3NPKA

The crystal structure of geranyltranstransferase from campylobacter jejuni
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
281
structure length
265
Chain Sequence
LNLKELFIHHLEKNLPKVESFHPFFNEALALMLKAGGKHFRAQLLLSVVQSNKPELLNQALDVALALEFIHTYSLIHDDLPAMDNADFRRGIPTLHKSYDETTAILVGDALNTEAFLVLSHAHLKDEIKIKLIKTLAFNAGLNGMVIGQAIDCFFEDKRLSLNELEFLHTHKTARLIAAALKMGCEICELNNEESNQIYKLGLKLGLIFQINDDIIDVTNSFVNLLGLEQAIKTKENLLNECEQDLEKLNEKLAQMIQNLIIQYL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title The crystal structure of geranyltranstransferase from Campylobacter jejuni
rcsb
source organism Campylobacter jejuni
total genus 98
structure length 265
sequence length 281
chains with identical sequence B
ec nomenclature ec 2.5.1.10: (2E,6E)-farnesyl diphosphate synthase.
pdb deposition date 2010-06-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3npkA00
1YHKA 1N21A 3N1WF 3Q1OA 3SDVA 2E93A 3LG5A 1WY0A 2F8CF 4OMHA 3NPRA 4KQ5A 5ILKA 4OMGA 3G4FA 3WEFA 4N1ZF 1V4HA 5DJRF 3V66A 3WEGA 5B03A 4LZ3A 3ICKA 3WCMA 4FJQA 3ICMA 3ACWA 4LFGA 3IPIA 2ZCOA 4H5DF 4PVYF 5JUZF 4LLSA 1RQJA 3M9UA 2AETA 2E4OA 2OA6A 4RXEA 3AQ0A 1KIYA 2E94A 3VJDA 4RXCA 3WCLA 3N5HF 3WJOA 5E8KA 4LTZA 5DGSF 2ZCQA 3WJNA 2J1PA 2Z4ZA 4K10A 2E8TA 3ASXA 3SDQA 3V1XA 5DHIA 3KRFA 5AELA 1KIZA 5IKHA 3WCJA 1HXAA 3SAEA 4H5EF 2E8XA 3PYBA 2AZJA 4KVDA 4EA0A 3OYRA 5I1UA 1RQIA 4WK5A 1YHLA 1HM4A 2PS8A 3ICNA 3SDUA 5A0KA 2E91A 4LPHF 3N49F 4DWBA 4KUXA 1WKZA 3W7FA 4MC3A 5HN9A 2ZY1A 4QPFA 4LFVF 3AE0A 4XQRF 3PDEA 4NKEA 2FTZA 4KPJA 3KRFB 4EA1A 3UCAA 4KVYA 4FP4A 1HXGA 3N6KF 3WCEA 3LZ9A 2AEKA 4DHDA 4KQSA 2E8WA 4NUAA 5B0IA 3LVSA 4OKZA 5HN8A 2ZCRA 1YV5A 1WL2A 1N1ZA 4F6XA 3N46F 4LUUA 3P8RA 3NRIA 3ZMBA 5ILHA 1WL1A 4KQUA 4MC8A 5DGNF 3WEKA 4GAXA 4RYPA 2Z4YA 1UBWA 1FPSA 3P8LA 4NKFA 4DI5A 1VG4A 2PS7A 4LA6A 3WSAA 3S4JA 1HX9A 3TFVA 5IN8A 4MC0A 2ZEUA 5IVGA 5B0MA 3CP6A 1WMWA 1JFAA 2VF6A 5DJVF 1UBXA 5EASA 3VJ9A 4JZXA 2I19A 2Z50A 1YJ4A 2PS5A 3B7LA 5B0KA 4KVWA 4UMJA 5ILJA 4E9UA 3WCBA 5H9DA 1YYSA 5B0JA 4KWDA 5IMIA 5B0LA 3N3LF 5JV1F 4NFJF 5AYPA 1UBVA 4F6VA 1V4IA 1V4EA 1DGPA 2Z7HA 4P0XA 5A0IA 3LGKA 3P5RA 5ILYA 3ACYA 2F94F 2E92A 4OGUA 3RYWA 1V4JA 3LEEA 4QXSF 3LGZB 3TS7A 2F92F 5IK9A 4JXNA 3N0GA 3KRPA 3PH7A 5B01A 2Z78A 2ONHA 3BNYA 4RNQA 5C05A 3V1VA 3SDTA 4Q23A 4JZBA 4GP2A 3VJAA 1HXCA 3CC9A 3Q30A 5EROA 5ERNA 4LIXA 5IL8A 3WCHA 3ACXA 5ILDA 2E8VA 3NF2A 3P5PA 1YYTA 1YHMA 2OGDA 1V4KA 1VG7A 1EZFA 2OPMA 5ILZA 3M02A 1YYRA 1N22A 4EA2A 3MZVA 5E8HA 4LFEA 3DYGA 3MAVA 3M01A 3KRPB 3WJKA 1N23A 3Q2QA 4HD1A 5ER8A 1ZW5A 3WCGA 4PVXF 3M00A 3LMDA 3OABA 4DXJA 4LXWA 2ONGA 3WE9A 5CG5A 3KRAA 4H5CF 5IMNA 2F8ZF 3P41A 1RTRA 1VG6A 4XQTF 3KB9A 3G4DA 3VJ8A 3NPKA 2F89F 1VG3A 3N5JF 4LLTA 4F62A 2Z52A 4JVJF 1N24A 2E95A 1YYUA 3KRCA 4E9ZA 2FORA 3WEJA 2E90A 1YYQA 4JYXA 1WL3A 5KSXF 4OKMA 3KBKA 3WCAA 5IK0A 3OABB 3PKOA 5DZ2A 4KFAA 2Q9ZA 5DJPF 