3NPRA

Crystal structure of the c(30) carotenoid dehydrosqualene synthase from s. aureus complexed with presqualene diphosphate (pspp)
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Dehydrosqualene synthase
publication title Mechanism of action and inhibition of dehydrosqualene synthase.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 114
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2010-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3nprA00
3ICKA 3TC1A 3G4DA 5JV0F 4P0VA 5ERMA 3WEHA 2E92A 5IMIA 2Q9ZA 3QQVA 4RXEA 3KROB 4H5DF 4LTZA 4LZ0A 3LGKA 3WCHA 5B0KA 2ZEVA 3KB9A 2E91A 5E8HA 3QKCA 3IPIA 5B00A 3PKOA 4OKMA 3P5RA 5DIQF 1EZFA 5CG6A 5IK0A 1YYUA 3OACA 3KRPB 5ILKA 3RYEA 1V4HA 3ICMA 3ZL6A 4RYPA 5HN9A 3LG5A 2E8WA 1WL2A 3BNYA 4FJQA 3NPRA 1HXCA 3S4JA 5DJPF 3LK5A 4JZXA 3G4FA 1UBXA 1JFAA 2E8VA 1HM4A 1UBVA 4Q23A 3N6KF 5A0KA 4MC3A 3RMGA 1YYQA 4LPGF 3SDRA 1DGPA 5H9DA 4LXWA 1N1ZA 3EZ3A 3EGTA 3ID0A 3LVSA 3V1VA 4DWBA 4KK2A 3PH7A 3ZCDA 3ACXA 2O1OA 2Z4ZA 3IBAA 1YQ7A 4LLSA 5JUZF 3VJ9A 4KVIA 4KUXA 4QXSF 3AE0A 3NF2A 2Z78A 5DHIA 3ICZA 5DW7A 2F7MF 5B0MA 5IMNA 1HXAA 3AQ0A 5E8LA 3TFPA 5ER8A 1YHMA 3VJEA 4WK5A 3WCMA 4KFAA 3ZOUA 5HN8A 3OYRA 2ONGA 3RYWA 2OA6A 3DYGA 1RTRA 1PS1A 2Q9YA 4LIXA 1RQIA 4JVJF 4E9ZA 4PVXF 1YJ4A 4JYXA 3LEEA 3KRPA 4KPJA 4NG6A 3NRIA 3P8RA 1UBWA 2AEKA 1YYSA 2RAHA 2J5CA 1KIYA 2H8OA 3AQCB 2OPMA 5JA0F 1YYTA 2F9KF 4LZ3A 4EA2A 3SDQA 2Z4YA 3M02A 1VG4A 5JV2F 3WSBA 4LFGA 4FP4A 4NFJF 5ILHA 3WJNA 3P5PA 2E8XA 3KRAA 4LLTA 3N3LF 2PS6A 4MC0A 4NFKF 4LFVF 3UCAA 2F94F 4KPDA 3PDEA 2OPNA 5HN7A 4RXAA 2ZCSA 1VG6A 5C05A 1FPSA 4RXCA 4F6XA 5E8KA 3CKEA 4MC8A 3CP6A 2Z52A 4H5CF 5IM1A 2E8TA 5HNAA 4KWDA 1N20A 2F8ZF 3M00A 4KQ5A 5IL3A 1WMWA 4DEMF 4NFIF 5AFXA 5B02A 1V4JA 3W7FA 3LGZB 1N23A 3N3DA 1VG3A 2AETA 3Q1OA 4GAXA 3ZMBA 4N1ZF 3N1WF 2AZJA 2ZEUA 3OABB 2J1PA 3KRCB 5IMPA 4GP1A 2FTZA 3MZVA 3N1VF 1YV5A 3WEIA 3VJDA 4LA6A 3DYFA 1UBYA 5DGNF 3KBKA 2I19A 2ZCOA 3ACYA 5EASA 3VJCA 3WCJA 4DWGA 3PYAA 3N45F 5I1UA 3BNXA 3N5JF 4K10A 4JXYA 3WCGA 3LZ9A 1VG2A 2ZY1A 2ZCQA 3P8LA 2P1CA 2F92F 1N24A 5B0LA 2E94A 3KROA 5EATA 3EFQA 2PS4A 5DJVF 2Z7HA 5IKAA 2EWGA 5IL8A 4RNQA 3VJBA 5IKHA 4LUUA 5B01A 2F89F 4DZWA 3ACWA 3B7LA 3N0GA 4NKFA 4F62A 2F8CF 5IVGA 5IN8A 1HXGA 3N5HF 3ADZA 4LPHF 4GP2A 2AZLA 3PYBA 5DZ2A 3KRFB 1YYRA 3LLWA 2PS8A 1KIZA 3WCBA 1N21A 3NPKA 5DGMF 4OMGA 1WL0A 3Q2ZA 1WKZA 3Q2QA 2E95A 3WCFA 4LTVA 4QPFA 5ERNA 3Q30A 2Z4VA 3V66A 4NUAA 1V4KA 2Z7IA 3WCDA 2AELA 3OABA 4JZBA 4ZQ8A 4RXDA 4P0WA 1N22A 2E4OA 4LA5A 3TS7A 1YHLA 2VF6A 3WCAA 3ASXA 1ZW5A 3WEFA 4DHDA 5KSXF 3SAEA 3SDTA 1WL3A 1WY0A 4LZCA 3AQBB 2E90A 2ONHA 1HX9A 2AZKA 4KQUA 2DH4A 3M9UA 5B03A 3M0GA 5CG5A 2Z4XA 3CC9A 1V4EA 2ZCRA 1YHKA 4EA1A 2J1OA 3WCCA 3WJKA 5AHUB 3N49F 3WEKA 3N0FA 1VG7A 2FORA 4GA3A 3LMDA 4XQRF 1JFGA 3ZMCA 1DI1A 4HD1A 3LOMA 5DHKA 