3UCAA

Crystal structure of isoprenoid synthase (target efi-501974) from clostridium perfringens
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
291
structure length
274
Chain Sequence
AMNINSLKEEVDQSLKAYFNKDREYNKVLYDSMAYSINVGGKRIRPILMLLSYYIYKSDYKKILTPAMAIEMIHTYSLIHDDLPCMDNDDLRRGKPTNHKVFGEAIAVLAGDALLNEAMKILVDYSLEEGKSALKATKIIADAAGSDGMIGGQIVDIINEDKEEISLKELDYMHLKKTGELIKASIMSGAVLAEASEGDIKKLEGFGYKLGLAFQIKDDILDVVGNNYITIFGLEECKKKCVNITEECIEILSSIKGNTEPLKVLTMKLLERKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Geranyltranstransferase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Clostridium perfringens
total genus 115
structure length 274
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3ucaA00
2E4OA 4DZWA 1PS1A 3P8RA 2AELA 3N3DA 3TS7A 2DH4A 4KK2A 2Q9ZA 3LK5A 3Q30A 3N45F 3VJBA 4KUXA 3P5RA 3N1WF 3Q1OA 1KIZA 3RYWA 1YHLA 4N1ZF 4OMGA 3N5JF 3W7FA 5EATA 2ZEUA 3N3LF 5IMPA 4KQUA 3WCJA 4ZQ8A 2FORA 4PVYF 4DWBA 1WKZA 5ERNA 1HX9A 3BNYA 1V4JA 4KKMA 5ILDA 3ZOUA 3M9UA 1N22A 2E8UA 4JVJF 3EGTA 4QPFA 2OPMA 4NKEA 4KPDA 4RNQA 3WCGA 5IK6A 3WCDA 3RMGA 5DHKA 3APZA 4KVYA 3KROB 3KROA 5AYPA 3ICKA 5A0JA 3LLWA 2ZCOA 1WMWA 5DGSF 4LLSA 1WL3A 3P41A 5I1UA 3ZL6A 3WCIA 3SDQA 4NFJF 4GAXA 3N1VF 3OYRA 4DEMF 4GP1A 4LA6A 5JUZF 1KIYA 2ZCQA 1RQJA 3MZVA 4RXAA 2ZCRA 2E92A 5AELA 1N21A 4LTZA 2E8WA 2ZCSA 3LZ9A 2ZEVA 2PS6A 3RYEA 3WCHA 3EFQA 1WY0A 3CKEA 4LOBA 1ZW5A 2Z4VA 2Z52A 2I19A 3M02A 2F94F 1N24A 1RTRA 5E8HA 1YV5A 3P8LA 3N49F 1WL1A 3SDUA 1DI1A 3OACB 3OACA 3ICZA 4JZXA 5DJVF 3WEIA 5H9DA 5JV1F 2P1CA 4DHDA 3WEJA 1HXAA 3LVSA 3WC9A 3OABB 5AHUB 3KRAB 3OABA 4LIXA 3S4JA 4DI5A 3SDRA 2ONHA 4L2XF 5B0LA 1YHKA 3Q2QA 3DYHA 2E8XA 4RXCA 2F89F 4JYXA 4LFVF 3NF2A 3KRPB 3KRPA 4KQSA 4DWGA 3WJKA 2OA6A 5IMIA 1YYQA 2F9KF 4LFEA 3TC1A 5CG5A 3CC9A 3WEFA 4F6VA 3VJEA 2E95A 5IK9A 1V4HA 3MAVA 4K10A 5A0IA 5HN8A 3PYBA 3QKCA 1V4KA 3N0FA 3AQCB 3QQVA 4RXEA 4FP4A 2Z4YA 1FPSA 5DHIA 4OGUA 5DJPF 3P5PA 4NFKF 3ACXA 4XQTF 4RYPA 5DGNF 5IMNA 3PH7A 3TFPA 4LTVA 3ACYA 3M01A 3LJIA 3WCEA 3WSAA 2Z7HA 4MC3A 5B0JA 2J5CA 1HXCA 2Z4ZA 5ERMA 4MC8A 1VG3A 5E8LA 3SDTA 3PKOA 2F7MF 2Q58A 3LEEA 5ILJA 2O1OA 1YHMA 4H5CF 4GP2A 1UBVA 3ZCDA 3LDWA 4LZ3A 3WCMA 5B0MA 1UBYA 4NKFA 3LGZB 5ILKA 2FTZA 4NG6A 2Q80A 4JXYA 3V1XA 1YQ7A 4KPJA 3SDVA 1VG2A 3AQ0A 2PS5A 4P0XA 3PDEA 1V4EA 1HXGA 4KVDA 3WSBA 5B0KA 3ID0A 4HD1A 1HM7A 5EROA 4LLTA 2J1OA 3CP6A 3WCLA 4H5EF 2H8OA 4EA0A 3WCBA 1N23A 4DXJA 5HN7A 3G4FA 3ICNA 5DW7A 1UBWA 2OPNA 2OGDA 4E9ZA 5ILIA 5ILHA 4KQ5A 3LMDA 2AZKA 3VJ8A 1N20A 3WEKA 5B03A 2ONGA 4XQSF 4WK5A 3WE9A 3M00A 3N6KF 4OKZA 3LSNA 3PYAA 4LXWA 5ILYA 1EZFA 2PS4A 2RAHA 4LZCA 2F8CF 2Z4XA 3UCAA 3NPKA 4LPGF 4EA2A 2E8TA 5DJRF 4RXDA 5DZ2A 4UMJA 1YYUA 4MC0A 5IK0A 2Z4WA 3VJ9A 1N1BA 2VF6A 5IKHA 3KRCB 4LPHF 3KRCA 2E91A 3TFNA 3TFVA 3G4DA 3ZMBA 5C05A 3RBMA 3V66A 4PVXF 5KSXF 4F62A 4FJQA 4QXSF 4P0WA 5AFXA 