  5CG5 A;  1YYT A;  5I1U A;  2DH4 A;  2OA6 A;  4QPF A;  4DI5 A;  4WK5 A;  4JYX A;  5DHI A;  3LGK A;  3PKO A;  3WCI A;  5IK6 A;  2F92 F;  3PDE A;  5JA0 F;  4LFE A;  3MAV A;  3WCD A;  4F62 A;  2F8Z F;  3AQ0 A;  3N3L F;  4H5E F;  4P0W A;  4LZ3 A;  4GP1 A;  5IMP A;  2Z4W A;  1ZW5 A;  2J1P A;  4KWD A;  5IK9 A;  1VG6 A;  3RMG A;  4DEM F;  3P8R A;  4F6V A;  2AZK A;  3CC9 A;  3N46 F;  2F94 F;  3WEH A;  4PVY F;  3TFP A;  3N0F A;  3NRI A;  3KRA A;  3RBM A;  4JXY A;  3N1W F;  4RXD A;  3WEI A;  1V4I A;  4LTV A;  1HM7 A;  5IKA A;  2OPN A;  3WCM A;  3VJ9 A;  3TFV A;  4NKE A;  2ONH A;  2E91 A;  2Z4Y A;  2AEL A;  4RNQ A;  5H9D A;  3SDU A;  4NKF A;  3NPK A;  3N3D A;  3WSA A;  1N20 A;  5DZ2 A;  4NFK F;  4JZX A;  3VJD A;  2E94 A;  3WEJ A;  3WSB A;  4FP4 A;  4KPJ A;  3G4F A;  4LTZ A;  1VG2 A;  3WCE A;  3V66 A;  5ERO A;  3OAC A;  1YQ7 A;  3DYH A;  3LSN A;  4P0V A;  4LLS A;  3WCC A;  1YYR A;  3KRC A;  2PS7 A;  2PS8 A;  4N1Z F;  2AET A;  4RXC A;  3WC9 A;  3LJI A;  3IBA A;  2AZL A;  5HN9 A;  4MC8 A;  3BNX A;  5AHU B;  4LOB A;  4EA2 A;  2ZCO A;  5ERM A;  3VJE A;  4XQR F;  3VJA A;  4K10 A;  5E8H A;  2PS5 A;  3ICK A;  4GP2 A;  4L2X F;  4EA1 A;  5EAS A;  2Z4Z A;  1WKZ A;  3LOM A;  5B03 A;  5DGM F;  3ZOU A;  2E8V A;  3N45 F;  1HXC A;  2E8X A;  5DGN F;  4JXN A;  2ZCQ A;  1N23 A;  3WJK A;  4NUA A;  1HX9 A;  2J5C A;  3M9U A;  3Q2Q A;  3SDQ A;  3V1X A;  4N9U A;  3ICN A;  5JV2 F;  3Q2Z A;  5B0M A;  3WEF A;  1UBX A;  3KRO A;  4LFV F;  4UMJ A;  1VG4 A;  2F7M F;  2Z4X A;  3LEE A;  5HN7 A;  3P5R A;  5ILH A;  3ZMC A;  3LK5 A;  3VJ8 A;  4XQS F;  2Q80 A;  1WL0 A;  5EAT A;  2OPM A;  3ADZ A;  4LUU A;  2QIS A;  5DJV F;  5CG6 A;  4DWG A;  3V1V A;  4RXE A;  3NF2 A;  2E92 A;  1UBW A;  3KRA B;  2ZY1 A;  3ASX A;  4LZC A;  5ILJ A;  5B00 A;  2E95 A;  2H8O A;  5KSX F;  4JVJ F;  3M0G A;  1HXG A;  2Z4V A;  4LPH F;  2J1O A;  3ZCD A;  2AZJ A;  1UBY A;  4JZB A;  1V4H A;  3CP6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...