3UCAA

Crystal structure of isoprenoid synthase (target efi-501974) from clostridium perfringens
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
291
structure length
274
Chain Sequence
AMNINSLKEEVDQSLKAYFNKDREYNKVLYDSMAYSINVGGKRIRPILMLLSYYIYKSDYKKILTPAMAIEMIHTYSLIHDDLPCMDNDDLRRGKPTNHKVFGEAIAVLAGDALLNEAMKILVDYSLEEGKSALKATKIIADAAGSDGMIGGQIVDIINEDKEEISLKELDYMHLKKTGELIKASIMSGAVLAEASEGDIKKLEGFGYKLGLAFQIKDDILDVVGNNYITIFGLEECKKKCVNITEECIEILSSIKGNTEPLKVLTMKLLERKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Geranyltranstransferase
publication title Prediction of function for the polyprenyl transferase subgroup in the isoprenoid synthase superfamily.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Transferase
total genus 115
structure length 274
sequence length 291
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-10-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00348 polyprenyl_synt Polyprenyl synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3ucaA00
4GP1A 3AE0A 5ILZA 4GA3A 5DJPF 4KPDA 4RXCA 4LZCA 5C05A 3DYGA 4FJQA 3WEFA 4JZBA 3SDVA 4E9ZA 3N1VF 4DWGA 4NKFA 3N1WF 1N1BA 1UBXA 4JXNA 5AYPA 3WEKA 2ZCSA 4OGUA 5JA0F 5DJVF 3CKEA 5ILKA 3WCFA 2O1OA 3WEHA 3V1XA 4E9UA 5DZ2A 1YYUA 2E93A 4DEMF 1YHMA 2E4OA 2E8XA 3WCHA 2F9KF 4MC0A 5JV2F 4DHDA 3KRCA 5IKAA 4NG6A 5ILHA 5B02A 5IL8A 3LLWA 5EAUA 3N46F 2VF6A 1YYTA 2ZEVA 5AHUB 3QKCA 5ERMA 2F7MF 2J1PA 3ICZA 1HXGA 5DHKA 3RMGA 3WCJA 1EZFA 2PS5A 4EA2A 2EWGA 3KBKA 3DYFA 3M9UA 1UBYA 1JFGA 2E94A 3ASXA 3SDQA 1WY0A 2J1OA 3ID0A 5H9DA 3WCEA 3LJIA 3N45F 5E8LA 4KUXA 5IMIA 5B00A 4KVYA 3NPKA 3APZA 5B01A 2Z52A 3V1VA 4Q23A 4LIXA 3TS7A 5IK9A 3N5JF 5EATA 4LLTA 2E90A 5JV0F 1YYQA 4JYXA 4EA0A 3ACYA 4GP2A 2E92A 3M00A 3AQCB 3WCAA 4LZ0A 3S4JA 3PKOA 3Q1OA 5EROA 3WSAA 2PS7A 2Z4VA 1DI1A 1V4EA 2F8CF 3BNXA 3KRAA 3WEJA 1WL0A 5HNAA 4PVXF 5B0MA 3OACA 2ONGA 3KROA 3P41A 3TC1A 4LFVF 2AELA 3MAVA 3VJCA 2OA6A 3Q2QA 3WCMA 4JXYA 2ZCOA 3M0GA 4RXAA 4LFGA 4RXEA 3PDEA 1YJ4A 4KK2A 3P8LA 2Z4WA 2E8UA 1RQIA 5B0KA 4KPJA 3VJAA 