3ADZA 3AQBB 5CG6A 4XQRF 2ZY1A 2PS7A 1YYSA 5B02A 1HM4A 1JFAA 5E8KA 3DYGA 1UBXA 2EWGA 2E8VA 3S9VA 3WJNA 2Z78A 4P0VA 4E1EA 1VG6A 2AZLA 3NRIA 3N5HF 1DGPA 3IPIA 1YJ4A 5JV0F 3ZMCA 2Q9YA 3KBKA 3IBAA 5DGMF 4F6XA 5B01A 3LOMA 4H5DF 4KWDA 2Z50A 3Q2ZA 3WCFA 5EAUA 2E90A 3LGKA 2AZJA 5IKAA 1VG7A 2PS8A 3WJOA 3VJCA 3NPRA 4LA5A 2J1PA 1V4IA 3BNXA 3SAEA 1WL0A 5IL3A 3N0GA 1WL2A 4NFIF 5ILZA 3WEHA 1VG4A 2Z7IA 3VJDA 5IN8A 3M0GA 4NUAA 3WCCA 3N46F 5HN9A 3WCAA 4KVIA 3WEGA 4EA1A 3LG5A 5IVGA 3VJAA 1JFGA 2QISA 4LFGA 4E9UA 4LUUA 4JXNA 4N9UA 4JZBA 3EZ3A 2AETA 3KB9A 5IL8A 4KFAA 5IM1A 5HNAA 4OKMA 4Q23A 4LZ0A 2AEKA 3KRFB 3KRFA 3V1VA 1YYTA 3ASXA 1RQIA 1YYRA 3AE0A 5A0KA 4GA3A 1N1ZA 3ACWA 5DIQF 2F92F 3KRAA 3ICMA 5ER8A 2E94A 4KVWA 4OMHA 5JA0F 5JV2F 3DYFA 3B7LA 5B00A 2E93A 5B0IA 5EASA 2F8ZF
chains in the Genus database with same CATH superfamily
2E4OA 4DZWA 1PS1A 3P8RA 2AELA 3N3DA 3TS7A 2DH4A 4KK2A 2Q9ZA 3LK5A 3Q30A 3N45F 3VJBA 4KUXA 3P5RA 3N1WF 3Q1OA 1KIZA 3RYWA 1YHLA 4N1ZF 4OMGA 3N5JF 3W7FA 5EATA 2ZEUA 3N3LF 5IMPA 4KQUA 3WCJA 4ZQ8A 2FORA 4PVYF 4DWBA 1WKZA 5ERNA 1HX9A 3BNYA 1V4JA 4KKMA 5ILDA 3ZOUA 3M9UA 1N22A 2E8UA 4JVJF 3EGTA 4QPFA 2OPMA 4NKEA 4KPDA 4RNQA 3WCGA 5IK6A 3WCDA 3RMGA 5DHKA 3APZA 4KVYA 3KROB 3KROA 5AYPA 3ICKA 5A0JA 3LLWA 2ZCOA 1WMWA 5DGSF 4LLSA 1WL3A 3P41A 5I1UA 3ZL6A 3WCIA 3SDQA 4NFJF 4GAXA 3N1VF 3OYRA 4DEMF 4GP1A 4LA6A 5JUZF 1KIYA 2ZCQA 1RQJA 3MZVA 4RXAA 2ZCRA 2E92A 5AELA 1N21A 4LTZA 2E8WA 2ZCSA 3LZ9A 2ZEVA 2PS6A 3RYEA 3WCHA 3EFQA 1WY0A 3CKEA 4LOBA 1ZW5A 2Z4VA 2Z52A 2I19A 3M02A 2F94F 1N24A 1RTRA 5E8HA 1YV5A 3P8LA 3N49F 1WL1A 3SDUA 1DI1A 3OACB 3OACA 3ICZA 4JZXA 5DJVF 3WEIA 5H9DA 5JV1F 2P1CA 4DHDA 3WEJA 1HXAA 3LVSA 3WC9A 3OABB 5AHUB 3KRAB 3OABA 4LIXA 3S4JA 4DI5A 3SDRA 2ONHA 4L2XF 5B0LA 1YHKA 3Q2QA 3DYHA 2E8XA 4RXCA 2F89F 4JYXA 4LFVF 3NF2A 3KRPB 3KRPA 4KQSA 4DWGA 3WJKA 2OA6A 5IMIA 1YYQA 2F9KF 4LFEA 3TC1A 5CG5A 3CC9A 3WEFA 4F6VA 3VJEA 2E95A 5IK9A 1V4HA 3MAVA 4K10A 5A0IA 5HN8A 3PYBA 3QKCA 1V4KA 3N0FA 3AQCB 3QQVA 4RXEA 4FP4A 2Z4YA 1FPSA 5DHIA 4OGUA 5DJPF 3P5PA 4NFKF 3ACXA 4XQTF 4RYPA 5DGNF 5IMNA 3PH7A 3TFPA 4LTVA 3ACYA 3M01A 3LJIA 3WCEA 3WSAA 2Z7HA 4MC3A 5B0JA 2J5CA 1HXCA 2Z4ZA 5ERMA 4MC8A 1VG3A 5E8LA 3SDTA 3PKOA 2F7MF 2Q58A 3LEEA 5ILJA 2O1OA 1YHMA 4H5CF 4GP2A 1UBVA 3ZCDA 3LDWA 4LZ3A 3WCMA 5B0MA 1UBYA 4NKFA 3LGZB 5ILKA 2FTZA 4NG6A 2Q80A 4JXYA 3V1XA 1YQ7A 4KPJA 3SDVA 1VG2A 3AQ0A 2PS5A 4P0XA 3PDEA 1V4EA 1HXGA 4KVDA 3WSBA 5B0KA 3ID0A 4HD1A 1HM7A 5EROA 4LLTA 2J1OA 3CP6A 3WCLA 4H5EF 2H8OA 4EA0A 3WCBA 1N23A 4DXJA 5HN7A 3G4FA 3ICNA 5DW7A 1UBWA 2OPNA 2OGDA 4E9ZA 5ILIA 5ILHA 4KQ5A 3LMDA 2AZKA 3VJ8A 1N20A 3WEKA 5B03A 2ONGA 4XQSF 4WK5A 3WE9A 3M00A 3N6KF 4OKZA 3LSNA 3PYAA 4LXWA 5ILYA 1EZFA 2PS4A 2RAHA 4LZCA 2F8CF 2Z4XA 3UCAA 3NPKA 4LPGF 4EA2A 2E8TA 5DJRF 4RXDA 5DZ2A 4UMJA 1YYUA 4MC0A 5IK0A 2Z4WA 3VJ9A 1N1BA 2VF6A 5IKHA 3KRCB 4LPHF 