3KRAB 5EAUA 4KKMA 4N9UA 3N45F 3EGTA 5B00A 5JA0F 4NFKF 2AZLA 3ZOUA 3BNXA 2J5CA 3WCCA 5A0JA 2OPNA 2ZEVA 2Z4XA 3ICZA 3KRCB 2Z4VA 2Z7IA 1JFGA 4GA3A 3LLWA 3CKEA 4RXDA 2RAHA 2AZKA 4LTVA 2Q9YA 2PS4A 3ID0A 3M0GA 4LPGF 5AHUB 4JXYA 3VJCA 3RMGA 4LZCA 3N3DA 3TFNA 5DHKA 3SDRA 3LDWA 3VJBA 3Q2ZA 2Z4WA 3VJEA 1HM7A 5IKAA 5CG6A 3DYHA 3TFPA 3AQBB 3LSNA 1N20A 5HN7A 3ADZA 3ZCDA 5EATA 1UBYA 2ZCSA 4DEMF 5HNAA 2H8OA 3WCDA 4DZWA 2Q58A 3OACA 4P0VA 2QISA 2Q80A 5B02A 4DWGA 5ERMA 3IBAA 4KK2A 4L2XF 3ZL6A 3RBMA 3QQVA 3EZ3A 5E8LA 3LJIA 5IL3A 5JV0F 2J1OA 3WEHA 4LA5A 3QKCA 4NG6A 3S9VA 2O1OA 3KROA 2DH4A 5DIQF 1DI1A 4E1EA 5JV2F 3RYEA 4KVIA 4NFIF 5AFXA 4P0WA 3LOMA 5IM1A 2EWGA 3APZA 2F7MF 3DYFA 1YQ7A 3WCIA 3TC1A 3OACB 5IMPA 1VG2A 1N1BA 4GP1A 5ILIA 5DW7A 4KPDA 3N1VF 4ZQ8A 4LZ0A 3WCFA 3WSBA 3N0FA 3PYAA 5IK6A 3WC9A 2F9KF 3EFQA 3LK5A 3AQCB 4XQSF 2PS6A 4LOBA 5DGMF 3WEIA 1PS1A 3KROB 1WL0A 2E8UA 3ZMCA 2AELA 2P1CA 4RXAA
chains in the Genus database with same CATH superfamily
1YHKA 1N21A 3N1WF 3Q1OA 3SDVA 2E93A 3LG5A 1WY0A 2F8CF 4OMHA 3NPRA 4KQ5A 5ILKA 4OMGA 3G4FA 3WEFA 4N1ZF 1V4HA 5DJRF 3V66A 3WEGA 5B03A 4LZ3A 3ICKA 3WCMA 4FJQA 3ICMA 3ACWA 4LFGA 3IPIA 2ZCOA 4H5DF 4PVYF 5JUZF 4LLSA 1RQJA 3M9UA 2AETA 2E4OA 2OA6A 4RXEA 3AQ0A 1KIYA 2E94A 3VJDA 4RXCA 3WCLA 3N5HF 3WJOA 5E8KA 4LTZA 5DGSF 2ZCQA 3WJNA 2J1PA 2Z4ZA 4K10A 2E8TA 3ASXA 3SDQA 3V1XA 5DHIA 3KRFA 5AELA 1KIZA 5IKHA 3WCJA 1HXAA 3SAEA 4H5EF 2E8XA 3PYBA 2AZJA 4KVDA 4EA0A 3OYRA 5I1UA 1RQIA 4WK5A 1YHLA 1HM4A 2PS8A 3ICNA 3SDUA 5A0KA 2E91A 4LPHF 3N49F 4DWBA 4KUXA 1WKZA 3W7FA 4MC3A 5HN9A 2ZY1A 4QPFA 4LFVF 3AE0A 4XQRF 3PDEA 4NKEA 2FTZA 4KPJA 3KRFB 4EA1A 3UCAA 4KVYA 4FP4A 1HXGA 3N6KF 3WCEA 3LZ9A 2AEKA 4DHDA 4KQSA 2E8WA 4NUAA 5B0IA 3LVSA 4OKZA 5HN8A 2ZCRA 1YV5A 1WL2A 1N1ZA 4F6XA 3N46F 4LUUA 3P8RA 3NRIA 3ZMBA 5ILHA 1WL1A 4KQUA 4MC8A 5DGNF 3WEKA 4GAXA 4RYPA 2Z4YA 1UBWA 1FPSA 3P8LA 4NKFA 4DI5A 1VG4A 2PS7A 4LA6A 3WSAA 3S4JA 1HX9A 3TFVA 5IN8A 4MC0A 2ZEUA 5IVGA 5B0MA 3CP6A 1WMWA 1JFAA 2VF6A 5DJVF 1UBXA 5EASA 3VJ9A 4JZXA 2I19A 2Z50A 1YJ4A 2PS5A 3B7LA 5B0KA 4KVWA 4UMJA 5ILJA 4E9UA 3WCBA 5H9DA 1YYSA 5B0JA 4KWDA 5IMIA 5B0LA 3N3LF 5JV1F 4NFJF 5AYPA 1UBVA 4F6VA 1V4IA 1V4EA 1DGPA 2Z7HA 4P0XA 5A0IA 3LGKA 3P5RA 5ILYA 3ACYA 2F94F 2E92A 4OGUA 3RYWA 1V4JA 3LEEA 4QXSF 3LGZB 3TS7A 2F92F 5IK9A 4JXNA 3N0GA 3KRPA 3PH7A 5B01A 2Z78A 2ONHA 3BNYA 4RNQA 5C05A 3V1VA 3SDTA 4Q23A 4JZBA 4GP2A 3VJAA 1HXCA 3CC9A 3Q30A 5EROA 5ERNA 4LIXA 5IL8A 3WCHA 3ACXA 5ILDA 2E8VA 3NF2A 3P5PA 1YYTA 1YHMA 2OGDA 1V4KA 1VG7A 1EZFA 2OPMA 5ILZA 3M02A 1YYRA 1N22A 4EA2A 3MZVA 5E8HA 4LFEA 3DYGA 3MAVA 3M01A 3KRPB 3WJKA 1N23A 3Q2QA 4HD1A 5ER8A 1ZW5A 3WCGA 4PVXF 3M00A 3LMDA 3OABA 4DXJA 4LXWA 2ONGA 3WE9A 5CG5A 3KRAA 4H5CF 5IMNA 2F8ZF 3P41A 1RTRA 1VG6A 4XQTF 3KB9A 3G4DA 3VJ8A 3NPKA 2F89F 1VG3A 3N5JF 4LLTA 4F62A 2Z52A 4JVJF 1N24A 2E95A 1YYUA 3KRCA 4E9ZA 2FORA 3WEJA 2E90A 