5B00A

Structure of the prenyltransferase moen5 in complex with geranyl pyrophosphate
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
261
structure length
261
Chain Sequence
YFQSMLAAEAANRDHVTRCVAQTGGSPDLVAHTAALRLYLRVPHFLTEWTTDPDRRAAVSRALALDIVSMKLLDDLMDDDTGLDRVELACVCLRLHLRALHELESLARDPKAVTDILEQDAVHLCGGQIRTKRSRATNLREWRAHASTYGSTFLGRYGALAAACGGEGQPADSVREFAEAFAMTITMADDLTDYDRNGERDGNLAHLMRTGAVAGQDVVDLLEELRGRALAAVAAPPGAPGLVPVVHLYTDDVLVRLLPRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MoeN5
publication title Moenomycin Biosynthesis: Structure and Mechanism of Action of the Prenyltransferase MoeN5.
pubmed doi rcsb
source organism Streptomyces ghanaensis
total genus 103
structure length 261
sequence length 261
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 5b00A00
2AZJA 1V4EA 3EZ3A 5KSXF 3N49F 2Z7IA 2Z78A 3IBAA 4KQUA 4NFKF 4H5DF 1YHMA 2Z4VA 2E8XA 5IMNA 1KIZA 2J5CA 3Q2QA 3G4DA 3LOMA 5ILDA 2AZKA 1HM4A 3WCGA 3NPKA 4PVXF 3VJEA 5ILHA 5IL3A 2PS8A 3NPRA 4LTZA 1HXCA 5EROA 4LOBA 3RYWA 4LA6A 4LA5A 5H9DA 3ACYA 3M00A 3KROA 4KUXA 5DGNF 2F8CF 4EA1A 3KRFA 3N0GA 2J1PA 2Z4WA 4RXEA 1V4IA 5B0KA 1WL1A 2E4OA 3M0GA 5JV1F 3N0FA 3WEIA 3AE0A 4E9UA 3VJBA 4DZWA 3N45F 2EWGA 3TFPA 5E8KA 5HN8A 3ACWA 4MC3A 1V4HA 4LPHF 3KB9A 4LXWA 2DH4A 5IN8A 3N1VF 3EFQA 3M01A 1N1BA 2RAHA 3ZL6A 3G4FA 3MZVA 2E91A 3DYGA 2AETA 5IMIA 2J1OA 5I1UA 1WL0A 3WJNA 5JA0F 3N1WF 3WCFA 5HN9A 5DIQF 3WCAA 3BNXA 2ZCRA 4PVYF 5ERMA 3PH7A 4NG6A 3WCEA 5HNAA 2Q80A 2PS4A 3WCJA 3ZOUA 1RQIA 4HD1A 2OPNA 3S4JA 4F62A 1KIYA 3AQ0A 5IK9A 2E8UA 3IPIA 3WSBA 3WEFA 5CG5A 4XQTF 4QPFA 3WCMA 3LGZB 4F6XA 4P0VA 4LLSA 4JVJF 4NKFA 3WCHA 5ILZA 4H5CF 2ZCQA 3ASXA 5AYPA 3OABB 5CG6A 5DJRF 3LLWA 4LFGA 2OPMA 2F9KF 2OGDA 4OMHA 4H5EF 4DWGA 3TFNA 4NFIF 1VG7A 5A0IA 2E94A 5HN7A 3TFVA 3WCIA 2ONGA 3BNYA 3WEKA 2E93A 5IM1A 4E9ZA 1YYTA 1VG3A 4XQSF 2AEKA 2ZEVA 1VG6A 2Q58A 3SDVA 4FP4A 5AFXA 3NF2A 4UMJA 5ERNA 5B01A 3ADZA 3N6KF 1UBXA 4DHDA 4KFAA 4KVWA 3ZMBA 3P8RA 1UBWA 1FPSA 4LFEA 2F8ZF 3WEGA 5A0JA 5B0MA 2FORA 3KRPA 3PDEA 2FTZA 3CP6A 4KK2A 2ZCSA 4OKZA 4OMGA 3TC1A 4F6VA 2PS5A 3LMDA 5DW7A 2E8WA 4KKMA 1YQ7A 2ZY1A 3APZA 3P5PA 2VF6A 1PS1A 4JZXA 3WC9A 4DXJA 3SAEA 5IK6A 1WY0A 2ZCOA 1N20A 5DHKA 4ZQ8A 2Z4ZA 5AELA 1YV5A 2AELA 2F7MF 3LG5A 3OACB 3V1XA 2PS7A 4LLTA 5EATA 2E8VA 2E92A 3LK5A 4QXSF 4KPDA 4JXYA 4RXDA 3OYRA 5IMPA 1WKZA 5ILYA 1YYSA 2O1OA 4KQ5A 4DEMF 5A0KA 3N5JF 1VG2A 3LEEA 3KRCA 3N46F 3WEHA 2E90A 2OA6A 3P41A 1ZW5A 4WK5A 3ZCDA 3PYAA 5B02A 3M02A 4OGUA 4MC8A 2QISA 4KVIA 3EGTA 1UBYA 3SDTA 5JUZF 1WL2A 3LVSA 2PS6A 3V66A 5B03A 4NKEA 3V1VA 4KVYA 4KVDA 1N1ZA 1RTRA 3WE9A 3ICMA 5AHUB 3CKEA 5C05A 1V4JA 3PYBA 3LZ9A 3PKOA 3WCDA 4N1ZF 4FJQA 5IVGA 5DZ2A 4P0WA 3P5RA 5DJVF 3Q2ZA 4JYXA 5B0JA 2I19A 3M9UA 3SDRA 1DGPA 3KROB 3ICZA 3KRFB 3B7LA 3N3LF 5B0IA 3OABA 4GP2A 3WCLA 2Z50A 5E8HA 4RXCA 1HX9A 3SDQA 1HM7A 4XQRF 3P8LA 5JV0F 