3KRCA 2E91A 3TFNA 3TFVA 3G4DA 3ZMBA 5C05A 3RBMA 3V66A 4PVXF 5KSXF 4F62A 4FJQA 4QXSF 4P0WA 5AFXA 3ADZA 3AQBB 5CG6A 4XQRF 2ZY1A 2PS7A 1YYSA 5B02A 1HM4A 1JFAA 5E8KA 3DYGA 1UBXA 2EWGA 2E8VA 3S9VA 3WJNA 2Z78A 4P0VA 4E1EA 1VG6A 2AZLA 3NRIA 3N5HF 1DGPA 3IPIA 1YJ4A 5JV0F 3ZMCA 2Q9YA 3KBKA 3IBAA 5DGMF 4F6XA 5B01A 3LOMA 4H5DF 4KWDA 2Z50A 3Q2ZA 3WCFA 5EAUA 2E90A 3LGKA 2AZJA 5IKAA 1VG7A 2PS8A 3WJOA 3VJCA 3NPRA 4LA5A 2J1PA 1V4IA 3BNXA 3SAEA 1WL0A 5IL3A 3N0GA 1WL2A 4NFIF 5ILZA 3WEHA 1VG4A 2Z7IA 3VJDA 5IN8A 3M0GA 4NUAA 3WCCA 3N46F 5HN9A 3WCAA 4KVIA 3WEGA 4EA1A 3LG5A 5IVGA 3VJAA 1JFGA 2QISA 4LFGA 4E9UA 4LUUA 4JXNA 4N9UA 4JZBA 3EZ3A 2AETA 3KB9A 5IL8A 4KFAA 5IM1A 5HNAA 4OKMA 4Q23A 4LZ0A 2AEKA 3KRFB 3KRFA 3V1VA 1YYTA 3ASXA 1RQIA 1YYRA 3AE0A 5A0KA 4GA3A 1N1ZA 3ACWA 5DIQF 2F92F 3KRAA 3ICMA 5ER8A 2E94A 4KVWA 4OMHA 5JA0F 5JV2F 3DYFA 3B7LA 5B00A 2E93A 5B0IA 5EASA 2F8ZF
chains in the Genus database with same CATH topology
2E4OA 4DZWA 1PS1A 3P8RA 2AELA 3N3DA 3TS7A 2DH4A 4KK2A 2Q9ZA 3LK5A 3Q30A 3N45F 3VJBA 4KUXA 3P5RA 3N1WF 3Q1OA 1KIZA 3RYWA 1YHLA 4N1ZF 4OMGA 3N5JF 3W7FA 5EATA 2ZEUA 3N3LF 5IMPA 4KQUA 3WCJA 4ZQ8A 2FORA 4PVYF 4DWBA 1WKZA 5ERNA 1HX9A 3BNYA 1V4JA 4KKMA 5ILDA 3ZOUA 3M9UA 1N22A 2E8UA 4JVJF 3EGTA 4QPFA 2OPMA 4NKEA 4KPDA 4RNQA 3WCGA 5IK6A 3WCDA 3RMGA 5DHKA 3APZA 4KVYA 3KROB 3KROA 5AYPA 3ICKA 5A0JA 3LLWA 2ZCOA 1WMWA 5DGSF 4LLSA 1WL3A 3P41A 5I1UA 3ZL6A 3WCIA 3SDQA 4NFJF 4GAXA 3N1VF 3OYRA 4DEMF 4GP1A 4LA6A 5JUZF 1KIYA 2ZCQA 1RQJA 3MZVA 4RXAA 2ZCRA 2E92A 5AELA 1N21A 4LTZA 2E8WA 2ZCSA 3LZ9A 2ZEVA 2PS6A 3RYEA 3WCHA 3EFQA 1WY0A 3CKEA 4LOBA 1ZW5A 2Z4VA 2Z52A 2I19A 3M02A 2F94F 1N24A 1RTRA 5E8HA 1YV5A 3P8LA 3N49F 1WL1A 3SDUA 1DI1A 3OACB 3OACA 3ICZA 4JZXA 5DJVF 3WEIA 5H9DA 5JV1F 2P1CA 4DHDA 3WEJA 1HXAA 3LVSA 3WC9A 3OABB 5AHUB 3KRAB 3OABA 4LIXA 3S4JA 4DI5A 3SDRA 2ONHA 4L2XF 5B0LA 1YHKA 3Q2QA 3DYHA 2E8XA 4RXCA 2F89F 4JYXA 4LFVF 3NF2A 3KRPB 3KRPA 4KQSA 4DWGA 3WJKA 2OA6A 5IMIA 1YYQA 2F9KF 4LFEA 3TC1A 5CG5A 3CC9A 3WEFA 4F6VA 3VJEA 2E95A 5IK9A 1V4HA 3MAVA 4K10A 5A0IA 5HN8A 3PYBA 3QKCA 1V4KA 3N0FA 3AQCB 3QQVA 4RXEA 4FP4A 2Z4YA 1FPSA 5DHIA 4OGUA 5DJPF 3P5PA 4NFKF 3ACXA 4XQTF 4RYPA 5DGNF 5IMNA 3PH7A 3TFPA 4LTVA 3ACYA 3M01A 3LJIA 3WCEA 3WSAA 2Z7HA 4MC3A 5B0JA 2J5CA 1HXCA 2Z4ZA 5ERMA 4MC8A 1VG3A 5E8LA 3SDTA 3PKOA 2F7MF 2Q58A 3LEEA 5ILJA 2O1OA 1YHMA 4H5CF 4GP2A 1UBVA 3ZCDA 3LDWA 4LZ3A 3WCMA 5B0MA 1UBYA 4NKFA 3LGZB 5ILKA 2FTZA 4NG6A 2Q80A 4JXYA 3V1XA 1YQ7A 4KPJA 3SDVA 1VG2A 3AQ0A 2PS5A 4P0XA 3PDEA 1V4EA 1HXGA 4KVDA 3WSBA 5B0KA 3ID0A 4HD1A 1HM7A 5EROA 4LLTA 2J1OA 3CP6A 3WCLA 4H5EF 2H8OA 4EA0A 3WCBA 1N23A 4DXJA 5HN7A 3G4FA 3ICNA 5DW7A 1UBWA 2OPNA 2OGDA 4E9ZA 5ILIA 5ILHA 4KQ5A 3LMDA 2AZKA 3VJ8A 1N20A 3WEKA 5B03A 2ONGA 4XQSF 4WK5A 3WE9A 3M00A 3N6KF 4OKZA 3LSNA 3PYAA 4LXWA 5ILYA 1EZFA 2PS4A 2RAHA 4LZCA 2F8CF 2Z4XA 3UCAA 3NPKA 4LPGF 