3SAEA 2AEKA 1HX9A 2ONHA 3B7LA 1UBVA 1HXAA 3CP6A 3EFQA 3N6KF 4KQUA 3IBAA 2PS6A 5DGSF 1N20A 5ILDA 3RYEA 3ACWA 2P1CA 4HD1A 4E1EA 3KRCB 2Q58A 3OABB 5EASA 5B0IA 5IVGA 4OKMA 3N49F 1RQJA 4LPGF 2I19A 3WCCA 1V4HA 3ADZA 3ACXA 5HN7A 5IMPA 2PS8A 2Q80A 4FP4A 4KFAA 1V4KA 4OMHA 4OMGA 4LFEA 3Q30A 1HXCA 4H5CF 3WCIA 4GAXA 5IKHA 1YYRA 3DYHA 4LPHF 5ILYA 2Z50A 3AQ0A 1JFAA 4NFJF 4KKMA 5I1UA 2QISA 4QXSF 4XQTF 4L2XF 4LTVA 4F6XA 4KQSA 2ZY1A 1VG7A 5KSXF 3VJEA 3SDTA 3WCDA 1RTRA 1YHLA 2ZCRA 5DGMF 5DJRF 5B0LA 4P0WA 2FORA 4RNQA 3P5RA 2PS4A 4LA6A 5HN9A 3PYBA 1VG6A 3NPRA 3ZL6A 1WL1A 3ZMBA 3RBMA 3KRFB 2F8ZF 5A0KA 5JV1F 2F89F 2AZLA 1PS1A 3CC9A 5CG5A 1YHKA 3WJOA 3S9VA 3KRPA 4N9UA 4OKZA 3VJ8A 3WCGA 2RAHA 2FTZA 4KWDA 4ZQ8A 5ILIA 3LZ9A 4H5DF 4KQ5A 2H8OA 5B03A 3WC9A 4P0XA 3SDUA 1ZW5A 3OYRA 3TFPA 2F94F 5HN8A 4WK5A 5DGNF 2Z78A 1VG2A 5IL3A 2Z7IA 3IPIA 3WEGA 1VG4A 3WCBA 3ZCDA 3P5PA 3M01A 4RXDA 4RYPA 4F6VA 3QQVA 4DWBA 2AZKA 1V4JA 1WL2A 3VJDA 3LEEA 2OPNA 3W7FA 3Q2ZA 4N1ZF 4LTZA 4XQSF 3KB9A 5DIQF 2AETA 1KIZA 3MZVA 3ZOUA 2Z4XA 3EZ3A 2ZEUA 3N0FA 5A0IA 2E8WA 5JUZF 2E8TA 3SDRA 3LG5A 3VJBA 5IMNA 3UCAA 1UBWA 3N3LF 1VG3A 3TFNA 4LZ3A 5E8KA 5A0JA 4NFIF 3LVSA 3G4FA 3PH7A 3PYAA 2E91A 4LOBA 2OPMA 5AFXA 4LLSA 3M02A 3N5HF 5B0JA 3TFVA 4NFKF 4LUUA 5DHIA 4XQRF 4JVJF 3ICMA 1YQ7A 5E8HA 4DXJA 3EGTA 4LXWA 1WKZA 3N0GA 5IK0A 2Z7HA 2E8VA 4F62A 3LGKA 1N24A 3OABA 1HM4A 4DZWA 1FPSA 3LGZB 5ILJA 3NRIA 4JZXA 5AELA 2OGDA 1KIYA 4P0VA 1N23A 3NF2A 2Z4ZA 3VJ9A 3V66A 2E95A 3BNYA 3WE9A 3LOMA 3LSNA 1WMWA 4DI5A 1WL3A 5DW7A 5ER8A 1N1ZA 1N22A 4UMJA 4LA5A 3ZMCA 5ERNA 5CG6A 3WSBA 3KRPB 4QPFA 4KVIA 2J5CA 2ZCQA 5IM1A 1V4IA 1DGPA 3WJKA 2AZJA 3G4DA 2DH4A 3KRAB 3P8RA 4EA1A 3ICNA 1YV5A 1N21A 3KRFA 4MC8A 3LK5A 3OACB 4H5EF 3WJNA 1HM7A 3KROB 5IN8A 2F92F 2Q9ZA 1YYSA 3LDWA 3WCLA 3AQBB 4NKEA 3N3DA 4K10A 4KVWA 4NUAA 2Z4YA 4MC3A 3WEIA 3RYWA 4KVDA 2Q9YA 5IK6A 4PVYF 3LMDA 3ICKA
chains in the Genus database with same CATH superfamily