5DGSF 4OMHA 4KVDA 2Z4WA 2E93A 4UMJA 5DJRF 3KRFA 5ILJA 4DXJA 3KRAB 2Z50A 4KVWA 3RBMA 1HM7A 4NKEA 1RQJA 4F6VA 3WEJA 3WC9A 3ICNA 4XQSF 3MAVA 4XQTF 2OGDA 3WE9A 3V1XA 4P0XA 3SDVA 3VJ8A 2E8UA 5AELA 5JV1F 5ILYA 5B0IA 4OGUA 4E9UA 3OACB 3TFNA 5ILZA 3TFVA 4LOBA 1WL1A 4EA0A 2PS5A 5ILIA 5A0JA 4N9UA 5A0IA 3LJIA 4DI5A 4LFEA 2Q80A 3S9VA 5B0JA 3VJAA 5IK9A 5IK6A 5EAUA 4L2XF 4JXNA 4E1EA 5ILDA 1V4IA 3APZA 4H5EF 5EROA 1N1BA 2PS7A 4KKMA 4KQSA 3WCLA 3LDWA 3SDUA 3WCIA 4OKZA 4KVYA 3WSAA 3N46F 3KRCA 3WCEA 3WJOA 4PVYF 3P41A 2Q58A 3DYHA 2QISA 3WEGA 3M01A 3LSNA 5AYPA
chains in the Genus database with same CATH superfamily
3ICKA 3TC1A 3G4DA 5JV0F 4P0VA 5ERMA 3WEHA 2E92A 5IMIA 2Q9ZA 3QQVA 4RXEA 3KROB 4H5DF 4LTZA 4LZ0A 3LGKA 3WCHA 5B0KA 2ZEVA 3KB9A 2E91A 5E8HA 3QKCA 3IPIA 5B00A 3PKOA 4OKMA 3P5RA 5DIQF 1EZFA 5CG6A 5IK0A 1YYUA 3OACA 3KRPB 5ILKA 3RYEA 1V4HA 3ICMA 3ZL6A 4RYPA 5HN9A 3LG5A 2E8WA 1WL2A 3BNYA 4FJQA 3NPRA 1HXCA 3S4JA 5DJPF 3LK5A 4JZXA 3G4FA 1UBXA 1JFAA 2E8VA 1HM4A 1UBVA 4Q23A 3N6KF 5A0KA 4MC3A 3RMGA 1YYQA 4LPGF 3SDRA 1DGPA 5H9DA 4LXWA 1N1ZA 3EZ3A 3EGTA 3ID0A 3LVSA 3V1VA 4DWBA 4KK2A 3PH7A 3ZCDA 3ACXA 2O1OA 2Z4ZA 3IBAA 1YQ7A 4LLSA 5JUZF 3VJ9A 4KVIA 4KUXA 4QXSF 3AE0A 3NF2A 2Z78A 5DHIA 3ICZA 5DW7A 2F7MF 5B0MA 5IMNA 1HXAA 3AQ0A 5E8LA 3TFPA 5ER8A 1YHMA 3VJEA 4WK5A 3WCMA 4KFAA 3ZOUA 5HN8A 3OYRA 2ONGA 3RYWA 2OA6A 3DYGA 1RTRA 1PS1A 2Q9YA 4LIXA 1RQIA 4JVJF 4E9ZA 4PVXF 1YJ4A 4JYXA 3LEEA 3KRPA 4KPJA 4NG6A 3NRIA 3P8RA 1UBWA 2AEKA 1YYSA 2RAHA 2J5CA 1KIYA 2H8OA 3AQCB 2OPMA 5JA0F 1YYTA 2F9KF 4LZ3A 4EA2A 3SDQA 2Z4YA 3M02A 1VG4A 5JV2F 3WSBA 4LFGA 4FP4A 4NFJF 5ILHA 3WJNA 3P5PA 2E8XA 3KRAA 4LLTA 3N3LF 2PS6A 4MC0A 4NFKF 4LFVF 3UCAA 2F94F 4KPDA 3PDEA 2OPNA 5HN7A 4RXAA 2ZCSA 1VG6A 5C05A 1FPSA 4RXCA 4F6XA 5E8KA 3CKEA 4MC8A 3CP6A 2Z52A 4H5CF 5IM1A 2E8TA 5HNAA 4KWDA 1N20A 2F8ZF 3M00A 4KQ5A 5IL3A 1WMWA 4DEMF 4NFIF 5AFXA 5B02A 1V4JA 3W7FA 3LGZB 1N23A 3N3DA 1VG3A 2AETA 3Q1OA 4GAXA 3ZMBA 4N1ZF 3N1WF 2AZJA 2ZEUA 3OABB 2J1PA 3KRCB 5IMPA 4GP1A 2FTZA 3MZVA 3N1VF 1YV5A 3WEIA 3VJDA 4LA6A 3DYFA 1UBYA 5DGNF 3KBKA 2I19A 2ZCOA 3ACYA 5EASA 3VJCA 3WCJA 4DWGA 3PYAA 3N45F 5I1UA 3BNXA 3N5JF 4K10A 4JXYA 3WCGA 3LZ9A 1VG2A 2ZY1A 2ZCQA 3P8LA 2P1CA 2F92F 1N24A 5B0LA 2E94A 3KROA 5EATA 3EFQA 2PS4A 5DJVF 2Z7HA 5IKAA 2EWGA 5IL8A 4RNQA 3VJBA 5IKHA 4LUUA 5B01A 2F89F 4DZWA 3ACWA 3B7LA 3N0GA 4NKFA 4F62A 2F8CF 5IVGA 5IN8A 1HXGA 3N5HF 3ADZA 4LPHF 4GP2A 2AZLA 3PYBA 5DZ2A 3KRFB 1YYRA 3LLWA 2PS8A 1KIZA 3WCBA 1N21A 3NPKA 5DGMF 4OMGA 1WL0A 3Q2ZA 1WKZA 3Q2QA 2E95A 3WCFA 4LTVA 4QPFA 5ERNA 3Q30A 2Z4VA 3V66A 4NUAA 1V4KA 2Z7IA 3WCDA 2AELA 3OABA 4JZBA 4ZQ8A 4RXDA 4P0WA 1N22A 2E4OA 4LA5A 3TS7A 1YHLA 2VF6A 3WCAA 3ASXA 1ZW5A 3WEFA 4DHDA 5KSXF 3SAEA 3SDTA 1WL3A 1WY0A 4LZCA 3AQBB 2E90A 2ONHA 1HX9A 2AZKA 4KQUA 2DH4A 3M9UA 5B03A 3M0GA 5CG5A 2Z4XA 3CC9A 