1YYQA 4JYXA 1WL3A 5KSXF 4OKMA 3KBKA 3WCAA 5IK0A 3OABB 3PKOA 5DZ2A 4KFAA 2Q9ZA 5DJPF 3KRAB 5EAUA 4KKMA 4N9UA 3N45F 3EGTA 5B00A 5JA0F 4NFKF 2AZLA 3ZOUA 3BNXA 2J5CA 3WCCA 5A0JA 2OPNA 2ZEVA 2Z4XA 3ICZA 3KRCB 2Z4VA 2Z7IA 1JFGA 4GA3A 3LLWA 3CKEA 4RXDA 2RAHA 2AZKA 4LTVA 2Q9YA 2PS4A 3ID0A 3M0GA 4LPGF 5AHUB 4JXYA 3VJCA 3RMGA 4LZCA 3N3DA 3TFNA 5DHKA 3SDRA 3LDWA 3VJBA 3Q2ZA 2Z4WA 3VJEA 1HM7A 5IKAA 5CG6A 3DYHA 3TFPA 3AQBB 3LSNA 1N20A 5HN7A 3ADZA 3ZCDA 5EATA 1UBYA 2ZCSA 4DEMF 5HNAA 2H8OA 3WCDA 4DZWA 2Q58A 3OACA 4P0VA 2QISA 2Q80A 5B02A 4DWGA 5ERMA 3IBAA 4KK2A 4L2XF 3ZL6A 3RBMA 3QQVA 3EZ3A 5E8LA 3LJIA 5IL3A 5JV0F 2J1OA 3WEHA 4LA5A 3QKCA 4NG6A 3S9VA 2O1OA 3KROA 2DH4A 5DIQF 1DI1A 4E1EA 5JV2F 3RYEA 4KVIA 4NFIF 5AFXA 4P0WA 3LOMA 5IM1A 2EWGA 3APZA 2F7MF 3DYFA 1YQ7A 3WCIA 3TC1A 3OACB 5IMPA 1VG2A 1N1BA 4GP1A 5ILIA 5DW7A 4KPDA 3N1VF 4ZQ8A 4LZ0A 3WCFA 3WSBA 3N0FA 3PYAA 5IK6A 3WC9A 2F9KF 3EFQA 3LK5A 3AQCB 4XQSF 2PS6A 4LOBA 5DGMF 3WEIA 1PS1A 3KROB 1WL0A 2E8UA 3ZMCA 2AELA 2P1CA 4RXAA
chains in the Genus database with same CATH topology
1YHKA 1N21A 3N1WF 3Q1OA 3SDVA 2E93A 3LG5A 1WY0A 2F8CF 4OMHA 3NPRA 4KQ5A 5ILKA 4OMGA 3G4FA 3WEFA 4N1ZF 1V4HA 5DJRF 3V66A 3WEGA 5B03A 4LZ3A 3ICKA 3WCMA 4FJQA 3ICMA 3ACWA 4LFGA 3IPIA 2ZCOA 4H5DF 4PVYF 5JUZF 4LLSA 1RQJA 3M9UA 2AETA 2E4OA 2OA6A 4RXEA 3AQ0A 1KIYA 2E94A 3VJDA 4RXCA 3WCLA 3N5HF 3WJOA 5E8KA 4LTZA 5DGSF 2ZCQA 3WJNA 2J1PA 2Z4ZA 4K10A 2E8TA 3ASXA 3SDQA 3V1XA 5DHIA 3KRFA 5AELA 1KIZA 5IKHA 3WCJA 1HXAA 3SAEA 4H5EF 2E8XA 3PYBA 2AZJA 4KVDA 4EA0A 3OYRA 5I1UA 1RQIA 4WK5A 1YHLA 1HM4A 2PS8A 3ICNA 3SDUA 5A0KA 2E91A 4LPHF 3N49F 4DWBA 4KUXA 1WKZA 3W7FA 4MC3A 5HN9A 2ZY1A 4QPFA 4LFVF 3AE0A 4XQRF 3PDEA 4NKEA 2FTZA 4KPJA 3KRFB 4EA1A 3UCAA 4KVYA 4FP4A 1HXGA 3N6KF 3WCEA 3LZ9A 2AEKA 4DHDA 4KQSA 2E8WA 4NUAA 5B0IA 3LVSA 4OKZA 5HN8A 2ZCRA 1YV5A 1WL2A 1N1ZA 4F6XA 3N46F 4LUUA 3P8RA 3NRIA 3ZMBA 5ILHA 1WL1A 4KQUA 4MC8A 5DGNF 3WEKA 4GAXA 4RYPA 2Z4YA 1UBWA 1FPSA 3P8LA 4NKFA 4DI5A 1VG4A 2PS7A 4LA6A 3WSAA 3S4JA 1HX9A 3TFVA 5IN8A 4MC0A 2ZEUA 5IVGA 5B0MA 3CP6A 1WMWA 1JFAA 2VF6A 5DJVF 1UBXA 5EASA 3VJ9A 4JZXA 2I19A 2Z50A 1YJ4A 2PS5A 3B7LA 5B0KA 4KVWA 4UMJA 5ILJA 4E9UA 3WCBA 5H9DA 1YYSA 5B0JA 4KWDA 5IMIA 5B0LA 3N3LF 5JV1F 4NFJF 5AYPA 1UBVA 4F6VA 1V4IA 1V4EA 1DGPA 2Z7HA 4P0XA 5A0IA 3LGKA 3P5RA 5ILYA 3ACYA 2F94F 2E92A 4OGUA 3RYWA 1V4JA 3LEEA 4QXSF 3LGZB 3TS7A 2F92F 5IK9A 4JXNA 3N0GA 3KRPA 3PH7A 5B01A 2Z78A 2ONHA 3BNYA 4RNQA 5C05A 3V1VA 3SDTA 4Q23A 4JZBA 4GP2A 3VJAA 1HXCA 3CC9A 3Q30A 5EROA 5ERNA 4LIXA 5IL8A 3WCHA 3ACXA 5ILDA 2E8VA 3NF2A 3P5PA 1YYTA 1YHMA 2OGDA 1V4KA 1VG7A 1EZFA 2OPMA 5ILZA 3M02A 1YYRA 1N22A 4EA2A 3MZVA 5E8HA 4LFEA 3DYGA 3MAVA 3M01A 3KRPB 3WJKA 1N23A 3Q2QA 4HD1A 5ER8A 1ZW5A 3WCGA 4PVXF 3M00A 3LMDA 3OABA 4DXJA 4LXWA 2ONGA 3WE9A 5CG5A 3KRAA 4H5CF 5IMNA 2F8ZF 3P41A 1RTRA 1VG6A 4XQTF 3KB9A 3G4DA 3VJ8A 3NPKA 2F89F 1VG3A 