4EA2A 2E8TA 5DJRF 4RXDA 5DZ2A 4UMJA 1YYUA 4MC0A 5IK0A 2Z4WA 3VJ9A 1N1BA 2VF6A 5IKHA 3KRCB 4LPHF 3KRCA 2E91A 3TFNA 3TFVA 3G4DA 3ZMBA 5C05A 3RBMA 3V66A 4PVXF 5KSXF 4F62A 4FJQA 4QXSF 4P0WA 5AFXA 3ADZA 3AQBB 5CG6A 4XQRF 2ZY1A 2PS7A 1YYSA 5B02A 1HM4A 1JFAA 5E8KA 3DYGA 1UBXA 2EWGA 2E8VA 3S9VA 3WJNA 2Z78A 4P0VA 4E1EA 1VG6A 2AZLA 3NRIA 3N5HF 1DGPA 3IPIA 1YJ4A 5JV0F 3ZMCA 2Q9YA 3KBKA 3IBAA 5DGMF 4F6XA 5B01A 3LOMA 4H5DF 4KWDA 2Z50A 3Q2ZA 3WCFA 5EAUA 2E90A 3LGKA 2AZJA 5IKAA 1VG7A 2PS8A 3WJOA 3VJCA 3NPRA 4LA5A 2J1PA 1V4IA 3BNXA 3SAEA 1WL0A 5IL3A 3N0GA 1WL2A 4NFIF 5ILZA 3WEHA 1VG4A 2Z7IA 3VJDA 5IN8A 3M0GA 4NUAA 3WCCA 3N46F 5HN9A 3WCAA 4KVIA 3WEGA 4EA1A 3LG5A 5IVGA 3VJAA 1JFGA 2QISA 4LFGA 4E9UA 4LUUA 4JXNA 4N9UA 4JZBA 3EZ3A 2AETA 3KB9A 5IL8A 4KFAA 5IM1A 5HNAA 4OKMA 4Q23A 4LZ0A 2AEKA 3KRFB 3KRFA 3V1VA 1YYTA 3ASXA 1RQIA 1YYRA 3AE0A 5A0KA 4GA3A 1N1ZA 3ACWA 5DIQF 2F92F 3KRAA 3ICMA 5ER8A 2E94A 4KVWA 4OMHA 5JA0F 5JV2F 3DYFA 3B7LA 5B00A 2E93A 5B0IA 5EASA 2F8ZF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4O A;  4DZW A;  1PS1 A;  3P8R A;  2AEL A;  3N3D A;  3TS7 A;  2DH4 A;  4KK2 A;  2Q9Z A;  3LK5 A;  3Q30 A;  3N45 F;  3VJB A;  4KUX A;  3P5R A;  3N1W F;  3Q1O A;  1KIZ A;  3RYW A;  1YHL A;  4N1Z F;  4OMG A;  3N5J F;  3W7F A;  5EAT A;  2ZEU A;  3N3L F;  5IMP A;  4KQU A;  3WCJ A;  4ZQ8 A;  2FOR A;  4PVY F;  4DWB A;  1WKZ A;  5ERN A;  1HX9 A;  3BNY A;  1V4J A;  4KKM A;  5ILD A;  3ZOU A;  3M9U A;  1N22 A;  2E8U A;  4JVJ F;  3EGT A;  4QPF A;  2OPM A;  4NKE A;  4KPD A;  4RNQ A;  3WCG A;  5IK6 A;  3WCD A;  3RMG A;  5DHK A;  3APZ A;  4KVY A;  3KRO B;  3KRO A;  5AYP A;  3ICK A;  5A0J A;  3LLW A;  2ZCO A;  1WMW A;  5DGS F;  4LLS A;  1WL3 A;  3P41 A;  5I1U A;  3ZL6 A;  3WCI A;  3SDQ A;  4NFJ F;  4GAX A;  3N1V F;  3OYR A;  4DEM F;  4GP1 A;  4LA6 A;  5JUZ F;  1KIY A;  2ZCQ A;  1RQJ A;  3MZV A;  4RXA A;  2ZCR A;  2E92 A;  5AEL A;  1N21 A;  4LTZ A;  2E8W A;  2ZCS A;  3LZ9 A;  2ZEV A;  2PS6 A;  3RYE A;  3WCH A;  3EFQ A;  1WY0 A;  3CKE A;  4LOB A;  1ZW5 A;  2Z4V A;  2Z52 A;  2I19 A;  3M02 A;  2F94 F;  1N24 A;  1RTR A;  5E8H A;  1YV5 A;  3P8L A;  3N49 F;  1WL1 A;  3SDU A;  1DI1 A;  3OAC B;  3OAC A;  3ICZ A;  4JZX A;  5DJV F;  3WEI A;  5H9D A;  5JV1 F;  2P1C A;  4DHD A;  3WEJ A;  1HXA A;  3LVS A;  3WC9 A;  3OAB B;  5AHU B;  3KRA B;  3OAB A;  4LIX A;  3S4J A;  4DI5 A;  3SDR A;  2ONH A;  4L2X F;  5B0L A;  1YHK A;  3Q2Q A;  3DYH A;  2E8X A;  4RXC A;  2F89 F;  4JYX A;  4LFV F;  3NF2 A;  3KRP B;  3KRP A;  4KQS A;  4DWG A;  3WJK A;  2OA6 A;  5IMI A;  1YYQ A;  2F9K F;  4LFE A;  3TC1 A;  5CG5 A;  3CC9 A;  3WEF A;  4F6V A;  3VJE A;  2E95 A;  5IK9 A;  1V4H A;  3MAV A;  4K10 A;  5A0I A;  5HN8 A;  3PYB A;  3QKC A;  1V4K A;  3N0F A;  3AQC B;  3QQV A;  4RXE A;  4FP4 A;  2Z4Y A;  1FPS A;  5DHI A;  4OGU A;  5DJP F;  3P5P A;  4NFK F;  