1V4EA 2ZCRA 1YHKA 4EA1A 2J1OA 3WCCA 3WJKA 5AHUB 3N49F 3WEKA 3N0FA 1VG7A 2FORA 4GA3A 3LMDA 4XQRF 1JFGA 3ZMCA 1DI1A 4HD1A 3LOMA 5DHKA 5DGSF 4OMHA 4KVDA 2Z4WA 2E93A 4UMJA 5DJRF 3KRFA 5ILJA 4DXJA 3KRAB 2Z50A 4KVWA 3RBMA 1HM7A 4NKEA 1RQJA 4F6VA 3WEJA 3WC9A 3ICNA 4XQSF 3MAVA 4XQTF 2OGDA 3WE9A 3V1XA 4P0XA 3SDVA 3VJ8A 2E8UA 5AELA 5JV1F 5ILYA 5B0IA 4OGUA 4E9UA 3OACB 3TFNA 5ILZA 3TFVA 4LOBA 1WL1A 4EA0A 2PS5A 5ILIA 5A0JA 4N9UA 5A0IA 3LJIA 4DI5A 4LFEA 2Q80A 3S9VA 5B0JA 3VJAA 5IK9A 5IK6A 5EAUA 4L2XF 4JXNA 4E1EA 5ILDA 1V4IA 3APZA 4H5EF 5EROA 1N1BA 2PS7A 4KKMA 4KQSA 3WCLA 3LDWA 3SDUA 3WCIA 4OKZA 4KVYA 3WSAA 3N46F 3KRCA 3WCEA 3WJOA 4PVYF 3P41A 2Q58A 3DYHA 2QISA 3WEGA 3M01A 3LSNA 5AYPA
chains in the Genus database with same CATH topology
3ICKA 3TC1A 3G4DA 5JV0F 4P0VA 5ERMA 3WEHA 2E92A 5IMIA 2Q9ZA 3QQVA 4RXEA 3KROB 4H5DF 4LTZA 4LZ0A 3LGKA 3WCHA 5B0KA 2ZEVA 3KB9A 2E91A 5E8HA 3QKCA 3IPIA 5B00A 3PKOA 4OKMA 3P5RA 5DIQF 1EZFA 5CG6A 5IK0A 1YYUA 3OACA 3KRPB 5ILKA 3RYEA 1V4HA 3ICMA 3ZL6A 4RYPA 5HN9A 3LG5A 2E8WA 1WL2A 3BNYA 4FJQA 3NPRA 1HXCA 3S4JA 5DJPF 3LK5A 4JZXA 3G4FA 1UBXA 1JFAA 2E8VA 1HM4A 1UBVA 4Q23A 3N6KF 5A0KA 4MC3A 3RMGA 1YYQA 4LPGF 3SDRA 1DGPA 5H9DA 4LXWA 1N1ZA 3EZ3A 3EGTA 3ID0A 3LVSA 3V1VA 4DWBA 4KK2A 3PH7A 3ZCDA 3ACXA 2O1OA 2Z4ZA 3IBAA 1YQ7A 4LLSA 5JUZF 3VJ9A 4KVIA 4KUXA 4QXSF 3AE0A 3NF2A 2Z78A 5DHIA 3ICZA 5DW7A 2F7MF 5B0MA 5IMNA 1HXAA 3AQ0A 5E8LA 3TFPA 5ER8A 1YHMA 3VJEA 4WK5A 3WCMA 4KFAA 3ZOUA 5HN8A 3OYRA 2ONGA 3RYWA 2OA6A 3DYGA 1RTRA 1PS1A 2Q9YA 4LIXA 1RQIA 4JVJF 4E9ZA 4PVXF 1YJ4A 4JYXA 3LEEA 3KRPA 4KPJA 4NG6A 3NRIA 3P8RA 1UBWA 2AEKA 1YYSA 2RAHA 2J5CA 1KIYA 2H8OA 3AQCB 2OPMA 5JA0F 1YYTA 2F9KF 4LZ3A 4EA2A 3SDQA 2Z4YA 3M02A 1VG4A 5JV2F 3WSBA 4LFGA 4FP4A 4NFJF 5ILHA 3WJNA 3P5PA 2E8XA 3KRAA 4LLTA 3N3LF 2PS6A 4MC0A 4NFKF 4LFVF 3UCAA 2F94F 4KPDA 3PDEA 2OPNA 5HN7A 4RXAA 2ZCSA 1VG6A 5C05A 1FPSA 4RXCA 4F6XA 5E8KA 3CKEA 4MC8A 3CP6A 2Z52A 4H5CF 5IM1A 2E8TA 5HNAA 4KWDA 1N20A 2F8ZF 3M00A 4KQ5A 5IL3A 1WMWA 4DEMF 4NFIF 5AFXA 5B02A 1V4JA 3W7FA 3LGZB 1N23A 3N3DA 1VG3A 2AETA 3Q1OA 4GAXA 3ZMBA 4N1ZF 3N1WF 2AZJA 2ZEUA 3OABB 2J1PA 3KRCB 5IMPA 4GP1A 2FTZA 3MZVA 3N1VF 1YV5A 3WEIA 3VJDA 4LA6A 3DYFA 1UBYA 5DGNF 3KBKA 2I19A 2ZCOA 3ACYA 5EASA 3VJCA 3WCJA 4DWGA 3PYAA 3N45F 5I1UA 3BNXA 3N5JF 4K10A 4JXYA 3WCGA 3LZ9A 1VG2A 2ZY1A 2ZCQA 3P8LA 2P1CA 2F92F 1N24A 5B0LA 2E94A 3KROA 5EATA 3EFQA 2PS4A 5DJVF 2Z7HA 5IKAA 2EWGA 5IL8A 4RNQA 3VJBA 5IKHA 4LUUA 5B01A 2F89F 4DZWA 3ACWA 3B7LA 3N0GA 4NKFA 4F62A 2F8CF 5IVGA 5IN8A 1HXGA 3N5HF 3ADZA 4LPHF 4GP2A 2AZLA 3PYBA 5DZ2A 3KRFB 1YYRA 3LLWA 2PS8A 1KIZA 3WCBA 1N21A 3NPKA 5DGMF 4OMGA 1WL0A 3Q2ZA 1WKZA 3Q2QA 2E95A 3WCFA 4LTVA 4QPFA 5ERNA 3Q30A 2Z4VA 3V66A 4NUAA 1V4KA 2Z7IA 3WCDA 2AELA 3OABA 4JZBA 4ZQ8A 4RXDA 4P0WA 1N22A 2E4OA 4LA5A 3TS7A 1YHLA 2VF6A 3WCAA 3ASXA 1ZW5A 