3N5JF 4LLTA 4F62A 2Z52A 4JVJF 1N24A 2E95A 1YYUA 3KRCA 4E9ZA 2FORA 3WEJA 2E90A 1YYQA 4JYXA 1WL3A 5KSXF 4OKMA 3KBKA 3WCAA 5IK0A 3OABB 3PKOA 5DZ2A 4KFAA 2Q9ZA 5DJPF 3KRAB 5EAUA 4KKMA 4N9UA 3N45F 3EGTA 5B00A 5JA0F 4NFKF 2AZLA 3ZOUA 3BNXA 2J5CA 3WCCA 5A0JA 2OPNA 2ZEVA 2Z4XA 3ICZA 3KRCB 2Z4VA 2Z7IA 1JFGA 4GA3A 3LLWA 3CKEA 4RXDA 2RAHA 2AZKA 4LTVA 2Q9YA 2PS4A 3ID0A 3M0GA 4LPGF 5AHUB 4JXYA 3VJCA 3RMGA 4LZCA 3N3DA 3TFNA 5DHKA 3SDRA 3LDWA 3VJBA 3Q2ZA 2Z4WA 3VJEA 1HM7A 5IKAA 5CG6A 3DYHA 3TFPA 3AQBB 3LSNA 1N20A 5HN7A 3ADZA 3ZCDA 5EATA 1UBYA 2ZCSA 4DEMF 5HNAA 2H8OA 3WCDA 4DZWA 2Q58A 3OACA 4P0VA 2QISA 2Q80A 5B02A 4DWGA 5ERMA 3IBAA 4KK2A 4L2XF 3ZL6A 3RBMA 3QQVA 3EZ3A 5E8LA 3LJIA 5IL3A 5JV0F 2J1OA 3WEHA 4LA5A 3QKCA 4NG6A 3S9VA 2O1OA 3KROA 2DH4A 5DIQF 1DI1A 4E1EA 5JV2F 3RYEA 4KVIA 4NFIF 5AFXA 4P0WA 3LOMA 5IM1A 2EWGA 3APZA 2F7MF 3DYFA 1YQ7A 3WCIA 3TC1A 3OACB 5IMPA 1VG2A 1N1BA 4GP1A 5ILIA 5DW7A 4KPDA 3N1VF 4ZQ8A 4LZ0A 3WCFA 3WSBA 3N0FA 3PYAA 5IK6A 3WC9A 2F9KF 3EFQA 3LK5A 3AQCB 4XQSF 2PS6A 4LOBA 5DGMF 3WEIA 1PS1A 3KROB 1WL0A 2E8UA 3ZMCA 2AELA 2P1CA 4RXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YHK A;  1N21 A;  3N1W F;  3Q1O A;  3SDV A;  2E93 A;  3LG5 A;  1WY0 A;  2F8C F;  4OMH A;  3NPR A;  4KQ5 A;  5ILK A;  4OMG A;  3G4F A;  3WEF A;  4N1Z F;  1V4H A;  5DJR F;  3V66 A;  3WEG A;  5B03 A;  4LZ3 A;  3ICK A;  3WCM A;  4FJQ A;  3ICM A;  3ACW A;  4LFG A;  3IPI A;  2ZCO A;  4H5D F;  4PVY F;  5JUZ F;  4LLS A;  1RQJ A;  3M9U A;  2AET A;  2E4O A;  2OA6 A;  4RXE A;  3AQ0 A;  1KIY A;  2E94 A;  3VJD A;  4RXC A;  3WCL A;  3N5H F;  3WJO A;  5E8K A;  4LTZ A;  5DGS F;  2ZCQ A;  3WJN A;  2J1P A;  2Z4Z A;  4K10 A;  2E8T A;  3ASX A;  3SDQ A;  3V1X A;  5DHI A;  3KRF A;  5AEL A;  1KIZ A;  5IKH A;  3WCJ A;  1HXA A;  3SAE A;  4H5E F;  2E8X A;  3PYB A;  2AZJ A;  4KVD A;  4EA0 A;  3OYR A;  5I1U A;  1RQI A;  4WK5 A;  1YHL A;  1HM4 A;  2PS8 A;  3ICN A;  3SDU A;  5A0K A;  2E91 A;  4LPH F;  3N49 F;  4DWB A;  4KUX A;  1WKZ A;  3W7F A;  4MC3 A;  5HN9 A;  2ZY1 A;  4QPF A;  4LFV F;  3AE0 A;  4XQR F;  3PDE A;  4NKE A;  2FTZ A;  4KPJ A;  3KRF B;  4EA1 A;  3UCA A;  4KVY A;  4FP4 A;  1HXG A;  3N6K F;  3WCE A;  3LZ9 A;  2AEK A;  4DHD A;  4KQS A;  2E8W A;  4NUA A;  5B0I A;  3LVS A;  4OKZ A;  5HN8 A;  2ZCR A;  1YV5 A;  1WL2 A;  1N1Z A;  4F6X A;  3N46 F;  4LUU A;  3P8R A;  3NRI A;  3ZMB A;  5ILH A;  1WL1 A;  4KQU A;  4MC8 A;  5DGN F;  3WEK A;  4GAX A;  4RYP A;  2Z4Y A;  1UBW A;  1FPS A;  3P8L A;  4NKF A;  4DI5 A;  1VG4 A;  2PS7 A;  4LA6 A;  3WSA A;  3S4J A;  1HX9 A;  3TFV A;  5IN8 A;  4MC0 A;  2ZEU A;  5IVG A;  5B0M A;  3CP6 A;  1WMW A;  1JFA A;  2VF6 A;  5DJV F;  1UBX A;  5EAS A;  3VJ9 A;  4JZX A;  2I19 A;  2Z50 A;  1YJ4 A;  2PS5 A;  3B7L A;  5B0K A;  4KVW A;  4UMJ A;  5ILJ A;  4E9U A;  3WCB A;  5H9D A;  1YYS A;  5B0J A;  4KWD A;  5IMI A;  5B0L A;  3N3L