3Q30A 3RYEA 3VJCA 3WCBA 4LPGF 1V4KA 1YYUA 5IK0A 5ILJA 3KRAA 3UCAA 3WJOA 1DI1A 2F92F 5DHIA 3WSAA 4L2XF 1RQJA 1WMWA 3S9VA 4NUAA 1YHKA 1HXAA 3LGKA 4LZCA 2Q9ZA 2ONHA 3ZMCA 2ZEUA 4LUUA 3LDWA 4MC0A 3TS7A 2F94F 3LJIA 3RMGA 4EA2A 3KRCB 3QQVA 3ICNA 5DGSF 1N21A 4LZ3A 4KPJA 4LIXA 3ID0A 1N22A 4Q23A 2AZLA 3WJKA 4K10A 4P0XA 1N24A 1N23A 4DI5A 1WL3A 3CC9A 3WEJA 3NRIA 1YYRA 4LTVA 3DYFA 2F89F 5EASA 4N9UA 2E95A 5ILKA 4GAXA 3LSNA 3VJ8A 3DYHA 4KWDA 3VJAA 5B0LA 5E8LA 1EZFA 3Q1OA 4JXNA 5ER8A 3VJ9A 4OKMA 4RNQA 3OACA 5DGMF 5IL8A 4EA0A 5IKHA 2P1CA 1YJ4A 5JV2F 4JZBA 1YYQA 4DWBA 3AQBB 3W7FA 1UBVA 3ICKA 4RXAA 3VJDA 1YHLA 4NFJF 3KBKA 2H8OA 1HXGA 3N5HF 2Q9YA 3ACXA 3SDUA 2Z7HA 4LZ0A 3WCCA 3AQCB 5B00A 2Z4YA 3N3DA 1VG4A 5IKAA 2Z4XA 4GP1A 3QKCA 5DJPF 2E8TA 1JFAA 1JFGA 3MAVA 5ILIA 4RYPA 5EAUA 4GA3A 3KRPB 4LFVF 4KQSA 3KRAB 3RBMA 4E1EA 2Z52A
chains in the Genus database with same CATH superfamily
2AZJA 1V4EA 3EZ3A 5KSXF 3N49F 2Z7IA 2Z78A 3IBAA 4KQUA 4NFKF 4H5DF 1YHMA 2Z4VA 2E8XA 5IMNA 1KIZA 2J5CA 3Q2QA 3G4DA 3LOMA 5ILDA 2AZKA 1HM4A 3WCGA 3NPKA 4PVXF 3VJEA 5ILHA 5IL3A 2PS8A 3NPRA 4LTZA 1HXCA 5EROA 4LOBA 3RYWA 4LA6A 4LA5A 5H9DA 3ACYA 3M00A 3KROA 4KUXA 5DGNF 2F8CF 4EA1A 3KRFA 3N0GA 2J1PA 2Z4WA 4RXEA 1V4IA 5B0KA 1WL1A 2E4OA 3M0GA 5JV1F 3N0FA 3WEIA 3AE0A 4E9UA 3VJBA 4DZWA 3N45F 2EWGA 3TFPA 5E8KA 5HN8A 3ACWA 4MC3A 1V4HA 4LPHF 3KB9A 4LXWA 2DH4A 5IN8A 3N1VF 3EFQA 3M01A 1N1BA 2RAHA 3ZL6A 3G4FA 3MZVA 2E91A 3DYGA 2AETA 5IMIA 2J1OA 5I1UA 1WL0A 3WJNA 5JA0F 3N1WF 3WCFA 5HN9A 5DIQF 3WCAA 3BNXA 2ZCRA 4PVYF 5ERMA 3PH7A 4NG6A 3WCEA 5HNAA 2Q80A 2PS4A 3WCJA 3ZOUA 1RQIA 4HD1A 2OPNA 3S4JA 4F62A 1KIYA 3AQ0A 5IK9A 2E8UA 3IPIA 3WSBA 3WEFA 5CG5A 4XQTF 4QPFA 3WCMA 3LGZB 4F6XA 4P0VA 4LLSA 4JVJF 4NKFA 3WCHA 5ILZA 4H5CF 2ZCQA 3ASXA 5AYPA 3OABB 5CG6A 5DJRF 3LLWA 4LFGA 2OPMA 2F9KF 2OGDA 4OMHA 4H5EF 4DWGA 3TFNA 4NFIF 1VG7A 5A0IA 2E94A 5HN7A 3TFVA 3WCIA 2ONGA 3BNYA 3WEKA 2E93A 5IM1A 4E9ZA 1YYTA 1VG3A 4XQSF 2AEKA 2ZEVA 1VG6A 2Q58A 3SDVA 4FP4A 5AFXA 3NF2A 4UMJA 5ERNA 5B01A 3ADZA 3N6KF 1UBXA 4DHDA 4KFAA 4KVWA 3ZMBA 3P8RA 1UBWA 1FPSA 4LFEA 2F8ZF 3WEGA 5A0JA 5B0MA 2FORA 3KRPA 3PDEA 2FTZA 3CP6A 4KK2A 2ZCSA 4OKZA 4OMGA 3TC1A 4F6VA 2PS5A 3LMDA 5DW7A 2E8WA 4KKMA 1YQ7A 2ZY1A 3APZA 3P5PA 2VF6A 1PS1A 4JZXA 3WC9A 4DXJA 3SAEA 5IK6A 1WY0A 2ZCOA 1N20A 5DHKA 4ZQ8A 2Z4ZA 5AELA 1YV5A 2AELA 2F7MF 3LG5A 3OACB 3V1XA 2PS7A 4LLTA 5EATA 2E8VA 2E92A 3LK5A 4QXSF 4KPDA 4JXYA 4RXDA 3OYRA 5IMPA 1WKZA 5ILYA 1YYSA 2O1OA 4KQ5A 4DEMF 5A0KA 3N5JF 1VG2A 3LEEA 3KRCA 3N46F 3WEHA 2E90A 2OA6A 3P41A 1ZW5A 4WK5A 3ZCDA 3PYAA 5B02A 3M02A 4OGUA 4MC8A 2QISA 4KVIA 3EGTA 1UBYA 3SDTA 5JUZF 1WL2A 3LVSA 2PS6A 3V66A 5B03A 4NKEA 3V1VA 4KVYA 4KVDA 1N1ZA 1RTRA 3WE9A 3ICMA 5AHUB 3CKEA 5C05A 1V4JA 3PYBA 3LZ9A 3PKOA 3WCDA 4N1ZF 4FJQA 5IVGA 5DZ2A 4P0WA 3P5RA 5DJVF 3Q2ZA 4JYXA 5B0JA 2I19A 3M9UA 3SDRA 1DGPA 3KROB 3ICZA 