3ACX A;  4XQT F;  4RYP A;  5DGN F;  5IMN A;  3PH7 A;  3TFP A;  4LTV A;  3ACY A;  3M01 A;  3LJI A;  3WCE A;  3WSA A;  2Z7H A;  4MC3 A;  5B0J A;  2J5C A;  1HXC A;  2Z4Z A;  5ERM A;  4MC8 A;  1VG3 A;  5E8L A;  3SDT A;  3PKO A;  2F7M F;  2Q58 A;  3LEE A;  5ILJ A;  2O1O A;  1YHM A;  4H5C F;  4GP2 A;  1UBV A;  3ZCD A;  3LDW A;  4LZ3 A;  3WCM A;  5B0M A;  1UBY A;  4NKF A;  3LGZ B;  5ILK A;  2FTZ A;  4NG6 A;  2Q80 A;  4JXY A;  3V1X A;  1YQ7 A;  4KPJ A;  3SDV A;  1VG2 A;  3AQ0 A;  2PS5 A;  4P0X A;  3PDE A;  1V4E A;  1HXG A;  4KVD A;  3WSB A;  5B0K A;  3ID0 A;  4HD1 A;  1HM7 A;  5ERO A;  4LLT A;  2J1O A;  3CP6 A;  3WCL A;  4H5E F;  2H8O A;  4EA0 A;  3WCB A;  1N23 A;  4DXJ A;  5HN7 A;  3G4F A;  3ICN A;  5DW7 A;  1UBW A;  2OPN A;  2OGD A;  4E9Z A;  5ILI A;  5ILH A;  4KQ5 A;  3LMD A;  2AZK A;  3VJ8 A;  1N20 A;  3WEK A;  5B03 A;  2ONG A;  4XQS F;  4WK5 A;  3WE9 A;  3M00 A;  3N6K F;  4OKZ A;  3LSN A;  3PYA A;  4LXW A;  5ILY A;  1EZF A;  2PS4 A;  2RAH A;  4LZC A;  2F8C F;  2Z4X A;  3UCA A;  3NPK A;  4LPG F;  4EA2 A;  2E8T A;  5DJR F;  4RXD A;  5DZ2 A;  4UMJ A;  1YYU A;  4MC0 A;  5IK0 A;  2Z4W A;  3VJ9 A;  1N1B A;  2VF6 A;  5IKH A;  3KRC B;  4LPH F;  3KRC A;  2E91 A;  3TFN A;  3TFV A;  3G4D A;  3ZMB A;  5C05 A;  3RBM A;  3V66 A;  4PVX F;  5KSX F;  4F62 A;  4FJQ A;  4QXS F;  4P0W A;  5AFX A;  3ADZ A;  3AQB B;  5CG6 A;  4XQR F;  2ZY1 A;  2PS7 A;  1YYS A;  5B02 A;  1HM4 A;  1JFA A;  5E8K A;  3DYG A;  1UBX A;  2EWG A;  2E8V A;  3S9V A;  3WJN A;  2Z78 A;  4P0V A;  4E1E A;  1VG6 A;  2AZL A;  3NRI A;  3N5H F;  1DGP A;  3IPI A;  1YJ4 A;  5JV0 F;  3ZMC A;  2Q9Y A;  3KBK A;  3IBA A;  5DGM F;  4F6X A;  5B01 A;  3LOM A;  4H5D F;  4KWD A;  2Z50 A;  3Q2Z A;  3WCF A;  5EAU A;  2E90 A;  3LGK A;  2AZJ A;  5IKA A;  1VG7 A;  2PS8 A;  3WJO A;  3VJC A;  3NPR A;  4LA5 A;  2J1P A;  1V4I A;  3BNX A;  3SAE A;  1WL0 A;  5IL3 A;  3N0G A;  1WL2 A;  4NFI F;  5ILZ A;  3WEH A;  1VG4 A;  2Z7I A;  3VJD A;  5IN8 A;  3M0G A;  4NUA A;  3WCC A;  3N46 F;  5HN9 A;  3WCA A;  4KVI A;  3WEG A;  4EA1 A;  3LG5 A;  5IVG A;  3VJA A;  1JFG A;  2QIS A;  4LFG A;  4E9U A;  4LUU A;  4JXN A;  4N9U A;  4JZB A;  3EZ3 A;  2AET A;  3KB9 A;  5IL8 A;  4KFA A;  5IM1 A;  5HNA A;  4OKM A;  4Q23 A;  4LZ0 A;  2AEK A;  3KRF B;  3KRF A;  3V1V A;  1YYT A;  3ASX A;  1RQI A;  1YYR A;  3AE0 A;  5A0K A;  4GA3 A;  1N1Z A;  3ACW A;  5DIQ F;  2F92 F;  3KRA A;  3ICM A;  5ER8 A;  2E94 A;  4KVW A;  4OMH A;  5JA0 F;  5JV2 F;  3DYF A;  3B7L A;  5B00 A;  2E93 A;  5B0I A;  5EAS A;  2F8Z F; 
#chains in the Genus database with same CATH topology