3WEFA 4DHDA 5KSXF 3SAEA 3SDTA 1WL3A 1WY0A 4LZCA 3AQBB 2E90A 2ONHA 1HX9A 2AZKA 4KQUA 2DH4A 3M9UA 5B03A 3M0GA 5CG5A 2Z4XA 3CC9A 1V4EA 2ZCRA 1YHKA 4EA1A 2J1OA 3WCCA 3WJKA 5AHUB 3N49F 3WEKA 3N0FA 1VG7A 2FORA 4GA3A 3LMDA 4XQRF 1JFGA 3ZMCA 1DI1A 4HD1A 3LOMA 5DHKA 5DGSF 4OMHA 4KVDA 2Z4WA 2E93A 4UMJA 5DJRF 3KRFA 5ILJA 4DXJA 3KRAB 2Z50A 4KVWA 3RBMA 1HM7A 4NKEA 1RQJA 4F6VA 3WEJA 3WC9A 3ICNA 4XQSF 3MAVA 4XQTF 2OGDA 3WE9A 3V1XA 4P0XA 3SDVA 3VJ8A 2E8UA 5AELA 5JV1F 5ILYA 5B0IA 4OGUA 4E9UA 3OACB 3TFNA 5ILZA 3TFVA 4LOBA 1WL1A 4EA0A 2PS5A 5ILIA 5A0JA 4N9UA 5A0IA 3LJIA 4DI5A 4LFEA 2Q80A 3S9VA 5B0JA 3VJAA 5IK9A 5IK6A 5EAUA 4L2XF 4JXNA 4E1EA 5ILDA 1V4IA 3APZA 4H5EF 5EROA 1N1BA 2PS7A 4KKMA 4KQSA 3WCLA 3LDWA 3SDUA 3WCIA 4OKZA 4KVYA 3WSAA 3N46F 3KRCA 3WCEA 3WJOA 4PVYF 3P41A 2Q58A 3DYHA 2QISA 3WEGA 3M01A 3LSNA 5AYPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ICK A;  3TC1 A;  3G4D A;  5JV0 F;  4P0V A;  5ERM A;  3WEH A;  2E92 A;  5IMI A;  2Q9Z A;  3QQV A;  4RXE A;  3KRO B;  4H5D F;  4LTZ A;  4LZ0 A;  3LGK A;  3WCH A;  5B0K A;  2ZEV A;  3KB9 A;  2E91 A;  5E8H A;  3QKC A;  3IPI A;  5B00 A;  3PKO A;  4OKM A;  3P5R A;  5DIQ F;  1EZF A;  5CG6 A;  5IK0 A;  1YYU A;  3OAC A;  3KRP B;  5ILK A;  3RYE A;  1V4H A;  3ICM A;  3ZL6 A;  4RYP A;  5HN9 A;  3LG5 A;  2E8W A;  1WL2 A;  3BNY A;  4FJQ A;  3NPR A;  1HXC A;  3S4J A;  5DJP F;  3LK5 A;  4JZX A;  3G4F A;  1UBX A;  1JFA A;  2E8V A;  1HM4 A;  1UBV A;  4Q23 A;  3N6K F;  5A0K A;  4MC3 A;  3RMG A;  1YYQ A;  4LPG F;  3SDR A;  1DGP A;  5H9D A;  4LXW A;  1N1Z A;  3EZ3 A;  3EGT A;  3ID0 A;  3LVS A;  3V1V A;  4DWB A;  4KK2 A;  3PH7 A;  3ZCD A;  3ACX A;  2O1O A;  2Z4Z A;  3IBA A;  1YQ7 A;  4LLS A;  5JUZ F;  3VJ9 A;  4KVI A;  4KUX A;  4QXS F;  3AE0 A;  3NF2 A;  2Z78 A;  5DHI A;  3ICZ A;  5DW7 A;  2F7M F;  5B0M A;  5IMN A;  1HXA A;  3AQ0 A;  5E8L A;  3TFP A;  5ER8 A;  1YHM A;  3VJE A;  4WK5 A;  3WCM A;  4KFA A;  3ZOU A;  5HN8 A;  3OYR A;  2ONG A;  3RYW A;  2OA6 A;  3DYG A;  1RTR A;  1PS1 A;  2Q9Y A;  4LIX A;  1RQI A;  4JVJ F;  4E9Z A;  4PVX F;  1YJ4 A;  4JYX A;  3LEE A;  3KRP A;  4KPJ A;  4NG6 A;  3NRI A;  3P8R A;  1UBW A;  2AEK A;  1YYS A;  2RAH A;  2J5C A;  1KIY A;  2H8O A;  3AQC B;  2OPM A;  5JA0 F;  1YYT A;  2F9K F;  4LZ3 A;  4EA2 A;  3SDQ A;  2Z4Y A;  3M02 A;  1VG4 A;  5JV2 F;  3WSB A;  4LFG A;  4FP4 A;  4NFJ F;  5ILH A;  3WJN A;  3P5P A;  2E8X A;  3KRA A;  4LLT A;  3N3L F;  2PS6 A;  4MC0 A;  4NFK F;  4LFV F;  3UCA A;  2F94 F;  4KPD A;  3PDE A;  2OPN A;  5HN7 A;  4RXA A;  2ZCS A;  1VG6 A;  5C05 A;  1FPS A;  4RXC A;  4F6X A;  5E8K A;  3CKE A;  4MC8 A;  3CP6 A;  2Z52 A;  4H5C F;  5IM1 A;  2E8T A;  5HNA A;  4KWD A;  1N20 A;  2F8Z F;  3M00 A;  4KQ5 A;  5IL3 A;  1WMW A;  4DEM F;  4NFI F;  5AFX A;  5B02 A;  1V4J A;  3W7F A;  3LGZ B;  1N23 A;  3N3D