3KRFB 3B7LA 3N3LF 5B0IA 3OABA 4GP2A 3WCLA 2Z50A 5E8HA 4RXCA 1HX9A 3SDQA 1HM7A 4XQRF 3P8LA 5JV0F 3Q30A 3RYEA 3VJCA 3WCBA 4LPGF 1V4KA 1YYUA 5IK0A 5ILJA 3KRAA 3UCAA 3WJOA 1DI1A 2F92F 5DHIA 3WSAA 4L2XF 1RQJA 1WMWA 3S9VA 4NUAA 1YHKA 1HXAA 3LGKA 4LZCA 2Q9ZA 2ONHA 3ZMCA 2ZEUA 4LUUA 3LDWA 4MC0A 3TS7A 2F94F 3LJIA 3RMGA 4EA2A 3KRCB 3QQVA 3ICNA 5DGSF 1N21A 4LZ3A 4KPJA 4LIXA 3ID0A 1N22A 4Q23A 2AZLA 3WJKA 4K10A 4P0XA 1N24A 1N23A 4DI5A 1WL3A 3CC9A 3WEJA 3NRIA 1YYRA 4LTVA 3DYFA 2F89F 5EASA 4N9UA 2E95A 5ILKA 4GAXA 3LSNA 3VJ8A 3DYHA 4KWDA 3VJAA 5B0LA 5E8LA 1EZFA 3Q1OA 4JXNA 5ER8A 3VJ9A 4OKMA 4RNQA 3OACA 5DGMF 5IL8A 4EA0A 5IKHA 2P1CA 1YJ4A 5JV2F 4JZBA 1YYQA 4DWBA 3AQBB 3W7FA 1UBVA 3ICKA 4RXAA 3VJDA 1YHLA 4NFJF 3KBKA 2H8OA 1HXGA 3N5HF 2Q9YA 3ACXA 3SDUA 2Z7HA 4LZ0A 3WCCA 3AQCB 5B00A 2Z4YA 3N3DA 1VG4A 5IKAA 2Z4XA 4GP1A 3QKCA 5DJPF 2E8TA 1JFAA 1JFGA 3MAVA 5ILIA 4RYPA 5EAUA 4GA3A 3KRPB 4LFVF 4KQSA 3KRAB 3RBMA 4E1EA 2Z52A
chains in the Genus database with same CATH topology
2AZJA 1V4EA 3EZ3A 5KSXF 3N49F 2Z7IA 2Z78A 3IBAA 4KQUA 4NFKF 4H5DF 1YHMA 2Z4VA 2E8XA 5IMNA 1KIZA 2J5CA 3Q2QA 3G4DA 3LOMA 5ILDA 2AZKA 1HM4A 3WCGA 3NPKA 4PVXF 3VJEA 5ILHA 5IL3A 2PS8A 3NPRA 4LTZA 1HXCA 5EROA 4LOBA 3RYWA 4LA6A 4LA5A 5H9DA 3ACYA 3M00A 3KROA 4KUXA 5DGNF 2F8CF 4EA1A 3KRFA 3N0GA 2J1PA 2Z4WA 4RXEA 1V4IA 5B0KA 1WL1A 2E4OA 3M0GA 5JV1F 3N0FA 3WEIA 3AE0A 4E9UA 3VJBA 4DZWA 3N45F 2EWGA 3TFPA 5E8KA 5HN8A 3ACWA 4MC3A 1V4HA 4LPHF 3KB9A 4LXWA 2DH4A 5IN8A 3N1VF 3EFQA 3M01A 1N1BA 2RAHA 3ZL6A 3G4FA 3MZVA 2E91A 3DYGA 2AETA 5IMIA 2J1OA 5I1UA 1WL0A 3WJNA 5JA0F 3N1WF 3WCFA 5HN9A 5DIQF 3WCAA 3BNXA 2ZCRA 4PVYF 5ERMA 3PH7A 4NG6A 3WCEA 5HNAA 2Q80A 2PS4A 3WCJA 3ZOUA 1RQIA 4HD1A 2OPNA 3S4JA 4F62A 1KIYA 3AQ0A 5IK9A 2E8UA 3IPIA 3WSBA 3WEFA 5CG5A 4XQTF 4QPFA 3WCMA 3LGZB 4F6XA 4P0VA 4LLSA 4JVJF 4NKFA 3WCHA 5ILZA 4H5CF 2ZCQA 3ASXA 5AYPA 3OABB 5CG6A 5DJRF 3LLWA 4LFGA 2OPMA 2F9KF 2OGDA 4OMHA 4H5EF 4DWGA 3TFNA 4NFIF 1VG7A 5A0IA 2E94A 5HN7A 3TFVA 3WCIA 2ONGA 3BNYA 3WEKA 2E93A 5IM1A 4E9ZA 1YYTA 1VG3A 4XQSF 2AEKA 2ZEVA 1VG6A 2Q58A 3SDVA 4FP4A 5AFXA 3NF2A 4UMJA 5ERNA 5B01A 3ADZA 3N6KF 1UBXA 4DHDA 4KFAA 4KVWA 3ZMBA 3P8RA 1UBWA 1FPSA 4LFEA 2F8ZF 3WEGA 5A0JA 5B0MA 2FORA 3KRPA 3PDEA 2FTZA 3CP6A 4KK2A 2ZCSA 4OKZA 4OMGA 3TC1A 4F6VA 2PS5A 3LMDA 5DW7A 2E8WA 4KKMA 1YQ7A 2ZY1A 3APZA 3P5PA 2VF6A 1PS1A 4JZXA 3WC9A 4DXJA 3SAEA 5IK6A 1WY0A 2ZCOA 1N20A 5DHKA 4ZQ8A 2Z4ZA 5AELA 1YV5A 2AELA 2F7MF 3LG5A 3OACB 3V1XA 2PS7A 4LLTA 5EATA 2E8VA 2E92A 3LK5A 4QXSF 4KPDA 4JXYA 4RXDA 3OYRA 5IMPA 1WKZA 5ILYA 1YYSA 2O1OA 4KQ5A 4DEMF 5A0KA 3N5JF 1VG2A 3LEEA 3KRCA 3N46F 3WEHA 2E90A 2OA6A 3P41A 1ZW5A 4WK5A 3ZCDA 3PYAA 5B02A 3M02A 4OGUA 4MC8A 2QISA 4KVIA 3EGTA 1UBYA 3SDTA 5JUZF 1WL2A 3LVSA 2PS6A 3V66A 5B03A 4NKEA 3V1VA 4KVYA 4KVDA 1N1ZA 1RTRA 3WE9A 3ICMA 5AHUB 3CKEA 5C05A 1V4JA 3PYBA 3LZ9A 3PKOA 3WCDA 4N1ZF 