 2E4O A;  4DZW A;  1PS1 A;  3P8R A;  2AEL A;  3N3D A;  3TS7 A;  2DH4 A;  4KK2 A;  2Q9Z A;  3LK5 A;  3Q30 A;  3N45 F;  3VJB A;  4KUX A;  3P5R A;  3N1W F;  3Q1O A;  1KIZ A;  3RYW A;  1YHL A;  4N1Z F;  4OMG A;  3N5J F;  3W7F A;  5EAT A;  2ZEU A;  3N3L F;  5IMP A;  4KQU A;  3WCJ A;  4ZQ8 A;  2FOR A;  4PVY F;  4DWB A;  1WKZ A;  5ERN A;  1HX9 A;  3BNY A;  1V4J A;  4KKM A;  5ILD A;  3ZOU A;  3M9U A;  1N22 A;  2E8U A;  4JVJ F;  3EGT A;  4QPF A;  2OPM A;  4NKE A;  4KPD A;  4RNQ A;  3WCG A;  5IK6 A;  3WCD A;  3RMG A;  5DHK A;  3APZ A;  4KVY A;  3KRO B;  3KRO A;  5AYP A;  3ICK A;  5A0J A;  3LLW A;  2ZCO A;  1WMW A;  5DGS F;  4LLS A;  1WL3 A;  3P41 A;  5I1U A;  3ZL6 A;  3WCI A;  3SDQ A;  4NFJ F;  4GAX A;  3N1V F;  3OYR A;  4DEM F;  4GP1 A;  4LA6 A;  5JUZ F;  1KIY A;  2ZCQ A;  1RQJ A;  3MZV A;  4RXA A;  2ZCR A;  2E92 A;  5AEL A;  1N21 A;  4LTZ A;  2E8W A;  2ZCS A;  3LZ9 A;  2ZEV A;  2PS6 A;  3RYE A;  3WCH A;  3EFQ A;  1WY0 A;  3CKE A;  4LOB A;  1ZW5 A;  2Z4V A;  2Z52 A;  2I19 A;  3M02 A;  2F94 F;  1N24 A;  1RTR A;  5E8H A;  1YV5 A;  3P8L A;  3N49 F;  1WL1 A;  3SDU A;  1DI1 A;  3OAC B;  3OAC A;  3ICZ A;  4JZX A;  5DJV F;  3WEI A;  5H9D A;  5JV1 F;  2P1C A;  4DHD A;  3WEJ A;  1HXA A;  3LVS A;  3WC9 A;  3OAB B;  5AHU B;  3KRA B;  3OAB A;  4LIX A;  3S4J A;  4DI5 A;  3SDR A;  2ONH A;  4L2X F;  5B0L A;  1YHK A;  3Q2Q A;  3DYH A;  2E8X A;  4RXC A;  2F89 F;  4JYX A;  4LFV F;  3NF2 A;  3KRP B;  3KRP A;  4KQS A;  4DWG A;  3WJK A;  2OA6 A;  5IMI A;  1YYQ A;  2F9K F;  4LFE A;  3TC1 A;  5CG5 A;  3CC9 A;  3WEF A;  4F6V A;  3VJE A;  2E95 A;  5IK9 A;  1V4H A;  3MAV A;  4K10 A;  5A0I A;  5HN8 A;  3PYB A;  3QKC A;  1V4K A;  3N0F A;  3AQC B;  3QQV A;  4RXE A;  4FP4 A;  2Z4Y A;  1FPS A;  5DHI A;  4OGU A;  5DJP F;  3P5P A;  4NFK F;  3ACX A;  4XQT F;  4RYP A;  5DGN F;  5IMN A;  3PH7 A;  3TFP A;  4LTV A;  3ACY A;  3M01 A;  3LJI A;  3WCE A;  3WSA A;  2Z7H A;  4MC3 A;  5B0J A;  2J5C A;  1HXC A;  2Z4Z A;  5ERM A;  4MC8 A;  1VG3 A;  5E8L A;  3SDT A;  3PKO A;  2F7M F;  2Q58 A;  3LEE A;  5ILJ A;  2O1O A;  1YHM A;  4H5C F;  4GP2 A;  1UBV A;  3ZCD A;  3LDW A;  4LZ3 A;  3WCM A;  5B0M A;  1UBY A;  4NKF A;  3LGZ B;  5ILK A;  2FTZ A;  4NG6 A;  2Q80 A;  4JXY A;  3V1X A;  1YQ7 A;  4KPJ A;  3SDV A;  1VG2 A;  3AQ0 A;  2PS5 A;  4P0X A;  3PDE A;  1V4E A;  1HXG A;  4KVD A;  3WSB A;  5B0K A;  3ID0 A;  4HD1 A;  1HM7 A;  5ERO A;  4LLT A;  2J1O A;  3CP6 A;  3WCL A;  4H5E F;  2H8O A;  4EA0 A;  3WCB A;  1N23 A;  4DXJ A;  5HN7 A;  3G4F A;  3ICN A;  5DW7 A;  1UBW A;  2OPN A;  2OGD A;  4E9Z A;  5ILI A;  5ILH A;  4KQ5 A;  3LMD A;  2AZK A;  3VJ8 A;  1N20 A;  3WEK A;  5B03 A;  2ONG A;  4XQS F;  4WK5 A;  3WE9 A;  3M00 A;  3N6K F;  4OKZ A;  3LSN A;  3PYA A;  4LXW A;  5ILY A;  1EZF A;  2PS4 A;  2RAH A;  4LZC A;  2F8C F;  2Z4X A;  3UCA A;  3NPK A;  4LPG F;  4EA2 A;  2E8T A;  5DJR F;  4RXD A;  5DZ2 A;  4UMJ A;  1YYU A;  4MC0 A;  5IK0 A;  2Z4W A;  3VJ9 A;  1N1B A;  2VF6 A;  5IKH A;  3KRC B;  4LPH F;  3KRC A;  2E91 A;  3TFN A;  3TFV A;  3G4D A;  3ZMB A;  5C05 A;  3RBM A;  3V66 A;  4PVX F;  5KSX