A;  1VG3 A;  2AET A;  3Q1O A;  4GAX A;  3ZMB A;  4N1Z F;  3N1W F;  2AZJ A;  2ZEU A;  3OAB B;  2J1P A;  3KRC B;  5IMP A;  4GP1 A;  2FTZ A;  3MZV A;  3N1V F;  1YV5 A;  3WEI A;  3VJD A;  4LA6 A;  3DYF A;  1UBY A;  5DGN F;  3KBK A;  2I19 A;  2ZCO A;  3ACY A;  5EAS A;  3VJC A;  3WCJ A;  4DWG A;  3PYA A;  3N45 F;  5I1U A;  3BNX A;  3N5J F;  4K10 A;  4JXY A;  3WCG A;  3LZ9 A;  1VG2 A;  2ZY1 A;  2ZCQ A;  3P8L A;  2P1C A;  2F92 F;  1N24 A;  5B0L A;  2E94 A;  3KRO A;  5EAT A;  3EFQ A;  2PS4 A;  5DJV F;  2Z7H A;  5IKA A;  2EWG A;  5IL8 A;  4RNQ A;  3VJB A;  5IKH A;  4LUU A;  5B01 A;  2F89 F;  4DZW A;  3ACW A;  3B7L A;  3N0G A;  4NKF A;  4F62 A;  2F8C F;  5IVG A;  5IN8 A;  1HXG A;  3N5H F;  3ADZ A;  4LPH F;  4GP2 A;  2AZL A;  3PYB A;  5DZ2 A;  3KRF B;  1YYR A;  3LLW A;  2PS8 A;  1KIZ A;  3WCB A;  1N21 A;  3NPK A;  5DGM F;  4OMG A;  1WL0 A;  3Q2Z A;  1WKZ A;  3Q2Q A;  2E95 A;  3WCF A;  4LTV A;  4QPF A;  5ERN A;  3Q30 A;  2Z4V A;  3V66 A;  4NUA A;  1V4K A;  2Z7I A;  3WCD A;  2AEL A;  3OAB A;  4JZB A;  4ZQ8 A;  4RXD A;  4P0W A;  1N22 A;  2E4O A;  4LA5 A;  3TS7 A;  1YHL A;  2VF6 A;  3WCA A;  3ASX A;  1ZW5 A;  3WEF A;  4DHD A;  5KSX F;  3SAE A;  3SDT A;  1WL3 A;  1WY0 A;  4LZC A;  3AQB B;  2E90 A;  2ONH A;  1HX9 A;  2AZK A;  4KQU A;  2DH4 A;  3M9U A;  5B03 A;  3M0G A;  5CG5 A;  2Z4X A;  3CC9 A;  1V4E A;  2ZCR A;  1YHK A;  4EA1 A;  2J1O A;  3WCC A;  3WJK A;  5AHU B;  3N49 F;  3WEK A;  3N0F A;  1VG7 A;  2FOR A;  4GA3 A;  3LMD A;  4XQR F;  1JFG A;  3ZMC A;  1DI1 A;  4HD1 A;  3LOM A;  5DHK A;  5DGS F;  4OMH A;  4KVD A;  2Z4W A;  2E93 A;  4UMJ A;  5DJR F;  3KRF A;  5ILJ A;  4DXJ A;  3KRA B;  2Z50 A;  4KVW A;  3RBM A;  1HM7 A;  4NKE A;  1RQJ A;  4F6V A;  3WEJ A;  3WC9 A;  3ICN A;  4XQS F;  3MAV A;  4XQT F;  2OGD A;  3WE9 A;  3V1X A;  4P0X A;  3SDV A;  3VJ8 A;  2E8U A;  5AEL A;  5JV1 F;  5ILY A;  5B0I A;  4OGU A;  4E9U A;  3OAC B;  3TFN A;  5ILZ A;  3TFV A;  4LOB A;  1WL1 A;  4EA0 A;  2PS5 A;  5ILI A;  5A0J A;  4N9U A;  5A0I A;  3LJI A;  4DI5 A;  4LFE A;  2Q80 A;  3S9V A;  5B0J A;  3VJA A;  5IK9 A;  5IK6 A;  5EAU A;  4L2X F;  4JXN A;  4E1E A;  5ILD A;  1V4I A;  3APZ A;  4H5E F;  5ERO A;  1N1B A;  2PS7 A;  4KKM A;  4KQS A;  3WCL A;  3LDW A;  3SDU A;  3WCI A;  4OKZ A;  4KVY A;  3WSA A;  3N46 F;  3KRC A;  3WCE A;  3WJO A;  4PVY F;  3P41 A;  2Q58 A;  3DYH A;  2QIS A;  3WEG A;  3M01 A;  3LSN A;  5AYP A; 
#chains in the Genus database with same CATH topology