4FJQA 5IVGA 5DZ2A 4P0WA 3P5RA 5DJVF 3Q2ZA 4JYXA 5B0JA 2I19A 3M9UA 3SDRA 1DGPA 3KROB 3ICZA 3KRFB 3B7LA 3N3LF 5B0IA 3OABA 4GP2A 3WCLA 2Z50A 5E8HA 4RXCA 1HX9A 3SDQA 1HM7A 4XQRF 3P8LA 5JV0F 3Q30A 3RYEA 3VJCA 3WCBA 4LPGF 1V4KA 1YYUA 5IK0A 5ILJA 3KRAA 3UCAA 3WJOA 1DI1A 2F92F 5DHIA 3WSAA 4L2XF 1RQJA 1WMWA 3S9VA 4NUAA 1YHKA 1HXAA 3LGKA 4LZCA 2Q9ZA 2ONHA 3ZMCA 2ZEUA 4LUUA 3LDWA 4MC0A 3TS7A 2F94F 3LJIA 3RMGA 4EA2A 3KRCB 3QQVA 3ICNA 5DGSF 1N21A 4LZ3A 4KPJA 4LIXA 3ID0A 1N22A 4Q23A 2AZLA 3WJKA 4K10A 4P0XA 1N24A 1N23A 4DI5A 1WL3A 3CC9A 3WEJA 3NRIA 1YYRA 4LTVA 3DYFA 2F89F 5EASA 4N9UA 2E95A 5ILKA 4GAXA 3LSNA 3VJ8A 3DYHA 4KWDA 3VJAA 5B0LA 5E8LA 1EZFA 3Q1OA 4JXNA 5ER8A 3VJ9A 4OKMA 4RNQA 3OACA 5DGMF 5IL8A 4EA0A 5IKHA 2P1CA 1YJ4A 5JV2F 4JZBA 1YYQA 4DWBA 3AQBB 3W7FA 1UBVA 3ICKA 4RXAA 3VJDA 1YHLA 4NFJF 3KBKA 2H8OA 1HXGA 3N5HF 2Q9YA 3ACXA 3SDUA 2Z7HA 4LZ0A 3WCCA 3AQCB 5B00A 2Z4YA 3N3DA 1VG4A 5IKAA 2Z4XA 4GP1A 3QKCA 5DJPF 2E8TA 1JFAA 1JFGA 3MAVA 5ILIA 4RYPA 5EAUA 4GA3A 3KRPB 4LFVF 4KQSA 3KRAB 3RBMA 4E1EA 2Z52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZJ A;  1V4E A;  3EZ3 A;  5KSX F;  3N49 F;  2Z7I A;  2Z78 A;  3IBA A;  4KQU A;  4NFK F;  4H5D F;  1YHM A;  2Z4V A;  2E8X A;  5IMN A;  1KIZ A;  2J5C A;  3Q2Q A;  3G4D A;  3LOM A;  5ILD A;  2AZK A;  1HM4 A;  3WCG A;  3NPK A;  4PVX F;  3VJE A;  5ILH A;  5IL3 A;  2PS8 A;  3NPR A;  4LTZ A;  1HXC A;  5ERO A;  4LOB A;  3RYW A;  4LA6 A;  4LA5 A;  5H9D A;  3ACY A;  3M00 A;  3KRO A;  4KUX A;  5DGN F;  2F8C F;  4EA1 A;  3KRF A;  3N0G A;  2J1P A;  2Z4W A;  4RXE A;  1V4I A;  5B0K A;  1WL1 A;  2E4O A;  3M0G A;  5JV1 F;  3N0F A;  3WEI A;  3AE0 A;  4E9U A;  3VJB A;  4DZW A;  3N45 F;  2EWG A;  3TFP A;  5E8K A;  5HN8 A;  3ACW A;  4MC3 A;  1V4H A;  4LPH F;  3KB9 A;  4LXW A;  2DH4 A;  5IN8 A;  3N1V F;  3EFQ A;  3M01 A;  1N1B A;  2RAH A;  3ZL6 A;  3G4F A;  3MZV A;  2E91 A;  3DYG A;  2AET A;  5IMI A;  2J1O A;  5I1U A;  1WL0 A;  3WJN A;  5JA0 F;  3N1W F;  3WCF A;  5HN9 A;  5DIQ F;  3WCA A;  3BNX A;  2ZCR A;  4PVY F;  5ERM A;  3PH7 A;  4NG6 A;  3WCE A;  5HNA A;  2Q80 A;  2PS4 A;  3WCJ A;  3ZOU A;  1RQI A;  4HD1 A;  2OPN A;  3S4J A;  4F62 A;  1KIY A;  3AQ0 A;  5IK9 A;  2E8U A;  3IPI A;  3WSB A;  3WEF A;  5CG5 A;  4XQT F;  4QPF A;  3WCM A;  3LGZ B;  4F6X A;  4P0V A;  4LLS A;  4JVJ F;  4NKF A;  3WCH A;  5ILZ A;  4H5C F;  2ZCQ A;  3ASX A;  5AYP A;  3OAB B;  5CG6 A;  5DJR F;  3LLW A;  4LFG A;  2OPM A;  2F9K F;  2OGD A;  4OMH A;  4H5E F;  4DWG A;  3TFN A;  4NFI F;  1VG7 A;  5A0I A;  2E94 A;  5HN7 A;  3TFV A;  3WCI A;  2ONG A;  3BNY A;  3WEK A;  2E93 A;  5IM1 A;  4E9Z A;  1YYT A;  1VG3 A;  4XQS F;  2AEK A;  2ZEV A;  1VG6 A;  2Q58 A;  3SDV A;  4FP4 A;  5AFX A;  3NF2 A;  4UMJ A;  5ERN A;  5B01 A;  3ADZ A;  3N6K F;  1UBX A;  4DHD A;  4KFA A;  4KVW A;  3ZMB A;  3P8R A;  1UBW A;  1FPS A;  4LFE A;  