F;  4F62 A;  4FJQ A;  4QXS F;  4P0W A;  5AFX A;  3ADZ A;  3AQB B;  5CG6 A;  4XQR F;  2ZY1 A;  2PS7 A;  1YYS A;  5B02 A;  1HM4 A;  1JFA A;  5E8K A;  3DYG A;  1UBX A;  2EWG A;  2E8V A;  3S9V A;  3WJN A;  2Z78 A;  4P0V A;  4E1E A;  1VG6 A;  2AZL A;  3NRI A;  3N5H F;  1DGP A;  3IPI A;  1YJ4 A;  5JV0 F;  3ZMC A;  2Q9Y A;  3KBK A;  3IBA A;  5DGM F;  4F6X A;  5B01 A;  3LOM A;  4H5D F;  4KWD A;  2Z50 A;  3Q2Z A;  3WCF A;  5EAU A;  2E90 A;  3LGK A;  2AZJ A;  5IKA A;  1VG7 A;  2PS8 A;  3WJO A;  3VJC A;  3NPR A;  4LA5 A;  2J1P A;  1V4I A;  3BNX A;  3SAE A;  1WL0 A;  5IL3 A;  3N0G A;  1WL2 A;  4NFI F;  5ILZ A;  3WEH A;  1VG4 A;  2Z7I A;  3VJD A;  5IN8 A;  3M0G A;  4NUA A;  3WCC A;  3N46 F;  5HN9 A;  3WCA A;  4KVI A;  3WEG A;  4EA1 A;  3LG5 A;  5IVG A;  3VJA A;  1JFG A;  2QIS A;  4LFG A;  4E9U A;  4LUU A;  4JXN A;  4N9U A;  4JZB A;  3EZ3 A;  2AET A;  3KB9 A;  5IL8 A;  4KFA A;  5IM1 A;  5HNA A;  4OKM A;  4Q23 A;  4LZ0 A;  2AEK A;  3KRF B;  3KRF A;  3V1V A;  1YYT A;  3ASX A;  1RQI A;  1YYR A;  3AE0 A;  5A0K A;  4GA3 A;  1N1Z A;  3ACW A;  5DIQ F;  2F92 F;  3KRA A;  3ICM A;  5ER8 A;  2E94 A;  4KVW A;  4OMH A;  5JA0 F;  5JV2 F;  3DYF A;  3B7L A;  5B00 A;  2E93 A;  5B0I A;  5EAS A;  2F8Z F; 
#chains in the Genus database with same CATH homology
 2E4O A;  4DZW A;  1PS1 A;  3P8R A;  2AEL A;  3N3D A;  3TS7 A;  2DH4 A;  4KK2 A;  2Q9Z A;  3LK5 A;  3Q30 A;  3N45 F;  3VJB A;  4KUX A;  3P5R A;  3N1W F;  3Q1O A;  1KIZ A;  3RYW A;  1YHL A;  4N1Z F;  4OMG A;  3N5J F;  3W7F A;  5EAT A;  2ZEU A;  3N3L F;  5IMP A;  4KQU A;  3WCJ A;  4ZQ8 A;  2FOR A;  4PVY F;  4DWB A;  1WKZ A;  5ERN A;  1HX9 A;  3BNY A;  1V4J A;  4KKM A;  5ILD A;  3ZOU A;  3M9U A;  1N22 A;  2E8U A;  4JVJ F;  3EGT A;  4QPF A;  2OPM A;  4NKE A;  4KPD A;  4RNQ A;  3WCG A;  5IK6 A;  3WCD A;  3RMG A;  5DHK A;  3APZ A;  4KVY A;  3KRO B;  3KRO A;  5AYP A;  3ICK A;  5A0J A;  3LLW A;  2ZCO A;  1WMW A;  5DGS F;  4LLS A;  1WL3 A;  3P41 A;  5I1U A;  3ZL6 A;  3WCI A;  3SDQ A;  4NFJ F;  4GAX A;  3N1V F;  3OYR A;  4DEM F;  4GP1 A;  4LA6 A;  5JUZ F;  1KIY A;  2ZCQ A;  1RQJ A;  3MZV A;  4RXA A;  2ZCR A;  2E92 A;  5AEL A;  1N21 A;  4LTZ A;  2E8W A;  2ZCS A;  3LZ9 A;  2ZEV A;  2PS6 A;  3RYE A;  3WCH A;  3EFQ A;  1WY0 A;  3CKE A;  4LOB A;  1ZW5 A;  2Z4V A;  2Z52 A;  2I19 A;  3M02 A;  2F94 F;  1N24 A;  1RTR A;  5E8H A;  1YV5 A;  3P8L A;  3N49 F;  1WL1 A;  3SDU A;  1DI1 A;  3OAC B;  3OAC A;  3ICZ A;  4JZX A;  5DJV F;  3WEI A;  5H9D A;  5JV1 F;  2P1C A;  4DHD A;  3WEJ A;  1HXA A;  3LVS A;  3WC9 A;  3OAB B;  5AHU B;  3KRA B;  3OAB A;  4LIX A;  3S4J A;  4DI5 A;  3SDR A;  2ONH A;  4L2X F;  5B0L A;  1YHK A;  3Q2Q A;  3DYH A;  2E8X A;  4RXC A;  2F89 F;  4JYX A;  4LFV F;  3NF2 A;  3KRP B;  3KRP A;  4KQS A;  4DWG A;  3WJK A;  2OA6 A;  5IMI A;  1YYQ A;  2F9K F;  4LFE A;  3TC1 A;  