 3ICK A;  3TC1 A;  3G4D A;  5JV0 F;  4P0V A;  5ERM A;  3WEH A;  2E92 A;  5IMI A;  2Q9Z A;  3QQV A;  4RXE A;  3KRO B;  4H5D F;  4LTZ A;  4LZ0 A;  3LGK A;  3WCH A;  5B0K A;  2ZEV A;  3KB9 A;  2E91 A;  5E8H A;  3QKC A;  3IPI A;  5B00 A;  3PKO A;  4OKM A;  3P5R A;  5DIQ F;  1EZF A;  5CG6 A;  5IK0 A;  1YYU A;  3OAC A;  3KRP B;  5ILK A;  3RYE A;  1V4H A;  3ICM A;  3ZL6 A;  4RYP A;  5HN9 A;  3LG5 A;  2E8W A;  1WL2 A;  3BNY A;  4FJQ A;  3NPR A;  1HXC A;  3S4J A;  5DJP F;  3LK5 A;  4JZX A;  3G4F A;  1UBX A;  1JFA A;  2E8V A;  1HM4 A;  1UBV A;  4Q23 A;  3N6K F;  5A0K A;  4MC3 A;  3RMG A;  1YYQ A;  4LPG F;  3SDR A;  1DGP A;  5H9D A;  4LXW A;  1N1Z A;  3EZ3 A;  3EGT A;  3ID0 A;  3LVS A;  3V1V A;  4DWB A;  4KK2 A;  3PH7 A;  3ZCD A;  3ACX A;  2O1O A;  2Z4Z A;  3IBA A;  1YQ7 A;  4LLS A;  5JUZ F;  3VJ9 A;  4KVI A;  4KUX A;  4QXS F;  3AE0 A;  3NF2 A;  2Z78 A;  5DHI A;  3ICZ A;  5DW7 A;  2F7M F;  5B0M A;  5IMN A;  1HXA A;  3AQ0 A;  5E8L A;  3TFP A;  5ER8 A;  1YHM A;  3VJE A;  4WK5 A;  3WCM A;  4KFA A;  3ZOU A;  5HN8 A;  3OYR A;  2ONG A;  3RYW A;  2OA6 A;  3DYG A;  1RTR A;  1PS1 A;  2Q9Y A;  4LIX A;  1RQI A;  4JVJ F;  4E9Z A;  4PVX F;  1YJ4 A;  4JYX A;  3LEE A;  3KRP A;  4KPJ A;  4NG6 A;  3NRI A;  3P8R A;  1UBW A;  2AEK A;  1YYS A;  2RAH A;  2J5C A;  1KIY A;  2H8O A;  3AQC B;  2OPM A;  5JA0 F;  1YYT A;  2F9K F;  4LZ3 A;  4EA2 A;  3SDQ A;  2Z4Y A;  3M02 A;  1VG4 A;  5JV2 F;  3WSB A;  4LFG A;  4FP4 A;  4NFJ F;  5ILH A;  3WJN A;  3P5P A;  2E8X A;  3KRA A;  4LLT A;  3N3L F;  2PS6 A;  4MC0 A;  4NFK F;  4LFV F;  3UCA A;  2F94 F;  4KPD A;  3PDE A;  2OPN A;  5HN7 A;  4RXA A;  2ZCS A;  1VG6 A;  5C05 A;  1FPS A;  4RXC A;  4F6X A;  5E8K A;  3CKE A;  4MC8 A;  3CP6 A;  2Z52 A;  4H5C F;  5IM1 A;  2E8T A;  5HNA A;  4KWD A;  1N20 A;  2F8Z F;  3M00 A;  4KQ5 A;  5IL3 A;  1WMW A;  4DEM F;  4NFI F;  5AFX A;  5B02 A;  1V4J A;  3W7F A;  3LGZ B;  1N23 A;  3N3D A;  1VG3 A;  2AET A;  3Q1O A;  4GAX A;  3ZMB A;  4N1Z F;  3N1W F;  2AZJ A;  2ZEU A;  3OAB B;  2J1P A;  3KRC B;  5IMP A;  4GP1 A;  2FTZ A;  3MZV A;  3N1V F;  1YV5 A;  3WEI A;  3VJD A;  4LA6 A;  3DYF A;  1UBY A;  5DGN F;  3KBK A;  2I19 A;  2ZCO A;  3ACY A;  5EAS A;  3VJC A;  3WCJ A;  4DWG A;  3PYA A;  3N45 F;  5I1U A;  3BNX A;  3N5J F;  4K10 A;  4JXY A;  3WCG A;  3LZ9 A;  1VG2 A;  2ZY1 A;  2ZCQ A;  3P8L A;  2P1C A;  2F92 F;  1N24 A;  5B0L A;  2E94 A;  3KRO A;  5EAT A;  3EFQ A;  2PS4 A;  5DJV F;  2Z7H A;  5IKA A;  2EWG A;  5IL8 A;  4RNQ A;  3VJB A;  5IKH A;  4LUU A;  5B01 A;  2F89 F;  4DZW A;  3ACW A;  3B7L A;  3N0G A;  4NKF A;  4F62 A;  2F8C F;  5IVG A;  5IN8 A;  1HXG A;  3N5H F;  3ADZ A;  4LPH F;  4GP2 A;  2AZL A;  3PYB A;  5DZ2 A;  3KRF B;  1YYR A;  3LLW A;  2PS8 A;  1KIZ A;  3WCB A;  1N21 A;  3NPK A;  5DGM F;  4OMG A;  1WL0 A;  3Q2Z A;  1WKZ A;  3Q2Q A;  2E95 A;  3WCF A;  4LTV A;  4QPF A;  5ERN A;  3Q30 A;  2Z4V A;  3V66 A;  4NUA A;  1V4K A;  2Z7I A;  3WCD A;  2AEL A;  3OAB A;  4JZB A;  4ZQ8 A;  4RXD A;  4P0W A;  1N22 A;  2E4O A;  4LA5 A;  3TS7 A;  1YHL A;  2VF6 A;  3WCA A;  3ASX A;  1ZW5 A;  3WEF A;  4DHD A;  5KSX F;  3SAE A;  3SDT A;  1WL3 A;  1WY0 A;  4LZC A;  