2F8Z F;  3WEG A;  5A0J A;  5B0M A;  2FOR A;  3KRP A;  3PDE A;  2FTZ A;  3CP6 A;  4KK2 A;  2ZCS A;  4OKZ A;  4OMG A;  3TC1 A;  4F6V A;  2PS5 A;  3LMD A;  5DW7 A;  2E8W A;  4KKM A;  1YQ7 A;  2ZY1 A;  3APZ A;  3P5P A;  2VF6 A;  1PS1 A;  4JZX A;  3WC9 A;  4DXJ A;  3SAE A;  5IK6 A;  1WY0 A;  2ZCO A;  1N20 A;  5DHK A;  4ZQ8 A;  2Z4Z A;  5AEL A;  1YV5 A;  2AEL A;  2F7M F;  3LG5 A;  3OAC B;  3V1X A;  2PS7 A;  4LLT A;  5EAT A;  2E8V A;  2E92 A;  3LK5 A;  4QXS F;  4KPD A;  4JXY A;  4RXD A;  3OYR A;  5IMP A;  1WKZ A;  5ILY A;  1YYS A;  2O1O A;  4KQ5 A;  4DEM F;  5A0K A;  3N5J F;  1VG2 A;  3LEE A;  3KRC A;  3N46 F;  3WEH A;  2E90 A;  2OA6 A;  3P41 A;  1ZW5 A;  4WK5 A;  3ZCD A;  3PYA A;  5B02 A;  3M02 A;  4OGU A;  4MC8 A;  2QIS A;  4KVI A;  3EGT A;  1UBY A;  3SDT A;  5JUZ F;  1WL2 A;  3LVS A;  2PS6 A;  3V66 A;  5B03 A;  4NKE A;  3V1V A;  4KVY A;  4KVD A;  1N1Z A;  1RTR A;  3WE9 A;  3ICM A;  5AHU B;  3CKE A;  5C05 A;  1V4J A;  3PYB A;  3LZ9 A;  3PKO A;  3WCD A;  4N1Z F;  4FJQ A;  5IVG A;  5DZ2 A;  4P0W A;  3P5R A;  5DJV F;  3Q2Z A;  4JYX A;  5B0J A;  2I19 A;  3M9U A;  3SDR A;  1DGP A;  3KRO B;  3ICZ A;  3KRF B;  3B7L A;  3N3L F;  5B0I A;  3OAB A;  4GP2 A;  3WCL A;  2Z50 A;  5E8H A;  4RXC A;  1HX9 A;  3SDQ A;  1HM7 A;  4XQR F;  3P8L A;  5JV0 F;  3Q30 A;  3RYE A;  3VJC A;  3WCB A;  4LPG F;  1V4K A;  1YYU A;  5IK0 A;  5ILJ A;  3KRA A;  3UCA A;  3WJO A;  1DI1 A;  2F92 F;  5DHI A;  3WSA A;  4L2X F;  1RQJ A;  1WMW A;  3S9V A;  4NUA A;  1YHK A;  1HXA A;  3LGK A;  4LZC A;  2Q9Z A;  2ONH A;  3ZMC A;  2ZEU A;  4LUU A;  3LDW A;  4MC0 A;  3TS7 A;  2F94 F;  3LJI A;  3RMG A;  4EA2 A;  3KRC B;  3QQV A;  3ICN A;  5DGS F;  1N21 A;  4LZ3 A;  4KPJ A;  4LIX A;  3ID0 A;  1N22 A;  4Q23 A;  2AZL A;  3WJK A;  4K10 A;  4P0X A;  1N24 A;  1N23 A;  4DI5 A;  1WL3 A;  3CC9 A;  3WEJ A;  3NRI A;  1YYR A;  4LTV A;  3DYF A;  2F89 F;  5EAS A;  4N9U A;  2E95 A;  5ILK A;  4GAX A;  3LSN A;  3VJ8 A;  3DYH A;  4KWD A;  3VJA A;  5B0L A;  5E8L A;  1EZF A;  3Q1O A;  4JXN A;  5ER8 A;  3VJ9 A;  4OKM A;  4RNQ A;  3OAC A;  5DGM F;  5IL8 A;  4EA0 A;  5IKH A;  2P1C A;  1YJ4 A;  5JV2 F;  4JZB A;  1YYQ A;  4DWB A;  3AQB B;  3W7F A;  1UBV A;  3ICK A;  4RXA A;  3VJD A;  1YHL A;  4NFJ F;  3KBK A;  2H8O A;  1HXG A;  3N5H F;  2Q9Y A;  3ACX A;  3SDU A;  2Z7H A;  4LZ0 A;  3WCC A;  3AQC B;  5B00 A;  2Z4Y A;  3N3D A;  1VG4 A;  5IKA A;  2Z4X A;  4GP1 A;  3QKC A;  5DJP F;  2E8T A;  1JFA A;  1JFG A;  3MAV A;  5ILI A;  4RYP A;  5EAU A;  4GA3 A;  3KRP B;  4LFV F;  4KQS A;  3KRA B;  3RBM A;  4E1E A;  2Z52 A; 
#chains in the Genus database with same CATH topology