F;  5JV1 F;  4NFJ F;  5AYP A;  1UBV A;  4F6V A;  1V4I A;  1V4E A;  1DGP A;  2Z7H A;  4P0X A;  5A0I A;  3LGK A;  3P5R A;  5ILY A;  3ACY A;  2F94 F;  2E92 A;  4OGU A;  3RYW A;  1V4J A;  3LEE A;  4QXS F;  3LGZ B;  3TS7 A;  2F92 F;  5IK9 A;  4JXN A;  3N0G A;  3KRP A;  3PH7 A;  5B01 A;  2Z78 A;  2ONH A;  3BNY A;  4RNQ A;  5C05 A;  3V1V A;  3SDT A;  4Q23 A;  4JZB A;  4GP2 A;  3VJA A;  1HXC A;  3CC9 A;  3Q30 A;  5ERO A;  5ERN A;  4LIX A;  5IL8 A;  3WCH A;  3ACX A;  5ILD A;  2E8V A;  3NF2 A;  3P5P A;  1YYT A;  1YHM A;  2OGD A;  1V4K A;  1VG7 A;  1EZF A;  2OPM A;  5ILZ A;  3M02 A;  1YYR A;  1N22 A;  4EA2 A;  3MZV A;  5E8H A;  4LFE A;  3DYG A;  3MAV A;  3M01 A;  3KRP B;  3WJK A;  1N23 A;  3Q2Q A;  4HD1 A;  5ER8 A;  1ZW5 A;  3WCG A;  4PVX F;  3M00 A;  3LMD A;  3OAB A;  4DXJ A;  4LXW A;  2ONG A;  3WE9 A;  5CG5 A;  3KRA A;  4H5C F;  5IMN A;  2F8Z F;  3P41 A;  1RTR A;  1VG6 A;  4XQT F;  3KB9 A;  3G4D A;  3VJ8 A;  3NPK A;  2F89 F;  1VG3 A;  3N5J F;  4LLT A;  4F62 A;  2Z52 A;  4JVJ F;  1N24 A;  2E95 A;  1YYU A;  3KRC A;  4E9Z A;  2FOR A;  3WEJ A;  2E90 A;  1YYQ A;  4JYX A;  1WL3 A;  5KSX F;  4OKM A;  3KBK A;  3WCA A;  5IK0 A;  3OAB B;  3PKO A;  5DZ2 A;  4KFA A;  2Q9Z A;  5DJP F;  3KRA B;  5EAU A;  4KKM A;  4N9U A;  3N45 F;  3EGT A;  5B00 A;  5JA0 F;  4NFK F;  2AZL A;  3ZOU A;  3BNX A;  2J5C A;  3WCC A;  5A0J A;  2OPN A;  2ZEV A;  2Z4X A;  3ICZ A;  3KRC B;  2Z4V A;  2Z7I A;  1JFG A;  4GA3 A;  3LLW A;  3CKE A;  4RXD A;  2RAH A;  2AZK A;  4LTV A;  2Q9Y A;  2PS4 A;  3ID0 A;  3M0G A;  4LPG F;  5AHU B;  4JXY A;  3VJC A;  3RMG A;  4LZC A;  3N3D A;  3TFN A;  5DHK A;  3SDR A;  3LDW A;  3VJB A;  3Q2Z A;  2Z4W A;  3VJE A;  1HM7 A;  5IKA A;  5CG6 A;  3DYH A;  3TFP A;  3AQB B;  3LSN A;  1N20 A;  5HN7 A;  3ADZ A;  3ZCD A;  5EAT A;  1UBY A;  2ZCS A;  4DEM F;  5HNA A;  2H8O A;  3WCD A;  4DZW A;  2Q58 A;  3OAC A;  4P0V A;  2QIS A;  2Q80 A;  5B02 A;  4DWG A;  5ERM A;  3IBA A;  4KK2 A;  4L2X F;  3ZL6 A;  3RBM A;  3QQV A;  3EZ3 A;  5E8L A;  3LJI A;  5IL3 A;  5JV0 F;  2J1O A;  3WEH A;  4LA5 A;  3QKC A;  4NG6 A;  3S9V A;  2O1O A;  3KRO A;  2DH4 A;  5DIQ F;  1DI1 A;  4E1E A;  5JV2 F;  3RYE A;  4KVI A;  4NFI F;  5AFX A;  4P0W A;  3LOM A;  5IM1 A;  2EWG A;  3APZ A;  2F7M F;  3DYF A;  1YQ7 A;  3WCI A;  3TC1 A;  3OAC B;  5IMP A;  1VG2 A;  1N1B A;  4GP1 A;  5ILI A;  5DW7 A;  4KPD A;  3N1V F;  4ZQ8 A;  4LZ0 A;  3WCF A;  3WSB A;  3N0F A;  3PYA A;  5IK6 A;  3WC9 A;  2F9K F;  3EFQ A;  3LK5 A;  3AQC B;  4XQS F;  2PS6 A;  4LOB A;  5DGM F;  3WEI A;  1PS1 A;  3KRO B;  1WL0 A;  2E8U A;  3ZMC A;  2AEL A;  2P1C A;  4RXA A; 
#chains in the Genus database with same CATH topology