3AQB B;  2E90 A;  2ONH A;  1HX9 A;  2AZK A;  4KQU A;  2DH4 A;  3M9U A;  5B03 A;  3M0G A;  5CG5 A;  2Z4X A;  3CC9 A;  1V4E A;  2ZCR A;  1YHK A;  4EA1 A;  2J1O A;  3WCC A;  3WJK A;  5AHU B;  3N49 F;  3WEK A;  3N0F A;  1VG7 A;  2FOR A;  4GA3 A;  3LMD A;  4XQR F;  1JFG A;  3ZMC A;  1DI1 A;  4HD1 A;  3LOM A;  5DHK A;  5DGS F;  4OMH A;  4KVD A;  2Z4W A;  2E93 A;  4UMJ A;  5DJR F;  3KRF A;  5ILJ A;  4DXJ A;  3KRA B;  2Z50 A;  4KVW A;  3RBM A;  1HM7 A;  4NKE A;  1RQJ A;  4F6V A;  3WEJ A;  3WC9 A;  3ICN A;  4XQS F;  3MAV A;  4XQT F;  2OGD A;  3WE9 A;  3V1X A;  4P0X A;  3SDV A;  3VJ8 A;  2E8U A;  5AEL A;  5JV1 F;  5ILY A;  5B0I A;  4OGU A;  4E9U A;  3OAC B;  3TFN A;  5ILZ A;  3TFV A;  4LOB A;  1WL1 A;  4EA0 A;  2PS5 A;  5ILI A;  5A0J A;  4N9U A;  5A0I A;  3LJI A;  4DI5 A;  4LFE A;  2Q80 A;  3S9V A;  5B0J A;  3VJA A;  5IK9 A;  5IK6 A;  5EAU A;  4L2X F;  4JXN A;  4E1E A;  5ILD A;  1V4I A;  3APZ A;  4H5E F;  5ERO A;  1N1B A;  2PS7 A;  4KKM A;  4KQS A;  3WCL A;  3LDW A;  3SDU A;  3WCI A;  4OKZ A;  4KVY A;  3WSA A;  3N46 F;  3KRC A;  3WCE A;  3WJO A;  4PVY F;  3P41 A;  2Q58 A;  3DYH A;  2QIS A;  3WEG A;  3M01 A;  3LSN A;  5AYP A; 
#chains in the Genus database with same CATH homology
 3ICK A;  3TC1 A;  3G4D A;  5JV0 F;  4P0V A;  5ERM A;  3WEH A;  2E92 A;  5IMI A;  2Q9Z A;  3QQV A;  4RXE A;  3KRO B;  4H5D F;  4LTZ A;  4LZ0 A;  3LGK A;  3WCH A;  5B0K A;  2ZEV A;  3KB9 A;  2E91 A;  5E8H A;  3QKC A;  3IPI A;  5B00 A;  3PKO A;  4OKM A;  3P5R A;  5DIQ F;  1EZF A;  5CG6 A;  5IK0 A;  1YYU A;  3OAC A;  3KRP B;  5ILK A;  3RYE A;  1V4H A;  3ICM A;  3ZL6 A;  4RYP A;  5HN9 A;  3LG5 A;  2E8W A;  1WL2 A;  3BNY A;  4FJQ A;  3NPR A;  1HXC A;  3S4J A;  5DJP F;  3LK5 A;  4JZX A;  3G4F A;  1UBX A;  1JFA A;  2E8V A;  1HM4 A;  1UBV A;  4Q23 A;  3N6K F;  5A0K A;  4MC3 A;  3RMG A;  1YYQ A;  4LPG F;  3SDR A;  1DGP A;  5H9D A;  4LXW A;  1N1Z A;  3EZ3 A;  3EGT A;  3ID0 A;  3LVS A;  3V1V A;  4DWB A;  4KK2 A;  3PH7 A;  3ZCD A;  3ACX A;  2O1O A;  2Z4Z A;  3IBA A;  1YQ7 A;  4LLS A;  5JUZ F;  3VJ9 A;  4KVI A;  4KUX A;  4QXS F;  3AE0 A;  3NF2 A;  2Z78 A;  5DHI A;  3ICZ A;  5DW7 A;  2F7M F;  5B0M A;  5IMN A;  1HXA A;  3AQ0 A;  5E8L A;  3TFP A;  5ER8 A;  1YHM A;  3VJE A;  4WK5 A;  3WCM A;  4KFA A;  3ZOU A;  5HN8 A;  3OYR A;  2ONG A;  3RYW A;  2OA6 A;  3DYG A;  1RTR A;  1PS1 A;  2Q9Y A;  4LIX A;  1RQI A;  4JVJ F;  4E9Z A;  4PVX F;  1YJ4 A;  4JYX A;  3LEE A;  3KRP A;  4KPJ A;  4NG6 A;  3NRI A;  3P8R A;  1UBW A;  2AEK A;  1YYS A;  2RAH A;  2J5C A;  1KIY A;  2H8O A;  3AQC B;  2OPM A;  5JA0 F;  1YYT A;  2F9K F;  4LZ3 A;  4EA2 A;  3SDQ A;  2Z4Y A;  3M02 A;  1VG4 A;  5JV2 F;  3WSB A;  4LFG A;  4FP4 A;  4NFJ F;  5ILH A;  3WJN A;  3P5P A;  2E8X A;  3KRA A;  4LLT A;  3N3L F;  2PS6 A;  4MC0 A;  4NFK F;  4LFV F;  3UCA