 2AZJ A;  1V4E A;  3EZ3 A;  5KSX F;  3N49 F;  2Z7I A;  2Z78 A;  3IBA A;  4KQU A;  4NFK F;  4H5D F;  1YHM A;  2Z4V A;  2E8X A;  5IMN A;  1KIZ A;  2J5C A;  3Q2Q A;  3G4D A;  3LOM A;  5ILD A;  2AZK A;  1HM4 A;  3WCG A;  3NPK A;  4PVX F;  3VJE A;  5ILH A;  5IL3 A;  2PS8 A;  3NPR A;  4LTZ A;  1HXC A;  5ERO A;  4LOB A;  3RYW A;  4LA6 A;  4LA5 A;  5H9D A;  3ACY A;  3M00 A;  3KRO A;  4KUX A;  5DGN F;  2F8C F;  4EA1 A;  3KRF A;  3N0G A;  2J1P A;  2Z4W A;  4RXE A;  1V4I A;  5B0K A;  1WL1 A;  2E4O A;  3M0G A;  5JV1 F;  3N0F A;  3WEI A;  3AE0 A;  4E9U A;  3VJB A;  4DZW A;  3N45 F;  2EWG A;  3TFP A;  5E8K A;  5HN8 A;  3ACW A;  4MC3 A;  1V4H A;  4LPH F;  3KB9 A;  4LXW A;  2DH4 A;  5IN8 A;  3N1V F;  3EFQ A;  3M01 A;  1N1B A;  2RAH A;  3ZL6 A;  3G4F A;  3MZV A;  2E91 A;  3DYG A;  2AET A;  5IMI A;  2J1O A;  5I1U A;  1WL0 A;  3WJN A;  5JA0 F;  3N1W F;  3WCF A;  5HN9 A;  5DIQ F;  3WCA A;  3BNX A;  2ZCR A;  4PVY F;  5ERM A;  3PH7 A;  4NG6 A;  3WCE A;  5HNA A;  2Q80 A;  2PS4 A;  3WCJ A;  3ZOU A;  1RQI A;  4HD1 A;  2OPN A;  3S4J A;  4F62 A;  1KIY A;  3AQ0 A;  5IK9 A;  2E8U A;  3IPI A;  3WSB A;  3WEF A;  5CG5 A;  4XQT F;  4QPF A;  3WCM A;  3LGZ B;  4F6X A;  4P0V A;  4LLS A;  4JVJ F;  4NKF A;  3WCH A;  5ILZ A;  4H5C F;  2ZCQ A;  3ASX A;  5AYP A;  3OAB B;  5CG6 A;  5DJR F;  3LLW A;  4LFG A;  2OPM A;  2F9K F;  2OGD A;  4OMH A;  4H5E F;  4DWG A;  3TFN A;  4NFI F;  1VG7 A;  5A0I A;  2E94 A;  5HN7 A;  3TFV A;  3WCI A;  2ONG A;  3BNY A;  3WEK A;  2E93 A;  5IM1 A;  4E9Z A;  1YYT A;  1VG3 A;  4XQS F;  2AEK A;  2ZEV A;  1VG6 A;  2Q58 A;  3SDV A;  4FP4 A;  5AFX A;  3NF2 A;  4UMJ A;  5ERN A;  5B01 A;  3ADZ A;  3N6K F;  1UBX A;  4DHD A;  4KFA A;  4KVW A;  3ZMB A;  3P8R A;  1UBW A;  1FPS A;  4LFE A;  2F8Z F;  3WEG A;  5A0J A;  5B0M A;  2FOR A;  3KRP A;  3PDE A;  2FTZ A;  3CP6 A;  4KK2 A;  2ZCS A;  4OKZ A;  4OMG A;  3TC1 A;  4F6V A;  2PS5 A;  3LMD A;  5DW7 A;  2E8W A;  4KKM A;  1YQ7 A;  2ZY1 A;  3APZ A;  3P5P A;  2VF6 A;  1PS1 A;  4JZX A;  3WC9 A;  4DXJ A;  3SAE A;  5IK6 A;  1WY0 A;  2ZCO A;  1N20 A;  5DHK A;  4ZQ8 A;  2Z4Z A;  5AEL A;  1YV5 A;  2AEL A;  2F7M F;  3LG5 A;  3OAC B;  3V1X A;  2PS7 A;  4LLT A;  5EAT A;  2E8V A;  2E92 A;  3LK5 A;  4QXS F;  4KPD A;  4JXY A;  4RXD A;  3OYR A;  5IMP A;  1WKZ A;  5ILY A;  1YYS A;  2O1O A;  4KQ5 A;  4DEM F;  5A0K A;  3N5J F;  1VG2 A;  3LEE A;  3KRC A;  3N46 F;  3WEH A;  2E90 A;  2OA6 A;  3P41 A;  1ZW5 A;  4WK5 A;  3ZCD A;  3PYA A;  5B02 A;  3M02 A;  4OGU A;  4MC8 A;  2QIS A;  4KVI A;  3EGT A;  1UBY A;  3SDT A;  5JUZ F;  1WL2 A;  3LVS A;  2PS6 A;  3V66 A;  5B03 A;  4NKE A;  3V1V A;  4KVY A;  4KVD A;  1N1Z A;  1RTR A;  3WE9 A;  3ICM A;  5AHU B;  3CKE A;  5C05 A;  1V4J A;  3PYB A;  3LZ9 A;  3PKO A;  3WCD A;  4N1Z F;  4FJQ A;  5IVG A;  5DZ2 A;  4P0W A;  3P5R A;  5DJV F;  3Q2Z A;  4JYX A;  5B0J A;  2I19 A;  3M9U A;  3SDR A;  1DGP A;  3KRO B;  3ICZ A;  3KRF B;  3B7L A;  3N3L F;  5B0I A;  3OAB A;  4GP2 A;  3WCL A;  2Z50 A;  5E8H A;  4RXC A;  1HX9 A;  3SDQ A;  1HM7 A;  4XQR F;  3P8L A;  5JV0 F;  3Q30 A;  3RYE