 1YHK A;  1N21 A;  3N1W F;  3Q1O A;  3SDV A;  2E93 A;  3LG5 A;  1WY0 A;  2F8C F;  4OMH A;  3NPR A;  4KQ5 A;  5ILK A;  4OMG A;  3G4F A;  3WEF A;  4N1Z F;  1V4H A;  5DJR F;  3V66 A;  3WEG A;  5B03 A;  4LZ3 A;  3ICK A;  3WCM A;  4FJQ A;  3ICM A;  3ACW A;  4LFG A;  3IPI A;  2ZCO A;  4H5D F;  4PVY F;  5JUZ F;  4LLS A;  1RQJ A;  3M9U A;  2AET A;  2E4O A;  2OA6 A;  4RXE A;  3AQ0 A;  1KIY A;  2E94 A;  3VJD A;  4RXC A;  3WCL A;  3N5H F;  3WJO A;  5E8K A;  4LTZ A;  5DGS F;  2ZCQ A;  3WJN A;  2J1P A;  2Z4Z A;  4K10 A;  2E8T A;  3ASX A;  3SDQ A;  3V1X A;  5DHI A;  3KRF A;  5AEL A;  1KIZ A;  5IKH A;  3WCJ A;  1HXA A;  3SAE A;  4H5E F;  2E8X A;  3PYB A;  2AZJ A;  4KVD A;  4EA0 A;  3OYR A;  5I1U A;  1RQI A;  4WK5 A;  1YHL A;  1HM4 A;  2PS8 A;  3ICN A;  3SDU A;  5A0K A;  2E91 A;  4LPH F;  3N49 F;  4DWB A;  4KUX A;  1WKZ A;  3W7F A;  4MC3 A;  5HN9 A;  2ZY1 A;  4QPF A;  4LFV F;  3AE0 A;  4XQR F;  3PDE A;  4NKE A;  2FTZ A;  4KPJ A;  3KRF B;  4EA1 A;  3UCA A;  4KVY A;  4FP4 A;  1HXG A;  3N6K F;  3WCE A;  3LZ9 A;  2AEK A;  4DHD A;  4KQS A;  2E8W A;  4NUA A;  5B0I A;  3LVS A;  4OKZ A;  5HN8 A;  2ZCR A;  1YV5 A;  1WL2 A;  1N1Z A;  4F6X A;  3N46 F;  4LUU A;  3P8R A;  3NRI A;  3ZMB A;  5ILH A;  1WL1 A;  4KQU A;  4MC8 A;  5DGN F;  3WEK A;  4GAX A;  4RYP A;  2Z4Y A;  1UBW A;  1FPS A;  3P8L A;  4NKF A;  4DI5 A;  1VG4 A;  2PS7 A;  4LA6 A;  3WSA A;  3S4J A;  1HX9 A;  3TFV A;  5IN8 A;  4MC0 A;  2ZEU A;  5IVG A;  5B0M A;  3CP6 A;  1WMW A;  1JFA A;  2VF6 A;  5DJV F;  1UBX A;  5EAS A;  3VJ9 A;  4JZX A;  2I19 A;  2Z50 A;  1YJ4 A;  2PS5 A;  3B7L A;  5B0K A;  4KVW A;  4UMJ A;  5ILJ A;  4E9U A;  3WCB A;  5H9D A;  1YYS A;  5B0J A;  4KWD A;  5IMI A;  5B0L A;  3N3L F;  5JV1 F;  4NFJ F;  5AYP A;  1UBV A;  4F6V A;  1V4I A;  1V4E A;  1DGP A;  2Z7H A;  4P0X A;  5A0I A;  3LGK A;  3P5R A;  5ILY A;  3ACY A;  2F94 F;  2E92 A;  4OGU A;  3RYW A;  1V4J A;  3LEE A;  4QXS F;  3LGZ B;  3TS7 A;  2F92 F;  5IK9 A;  4JXN A;  3N0G A;  3KRP A;  3PH7 A;  5B01 A;  2Z78 A;  2ONH A;  3BNY A;  4RNQ A;  5C05 A;  3V1V A;  3SDT A;  4Q23 A;  4JZB A;  4GP2 A;  3VJA A;  1HXC A;  3CC9 A;  3Q30 A;  5ERO A;  5ERN A;  4LIX A;  5IL8 A;  3WCH A;  3ACX A;  5ILD A;  2E8V A;  3NF2 A;  3P5P A;  1YYT A;  1YHM A;  2OGD A;  1V4K A;  1VG7 A;  1EZF A;  2OPM A;  5ILZ A;  3M02 A;  1YYR A;  1N22 A;  4EA2 A;  3MZV A;  5E8H A;  4LFE A;  3DYG A;  3MAV A;  3M01 A;  3KRP B;  3WJK A;  1N23 A;  3Q2Q A;  4HD1 A;  5ER8 A;  1ZW5 A;  3WCG A;  4PVX F;  3M00 A;  3LMD A;  3OAB A;  4DXJ A;  4LXW A;  2ONG A;  3WE9 A;  5CG5 A;  3KRA A;  4H5C F;  5IMN A;  2F8Z F;  3P41 A;  1RTR A;  1VG6 A;  4XQT F;  3KB9 A;  3G4D A;  3VJ8 A;  3NPK A;  2F89 F;  1VG3 A;  3N5J F;  4LLT A;  4F62 A;  2Z52 A;  4JVJ F;  1N24 A;  2E95 A;  1YYU A;  3KRC A;  4E9Z A;  2FOR A;  3WEJ A;  2E90 A;  1YYQ A;  4JYX A;  1WL3 A;  5KSX F;  4OKM A;  3KBK A;  3WCA A;  5IK0 A;  3OAB B;  3PKO A;  5DZ2 A;  4KFA A;  2Q9Z A;  5DJP F;  3KRA B;  5EAU A;  4KKM A;  4N9U A;  3N45 F;  3EGT A;  5B00 A;  5JA0 F;  4NFK F;  2AZL A;  3ZOU A;  