5CG5 A;  3CC9 A;  3WEF A;  4F6V A;  3VJE A;  2E95 A;  5IK9 A;  1V4H A;  3MAV A;  4K10 A;  5A0I A;  5HN8 A;  3PYB A;  3QKC A;  1V4K A;  3N0F A;  3AQC B;  3QQV A;  4RXE A;  4FP4 A;  2Z4Y A;  1FPS A;  5DHI A;  4OGU A;  5DJP F;  3P5P A;  4NFK F;  3ACX A;  4XQT F;  4RYP A;  5DGN F;  5IMN A;  3PH7 A;  3TFP A;  4LTV A;  3ACY A;  3M01 A;  3LJI A;  3WCE A;  3WSA A;  2Z7H A;  4MC3 A;  5B0J A;  2J5C A;  1HXC A;  2Z4Z A;  5ERM A;  4MC8 A;  1VG3 A;  5E8L A;  3SDT A;  3PKO A;  2F7M F;  2Q58 A;  3LEE A;  5ILJ A;  2O1O A;  1YHM A;  4H5C F;  4GP2 A;  1UBV A;  3ZCD A;  3LDW A;  4LZ3 A;  3WCM A;  5B0M A;  1UBY A;  4NKF A;  3LGZ B;  5ILK A;  2FTZ A;  4NG6 A;  2Q80 A;  4JXY A;  3V1X A;  1YQ7 A;  4KPJ A;  3SDV A;  1VG2 A;  3AQ0 A;  2PS5 A;  4P0X A;  3PDE A;  1V4E A;  1HXG A;  4KVD A;  3WSB A;  5B0K A;  3ID0 A;  4HD1 A;  1HM7 A;  5ERO A;  4LLT A;  2J1O A;  3CP6 A;  3WCL A;  4H5E F;  2H8O A;  4EA0 A;  3WCB A;  1N23 A;  4DXJ A;  5HN7 A;  3G4F A;  3ICN A;  5DW7 A;  1UBW A;  2OPN A;  2OGD A;  4E9Z A;  5ILI A;  5ILH A;  4KQ5 A;  3LMD A;  2AZK A;  3VJ8 A;  1N20 A;  3WEK A;  5B03 A;  2ONG A;  4XQS F;  4WK5 A;  3WE9 A;  3M00 A;  3N6K F;  4OKZ A;  3LSN A;  3PYA A;  4LXW A;  5ILY A;  1EZF A;  2PS4 A;  2RAH A;  4LZC A;  2F8C F;  2Z4X A;  3UCA A;  3NPK A;  4LPG F;  4EA2 A;  2E8T A;  5DJR F;  4RXD A;  5DZ2 A;  4UMJ A;  1YYU A;  4MC0 A;  5IK0 A;  2Z4W A;  3VJ9 A;  1N1B A;  2VF6 A;  5IKH A;  3KRC B;  4LPH F;  3KRC A;  2E91 A;  3TFN A;  3TFV A;  3G4D A;  3ZMB A;  5C05 A;  3RBM A;  3V66 A;  4PVX F;  5KSX F;  4F62 A;  4FJQ A;  4QXS F;  4P0W A;  5AFX A;  3ADZ A;  3AQB B;  5CG6 A;  4XQR F;  2ZY1 A;  2PS7 A;  1YYS A;  5B02 A;  1HM4 A;  1JFA A;  5E8K A;  3DYG A;  1UBX A;  2EWG A;  2E8V A;  3S9V A;  3WJN A;  2Z78 A;  4P0V A;  4E1E A;  1VG6 A;  2AZL A;  3NRI A;  3N5H F;  1DGP A;  3IPI A;  1YJ4 A;  5JV0 F;  3ZMC A;  2Q9Y A;  3KBK A;  3IBA A;  5DGM F;  4F6X A;  5B01 A;  3LOM A;  4H5D F;  4KWD A;  2Z50 A;  3Q2Z A;  3WCF A;  5EAU A;  2E90 A;  3LGK A;  2AZJ A;  5IKA A;  1VG7 A;  2PS8 A;  3WJO A;  3VJC A;  3NPR A;  4LA5 A;  2J1P A;  1V4I A;  3BNX A;  3SAE A;  1WL0 A;  5IL3 A;  3N0G A;  1WL2 A;  4NFI F;  5ILZ A;  3WEH A;  1VG4 A;  2Z7I A;  3VJD A;  5IN8 A;  3M0G A;  4NUA A;  3WCC A;  3N46 F;  5HN9 A;  3WCA A;  4KVI A;  3WEG A;  4EA1 A;  3LG5 A;  5IVG A;  3VJA A;  1JFG A;  2QIS A;  4LFG A;  4E9U A;  4LUU A;  4JXN A;  4N9U A;  4JZB A;  3EZ3 A;  2AET A;  3KB9 A;  5IL8 A;  4KFA A;  5IM1 A;  5HNA A;  4OKM A;  4Q23 A;  4LZ0 A;  2AEK A;  3KRF B;  3KRF A;  3V1V A;  1YYT A;  3ASX A;  1RQI A;  1YYR A;  3AE0 A;  5A0K A;  4GA3 A;  1N1Z A;  3ACW A;  5DIQ F;  2F92 F;  3KRA A;  3ICM A;  5ER8 A;  2E94 A;  4KVW A;  4OMH A;  5JA0 F;  5JV2 F;  3DYF A;  3B7L A;  5B00 A;  2E93 A;  5B0I A;  5EAS A;  2F8Z F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...