A;  3VJC A;  3WCB A;  4LPG F;  1V4K A;  1YYU A;  5IK0 A;  5ILJ A;  3KRA A;  3UCA A;  3WJO A;  1DI1 A;  2F92 F;  5DHI A;  3WSA A;  4L2X F;  1RQJ A;  1WMW A;  3S9V A;  4NUA A;  1YHK A;  1HXA A;  3LGK A;  4LZC A;  2Q9Z A;  2ONH A;  3ZMC A;  2ZEU A;  4LUU A;  3LDW A;  4MC0 A;  3TS7 A;  2F94 F;  3LJI A;  3RMG A;  4EA2 A;  3KRC B;  3QQV A;  3ICN A;  5DGS F;  1N21 A;  4LZ3 A;  4KPJ A;  4LIX A;  3ID0 A;  1N22 A;  4Q23 A;  2AZL A;  3WJK A;  4K10 A;  4P0X A;  1N24 A;  1N23 A;  4DI5 A;  1WL3 A;  3CC9 A;  3WEJ A;  3NRI A;  1YYR A;  4LTV A;  3DYF A;  2F89 F;  5EAS A;  4N9U A;  2E95 A;  5ILK A;  4GAX A;  3LSN A;  3VJ8 A;  3DYH A;  4KWD A;  3VJA A;  5B0L A;  5E8L A;  1EZF A;  3Q1O A;  4JXN A;  5ER8 A;  3VJ9 A;  4OKM A;  4RNQ A;  3OAC A;  5DGM F;  5IL8 A;  4EA0 A;  5IKH A;  2P1C A;  1YJ4 A;  5JV2 F;  4JZB A;  1YYQ A;  4DWB A;  3AQB B;  3W7F A;  1UBV A;  3ICK A;  4RXA A;  3VJD A;  1YHL A;  4NFJ F;  3KBK A;  2H8O A;  1HXG A;  3N5H F;  2Q9Y A;  3ACX A;  3SDU A;  2Z7H A;  4LZ0 A;  3WCC A;  3AQC B;  5B00 A;  2Z4Y A;  3N3D A;  1VG4 A;  5IKA A;  2Z4X A;  4GP1 A;  3QKC A;  5DJP F;  2E8T A;  1JFA A;  1JFG A;  3MAV A;  5ILI A;  4RYP A;  5EAU A;  4GA3 A;  3KRP B;  4LFV F;  4KQS A;  3KRA B;  3RBM A;  4E1E A;  2Z52 A; 
#chains in the Genus database with same CATH homology
 2AZJ A;  1V4E A;  3EZ3 A;  5KSX F;  3N49 F;  2Z7I A;  2Z78 A;  3IBA A;  4KQU A;  4NFK F;  4H5D F;  1YHM A;  2Z4V A;  2E8X A;  5IMN A;  1KIZ A;  2J5C A;  3Q2Q A;  3G4D A;  3LOM A;  5ILD A;  2AZK A;  1HM4 A;  3WCG A;  3NPK A;  4PVX F;  3VJE A;  5ILH A;  5IL3 A;  2PS8 A;  3NPR A;  4LTZ A;  1HXC A;  5ERO A;  4LOB A;  3RYW A;  4LA6 A;  4LA5 A;  5H9D A;  3ACY A;  3M00 A;  3KRO A;  4KUX A;  5DGN F;  2F8C F;  4EA1 A;  3KRF A;  3N0G A;  2J1P A;  2Z4W A;  4RXE A;  1V4I A;  5B0K A;  1WL1 A;  2E4O A;  3M0G A;  5JV1 F;  3N0F A;  3WEI A;  3AE0 A;  4E9U A;  3VJB A;  4DZW A;  3N45 F;  2EWG A;  3TFP A;  5E8K A;  5HN8 A;  3ACW A;  4MC3 A;  1V4H A;  4LPH F;  3KB9 A;  4LXW A;  2DH4 A;  5IN8 A;  3N1V F;  3EFQ A;  3M01 A;  1N1B A;  2RAH A;  3ZL6 A;  3G4F A;  3MZV A;  2E91 A;  3DYG A;  2AET A;  5IMI A;  2J1O A;  5I1U A;  1WL0 A;  3WJN A;  5JA0 F;  3N1W F;  3WCF A;  5HN9 A;  5DIQ F;  3WCA A;  3BNX A;  2ZCR A;  4PVY F;  5ERM A;  3PH7 A;  4NG6 A;  3WCE A;  5HNA A;  2Q80 A;  2PS4 A;  3WCJ A;  3ZOU A;  1RQI A;  4HD1 A;  2OPN A;  3S4J A;  4F62 A;  1KIY A;  3AQ0 A;  5IK9 A;  2E8U A;  3IPI A;  3WSB A;  3WEF A;  5CG5 A;  4XQT F;  4QPF A;  3WCM A;  3LGZ B;  4F6X A;  4P0V A;  4LLS A;  4JVJ F;  4NKF A;  3WCH A;  5ILZ A;  4H5C F;  2ZCQ A;  3ASX A;  5AYP A;  3OAB B;  5CG6 A;  5DJR F;  3LLW A;  4LFG A;  2OPM A;  2F9K F;  2OGD A;  4OMH A;  4H5E F;  4DWG A;  3TFN A;  4NFI F;  1VG7 A;  5A0I A;  2E94 A;  5HN7 A;  3TFV A;  3WCI A;  2ONG A;  3BNY A;  3WEK A;  2E93 A;  5IM1 A;  4E9Z A;  1YYT A;  