3BNX A;  2J5C A;  3WCC A;  5A0J A;  2OPN A;  2ZEV A;  2Z4X A;  3ICZ A;  3KRC B;  2Z4V A;  2Z7I A;  1JFG A;  4GA3 A;  3LLW A;  3CKE A;  4RXD A;  2RAH A;  2AZK A;  4LTV A;  2Q9Y A;  2PS4 A;  3ID0 A;  3M0G A;  4LPG F;  5AHU B;  4JXY A;  3VJC A;  3RMG A;  4LZC A;  3N3D A;  3TFN A;  5DHK A;  3SDR A;  3LDW A;  3VJB A;  3Q2Z A;  2Z4W A;  3VJE A;  1HM7 A;  5IKA A;  5CG6 A;  3DYH A;  3TFP A;  3AQB B;  3LSN A;  1N20 A;  5HN7 A;  3ADZ A;  3ZCD A;  5EAT A;  1UBY A;  2ZCS A;  4DEM F;  5HNA A;  2H8O A;  3WCD A;  4DZW A;  2Q58 A;  3OAC A;  4P0V A;  2QIS A;  2Q80 A;  5B02 A;  4DWG A;  5ERM A;  3IBA A;  4KK2 A;  4L2X F;  3ZL6 A;  3RBM A;  3QQV A;  3EZ3 A;  5E8L A;  3LJI A;  5IL3 A;  5JV0 F;  2J1O A;  3WEH A;  4LA5 A;  3QKC A;  4NG6 A;  3S9V A;  2O1O A;  3KRO A;  2DH4 A;  5DIQ F;  1DI1 A;  4E1E A;  5JV2 F;  3RYE A;  4KVI A;  4NFI F;  5AFX A;  4P0W A;  3LOM A;  5IM1 A;  2EWG A;  3APZ A;  2F7M F;  3DYF A;  1YQ7 A;  3WCI A;  3TC1 A;  3OAC B;  5IMP A;  1VG2 A;  1N1B A;  4GP1 A;  5ILI A;  5DW7 A;  4KPD A;  3N1V F;  4ZQ8 A;  4LZ0 A;  3WCF A;  3WSB A;  3N0F A;  3PYA A;  5IK6 A;  3WC9 A;  2F9K F;  3EFQ A;  3LK5 A;  3AQC B;  4XQS F;  2PS6 A;  4LOB A;  5DGM F;  3WEI A;  1PS1 A;  3KRO B;  1WL0 A;  2E8U A;  3ZMC A;  2AEL A;  2P1C A;  4RXA A; 
#chains in the Genus database with same CATH homology
 1YHK A;  1N21 A;  3N1W F;  3Q1O A;  3SDV A;  2E93 A;  3LG5 A;  1WY0 A;  2F8C F;  4OMH A;  3NPR A;  4KQ5 A;  5ILK A;  4OMG A;  3G4F A;  3WEF A;  4N1Z F;  1V4H A;  5DJR F;  3V66 A;  3WEG A;  5B03 A;  4LZ3 A;  3ICK A;  3WCM A;  4FJQ A;  3ICM A;  3ACW A;  4LFG A;  3IPI A;  2ZCO A;  4H5D F;  4PVY F;  5JUZ F;  4LLS A;  1RQJ A;  3M9U A;  2AET A;  2E4O A;  2OA6 A;  4RXE A;  3AQ0 A;  1KIY A;  2E94 A;  3VJD A;  4RXC A;  3WCL A;  3N5H F;  3WJO A;  5E8K A;  4LTZ A;  5DGS F;  2ZCQ A;  3WJN A;  2J1P A;  2Z4Z A;  4K10 A;  2E8T A;  3ASX A;  3SDQ A;  3V1X A;  5DHI A;  3KRF A;  5AEL A;  1KIZ A;  5IKH A;  3WCJ A;  1HXA A;  3SAE A;  4H5E F;  2E8X A;  3PYB A;  2AZJ A;  4KVD A;  4EA0 A;  3OYR A;  5I1U A;  1RQI A;  4WK5 A;  1YHL A;  1HM4 A;  2PS8 A;  3ICN A;  3SDU A;  5A0K A;  2E91 A;  4LPH F;  3N49 F;  4DWB A;  4KUX A;  1WKZ A;  3W7F A;  4MC3 A;  5HN9 A;  2ZY1 A;  4QPF A;  4LFV F;  3AE0 A;  4XQR F;  3PDE A;  4NKE A;  2FTZ A;  4KPJ A;  3KRF B;  4EA1 A;  3UCA A;  4KVY A;  4FP4 A;  1HXG A;  3N6K F;  3WCE A;  3LZ9 A;  2AEK A;  4DHD A;  4KQS A;  2E8W A;  4NUA A;  5B0I A;  3LVS A;  4OKZ A;  5HN8 A;  2ZCR A;  1YV5 A;  1WL2 A;  1N1Z A;  4F6X A;  3N46 F;  4LUU A;  3P8R A;  3NRI A;  3ZMB A;  5ILH A;  1WL1 A;  4KQU A;  4MC8 A;  5DGN F;  3WEK A;  4GAX A;  4RYP A;  2Z4Y A;  1UBW A;  1FPS A;  3P8L A;  4NKF A;  4DI5 A;  1VG4 A;  2PS7 A;  4LA6 A;  3WSA A;  3S4J A;  1HX9 A;  3TFV A;  5IN8 A;  4MC0 A;  2ZEU A;  5IVG A;  5B0M A;  3CP6 A;  1WMW A;  1JFA A;  2VF6 A;  5DJV F;  1UBX