A;  2F94 F;  4KPD A;  3PDE A;  2OPN A;  5HN7 A;  4RXA A;  2ZCS A;  1VG6 A;  5C05 A;  1FPS A;  4RXC A;  4F6X A;  5E8K A;  3CKE A;  4MC8 A;  3CP6 A;  2Z52 A;  4H5C F;  5IM1 A;  2E8T A;  5HNA A;  4KWD A;  1N20 A;  2F8Z F;  3M00 A;  4KQ5 A;  5IL3 A;  1WMW A;  4DEM F;  4NFI F;  5AFX A;  5B02 A;  1V4J A;  3W7F A;  3LGZ B;  1N23 A;  3N3D A;  1VG3 A;  2AET A;  3Q1O A;  4GAX A;  3ZMB A;  4N1Z F;  3N1W F;  2AZJ A;  2ZEU A;  3OAB B;  2J1P A;  3KRC B;  5IMP A;  4GP1 A;  2FTZ A;  3MZV A;  3N1V F;  1YV5 A;  3WEI A;  3VJD A;  4LA6 A;  3DYF A;  1UBY A;  5DGN F;  3KBK A;  2I19 A;  2ZCO A;  3ACY A;  5EAS A;  3VJC A;  3WCJ A;  4DWG A;  3PYA A;  3N45 F;  5I1U A;  3BNX A;  3N5J F;  4K10 A;  4JXY A;  3WCG A;  3LZ9 A;  1VG2 A;  2ZY1 A;  2ZCQ A;  3P8L A;  2P1C A;  2F92 F;  1N24 A;  5B0L A;  2E94 A;  3KRO A;  5EAT A;  3EFQ A;  2PS4 A;  5DJV F;  2Z7H A;  5IKA A;  2EWG A;  5IL8 A;  4RNQ A;  3VJB A;  5IKH A;  4LUU A;  5B01 A;  2F89 F;  4DZW A;  3ACW A;  3B7L A;  3N0G A;  4NKF A;  4F62 A;  2F8C F;  5IVG A;  5IN8 A;  1HXG A;  3N5H F;  3ADZ A;  4LPH F;  4GP2 A;  2AZL A;  3PYB A;  5DZ2 A;  3KRF B;  1YYR A;  3LLW A;  2PS8 A;  1KIZ A;  3WCB A;  1N21 A;  3NPK A;  5DGM F;  4OMG A;  1WL0 A;  3Q2Z A;  1WKZ A;  3Q2Q A;  2E95 A;  3WCF A;  4LTV A;  4QPF A;  5ERN A;  3Q30 A;  2Z4V A;  3V66 A;  4NUA A;  1V4K A;  2Z7I A;  3WCD A;  2AEL A;  3OAB A;  4JZB A;  4ZQ8 A;  4RXD A;  4P0W A;  1N22 A;  2E4O A;  4LA5 A;  3TS7 A;  1YHL A;  2VF6 A;  3WCA A;  3ASX A;  1ZW5 A;  3WEF A;  4DHD A;  5KSX F;  3SAE A;  3SDT A;  1WL3 A;  1WY0 A;  4LZC A;  3AQB B;  2E90 A;  2ONH A;  1HX9 A;  2AZK A;  4KQU A;  2DH4 A;  3M9U A;  5B03 A;  3M0G A;  5CG5 A;  2Z4X A;  3CC9 A;  1V4E A;  2ZCR A;  1YHK A;  4EA1 A;  2J1O A;  3WCC A;  3WJK A;  5AHU B;  3N49 F;  3WEK A;  3N0F A;  1VG7 A;  2FOR A;  4GA3 A;  3LMD A;  4XQR F;  1JFG A;  3ZMC A;  1DI1 A;  4HD1 A;  3LOM A;  5DHK A;  5DGS F;  4OMH A;  4KVD A;  2Z4W A;  2E93 A;  4UMJ A;  5DJR F;  3KRF A;  5ILJ A;  4DXJ A;  3KRA B;  2Z50 A;  4KVW A;  3RBM A;  1HM7 A;  4NKE A;  1RQJ A;  4F6V A;  3WEJ A;  3WC9 A;  3ICN A;  4XQS F;  3MAV A;  4XQT F;  2OGD A;  3WE9 A;  3V1X A;  4P0X A;  3SDV A;  3VJ8 A;  2E8U A;  5AEL A;  5JV1 F;  5ILY A;  5B0I A;  4OGU A;  4E9U A;  3OAC B;  3TFN A;  5ILZ A;  3TFV A;  4LOB A;  1WL1 A;  4EA0 A;  2PS5 A;  5ILI A;  5A0J A;  4N9U A;  5A0I A;  3LJI A;  4DI5 A;  4LFE A;  2Q80 A;  3S9V A;  5B0J A;  3VJA A;  5IK9 A;  5IK6 A;  5EAU A;  4L2X F;  4JXN A;  4E1E A;  5ILD A;  1V4I A;  3APZ A;  4H5E F;  5ERO A;  1N1B A;  2PS7 A;  4KKM A;  4KQS A;  3WCL A;  3LDW A;  3SDU A;  3WCI A;  4OKZ A;  4KVY A;  3WSA A;  3N46 F;  3KRC A;  3WCE A;  3WJO A;  4PVY F;  3P41 A;  2Q58 A;  3DYH A;  2QIS A;  3WEG A;  3M01 A;  3LSN A;  5AYP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...