1VG3 A;  4XQS F;  2AEK A;  2ZEV A;  1VG6 A;  2Q58 A;  3SDV A;  4FP4 A;  5AFX A;  3NF2 A;  4UMJ A;  5ERN A;  5B01 A;  3ADZ A;  3N6K F;  1UBX A;  4DHD A;  4KFA A;  4KVW A;  3ZMB A;  3P8R A;  1UBW A;  1FPS A;  4LFE A;  2F8Z F;  3WEG A;  5A0J A;  5B0M A;  2FOR A;  3KRP A;  3PDE A;  2FTZ A;  3CP6 A;  4KK2 A;  2ZCS A;  4OKZ A;  4OMG A;  3TC1 A;  4F6V A;  2PS5 A;  3LMD A;  5DW7 A;  2E8W A;  4KKM A;  1YQ7 A;  2ZY1 A;  3APZ A;  3P5P A;  2VF6 A;  1PS1 A;  4JZX A;  3WC9 A;  4DXJ A;  3SAE A;  5IK6 A;  1WY0 A;  2ZCO A;  1N20 A;  5DHK A;  4ZQ8 A;  2Z4Z A;  5AEL A;  1YV5 A;  2AEL A;  2F7M F;  3LG5 A;  3OAC B;  3V1X A;  2PS7 A;  4LLT A;  5EAT A;  2E8V A;  2E92 A;  3LK5 A;  4QXS F;  4KPD A;  4JXY A;  4RXD A;  3OYR A;  5IMP A;  1WKZ A;  5ILY A;  1YYS A;  2O1O A;  4KQ5 A;  4DEM F;  5A0K A;  3N5J F;  1VG2 A;  3LEE A;  3KRC A;  3N46 F;  3WEH A;  2E90 A;  2OA6 A;  3P41 A;  1ZW5 A;  4WK5 A;  3ZCD A;  3PYA A;  5B02 A;  3M02 A;  4OGU A;  4MC8 A;  2QIS A;  4KVI A;  3EGT A;  1UBY A;  3SDT A;  5JUZ F;  1WL2 A;  3LVS A;  2PS6 A;  3V66 A;  5B03 A;  4NKE A;  3V1V A;  4KVY A;  4KVD A;  1N1Z A;  1RTR A;  3WE9 A;  3ICM A;  5AHU B;  3CKE A;  5C05 A;  1V4J A;  3PYB A;  3LZ9 A;  3PKO A;  3WCD A;  4N1Z F;  4FJQ A;  5IVG A;  5DZ2 A;  4P0W A;  3P5R A;  5DJV F;  3Q2Z A;  4JYX A;  5B0J A;  2I19 A;  3M9U A;  3SDR A;  1DGP A;  3KRO B;  3ICZ A;  3KRF B;  3B7L A;  3N3L F;  5B0I A;  3OAB A;  4GP2 A;  3WCL A;  2Z50 A;  5E8H A;  4RXC A;  1HX9 A;  3SDQ A;  1HM7 A;  4XQR F;  3P8L A;  5JV0 F;  3Q30 A;  3RYE A;  3VJC A;  3WCB A;  4LPG F;  1V4K A;  1YYU A;  5IK0 A;  5ILJ A;  3KRA A;  3UCA A;  3WJO A;  1DI1 A;  2F92 F;  5DHI A;  3WSA A;  4L2X F;  1RQJ A;  1WMW A;  3S9V A;  4NUA A;  1YHK A;  1HXA A;  3LGK A;  4LZC A;  2Q9Z A;  2ONH A;  3ZMC A;  2ZEU A;  4LUU A;  3LDW A;  4MC0 A;  3TS7 A;  2F94 F;  3LJI A;  3RMG A;  4EA2 A;  3KRC B;  3QQV A;  3ICN A;  5DGS F;  1N21 A;  4LZ3 A;  4KPJ A;  4LIX A;  3ID0 A;  1N22 A;  4Q23 A;  2AZL A;  3WJK A;  4K10 A;  4P0X A;  1N24 A;  1N23 A;  4DI5 A;  1WL3 A;  3CC9 A;  3WEJ A;  3NRI A;  1YYR A;  4LTV A;  3DYF A;  2F89 F;  5EAS A;  4N9U A;  2E95 A;  5ILK A;  4GAX A;  3LSN A;  3VJ8 A;  3DYH A;  4KWD A;  3VJA A;  5B0L A;  5E8L A;  1EZF A;  3Q1O A;  4JXN A;  5ER8 A;  3VJ9 A;  4OKM A;  4RNQ A;  3OAC A;  5DGM F;  5IL8 A;  4EA0 A;  5IKH A;  2P1C A;  1YJ4 A;  5JV2 F;  4JZB A;  1YYQ A;  4DWB A;  3AQB B;  3W7F A;  1UBV A;  3ICK A;  4RXA A;  3VJD A;  1YHL A;  4NFJ F;  3KBK A;  2H8O A;  1HXG A;  3N5H F;  2Q9Y A;  3ACX A;  3SDU A;  2Z7H A;  4LZ0 A;  3WCC A;  3AQC B;  5B00 A;  2Z4Y A;  3N3D A;  1VG4 A;  5IKA A;  2Z4X A;  4GP1 A;  3QKC A;  5DJP F;  2E8T A;  1JFA A;  1JFG A;  3MAV A;  5ILI A;  4RYP A;  5EAU A;  4GA3 A;  3KRP B;  4LFV F;  4KQS A;  3KRA B;  3RBM A;  4E1E A;  2Z52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...