A;  5EAS A;  3VJ9 A;  4JZX A;  2I19 A;  2Z50 A;  1YJ4 A;  2PS5 A;  3B7L A;  5B0K A;  4KVW A;  4UMJ A;  5ILJ A;  4E9U A;  3WCB A;  5H9D A;  1YYS A;  5B0J A;  4KWD A;  5IMI A;  5B0L A;  3N3L F;  5JV1 F;  4NFJ F;  5AYP A;  1UBV A;  4F6V A;  1V4I A;  1V4E A;  1DGP A;  2Z7H A;  4P0X A;  5A0I A;  3LGK A;  3P5R A;  5ILY A;  3ACY A;  2F94 F;  2E92 A;  4OGU A;  3RYW A;  1V4J A;  3LEE A;  4QXS F;  3LGZ B;  3TS7 A;  2F92 F;  5IK9 A;  4JXN A;  3N0G A;  3KRP A;  3PH7 A;  5B01 A;  2Z78 A;  2ONH A;  3BNY A;  4RNQ A;  5C05 A;  3V1V A;  3SDT A;  4Q23 A;  4JZB A;  4GP2 A;  3VJA A;  1HXC A;  3CC9 A;  3Q30 A;  5ERO A;  5ERN A;  4LIX A;  5IL8 A;  3WCH A;  3ACX A;  5ILD A;  2E8V A;  3NF2 A;  3P5P A;  1YYT A;  1YHM A;  2OGD A;  1V4K A;  1VG7 A;  1EZF A;  2OPM A;  5ILZ A;  3M02 A;  1YYR A;  1N22 A;  4EA2 A;  3MZV A;  5E8H A;  4LFE A;  3DYG A;  3MAV A;  3M01 A;  3KRP B;  3WJK A;  1N23 A;  3Q2Q A;  4HD1 A;  5ER8 A;  1ZW5 A;  3WCG A;  4PVX F;  3M00 A;  3LMD A;  3OAB A;  4DXJ A;  4LXW A;  2ONG A;  3WE9 A;  5CG5 A;  3KRA A;  4H5C F;  5IMN A;  2F8Z F;  3P41 A;  1RTR A;  1VG6 A;  4XQT F;  3KB9 A;  3G4D A;  3VJ8 A;  3NPK A;  2F89 F;  1VG3 A;  3N5J F;  4LLT A;  4F62 A;  2Z52 A;  4JVJ F;  1N24 A;  2E95 A;  1YYU A;  3KRC A;  4E9Z A;  2FOR A;  3WEJ A;  2E90 A;  1YYQ A;  4JYX A;  1WL3 A;  5KSX F;  4OKM A;  3KBK A;  3WCA A;  5IK0 A;  3OAB B;  3PKO A;  5DZ2 A;  4KFA A;  2Q9Z A;  5DJP F;  3KRA B;  5EAU A;  4KKM A;  4N9U A;  3N45 F;  3EGT A;  5B00 A;  5JA0 F;  4NFK F;  2AZL A;  3ZOU A;  3BNX A;  2J5C A;  3WCC A;  5A0J A;  2OPN A;  2ZEV A;  2Z4X A;  3ICZ A;  3KRC B;  2Z4V A;  2Z7I A;  1JFG A;  4GA3 A;  3LLW A;  3CKE A;  4RXD A;  2RAH A;  2AZK A;  4LTV A;  2Q9Y A;  2PS4 A;  3ID0 A;  3M0G A;  4LPG F;  5AHU B;  4JXY A;  3VJC A;  3RMG A;  4LZC A;  3N3D A;  3TFN A;  5DHK A;  3SDR A;  3LDW A;  3VJB A;  3Q2Z A;  2Z4W A;  3VJE A;  1HM7 A;  5IKA A;  5CG6 A;  3DYH A;  3TFP A;  3AQB B;  3LSN A;  1N20 A;  5HN7 A;  3ADZ A;  3ZCD A;  5EAT A;  1UBY A;  2ZCS A;  4DEM F;  5HNA A;  2H8O A;  3WCD A;  4DZW A;  2Q58 A;  3OAC A;  4P0V A;  2QIS A;  2Q80 A;  5B02 A;  4DWG A;  5ERM A;  3IBA A;  4KK2 A;  4L2X F;  3ZL6 A;  3RBM A;  3QQV A;  3EZ3 A;  5E8L A;  3LJI A;  5IL3 A;  5JV0 F;  2J1O A;  3WEH A;  4LA5 A;  3QKC A;  4NG6 A;  3S9V A;  2O1O A;  3KRO A;  2DH4 A;  5DIQ F;  1DI1 A;  4E1E A;  5JV2 F;  3RYE A;  4KVI A;  4NFI F;  5AFX A;  4P0W A;  3LOM A;  5IM1 A;  2EWG A;  3APZ A;  2F7M F;  3DYF A;  1YQ7 A;  3WCI A;  3TC1 A;  3OAC B;  5IMP A;  1VG2 A;  1N1B A;  4GP1 A;  5ILI A;  5DW7 A;  4KPD A;  3N1V F;  4ZQ8 A;  4LZ0 A;  3WCF A;  3WSB A;  3N0F A;  3PYA A;  5IK6 A;  3WC9 A;  2F9K F;  3EFQ A;  3LK5 A;  3AQC B;  4XQS F;  2PS6 A;  4LOB A;  5DGM F;  3WEI A;  1PS1 A;  3KRO B;  1WL0 A;  2E8U A;  3ZMC A;  2AEL A;  2P1C A;  4RXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...