4GP1A 3AE0A 5ILZA 4GA3A 5DJPF 4KPDA 4RXCA 4LZCA 5C05A 3DYGA 4FJQA 3WEFA 4JZBA 3SDVA 4E9ZA 3N1VF 4DWGA 4NKFA 3N1WF 1N1BA 1UBXA 4JXNA 5AYPA 3WEKA 2ZCSA 4OGUA 5JA0F 5DJVF 3CKEA 5ILKA 3WCFA 2O1OA 3WEHA 3V1XA 4E9UA 5DZ2A 1YYUA 2E93A 4DEMF 1YHMA 2E4OA 2E8XA 3WCHA 2F9KF 4MC0A 5JV2F 4DHDA 3KRCA 5IKAA 4NG6A 5ILHA 5B02A 5IL8A 3LLWA 5EAUA 3N46F 2VF6A 1YYTA 2ZEVA 5AHUB 3QKCA 5ERMA 2F7MF 2J1PA 3ICZA 1HXGA 5DHKA 3RMGA 3WCJA 1EZFA 2PS5A 4EA2A 2EWGA 3KBKA 3DYFA 3M9UA 1UBYA 1JFGA 2E94A 3ASXA 3SDQA 1WY0A 2J1OA 3ID0A 5H9DA 3WCEA 3LJIA 3N45F 5E8LA 4KUXA 5IMIA 5B00A 4KVYA 3NPKA 3APZA 5B01A 2Z52A 3V1VA 4Q23A 4LIXA 3TS7A 5IK9A 3N5JF 5EATA 4LLTA 2E90A 5JV0F 1YYQA 4JYXA 4EA0A 3ACYA 4GP2A 2E92A 3M00A 3AQCB 3WCAA 4LZ0A 3S4JA 3PKOA 3Q1OA 5EROA 3WSAA 2PS7A 2Z4VA 1DI1A 1V4EA 2F8CF 3BNXA 3KRAA 3WEJA 1WL0A 5HNAA 4PVXF 5B0MA 3OACA 2ONGA 3KROA 3P41A 3TC1A 4LFVF 2AELA 3MAVA 3VJCA 2OA6A 3Q2QA 3WCMA 4JXYA 2ZCOA 3M0GA 4RXAA 4LFGA 4RXEA 3PDEA 1YJ4A 4KK2A 3P8LA 2Z4WA 2E8UA 1RQIA 5B0KA 4KPJA 3VJAA 3SAEA 2AEKA 1HX9A 2ONHA 3B7LA 1UBVA 1HXAA 3CP6A 3EFQA 3N6KF 4KQUA 3IBAA 2PS6A 5DGSF 1N20A 5ILDA 3RYEA 3ACWA 2P1CA 4HD1A 4E1EA 3KRCB 2Q58A 3OABB 5EASA 5B0IA 5IVGA 4OKMA 3N49F 1RQJA 4LPGF 2I19A 3WCCA 1V4HA 3ADZA 3ACXA 5HN7A 5IMPA 2PS8A 2Q80A 4FP4A 4KFAA 1V4KA 4OMHA 4OMGA 4LFEA 3Q30A 1HXCA 4H5CF 3WCIA 4GAXA 5IKHA 1YYRA 3DYHA 4LPHF 5ILYA 2Z50A 3AQ0A 1JFAA 4NFJF 4KKMA 5I1UA 2QISA 4QXSF 4XQTF 4L2XF 4LTVA 4F6XA 4KQSA 2ZY1A 1VG7A 5KSXF 3VJEA 3SDTA 3WCDA 1RTRA 1YHLA 2ZCRA 5DGMF 5DJRF 5B0LA 4P0WA 2FORA 4RNQA 3P5RA 2PS4A 4LA6A 5HN9A 3PYBA 1VG6A 3NPRA 3ZL6A 1WL1A 3ZMBA 3RBMA 3KRFB 2F8ZF 5A0KA 5JV1F 2F89F 2AZLA 1PS1A 3CC9A 5CG5A 1YHKA 3WJOA 3S9VA 3KRPA 4N9UA 4OKZA 3VJ8A 3WCGA 2RAHA 2FTZA 4KWDA 4ZQ8A 5ILIA 3LZ9A 4H5DF 4KQ5A 2H8OA 5B03A 3WC9A 4P0XA 3SDUA 1ZW5A 3OYRA 3TFPA 2F94F 5HN8A 4WK5A 5DGNF 2Z78A 1VG2A 5IL3A 2Z7IA 3IPIA 3WEGA 1VG4A 3WCBA 3ZCDA 3P5PA 3M01A 4RXDA 4RYPA 4F6VA 3QQVA 4DWBA 2AZKA 1V4JA 1WL2A 3VJDA 3LEEA 2OPNA 3W7FA 3Q2ZA 4N1ZF 4LTZA 4XQSF 3KB9A 5DIQF 2AETA 1KIZA 3MZVA 3ZOUA 2Z4XA 3EZ3A 2ZEUA 3N0FA 5A0IA 2E8WA 5JUZF 2E8TA 3SDRA 3LG5A 3VJBA 5IMNA 3UCAA 1UBWA 3N3LF 1VG3A 3TFNA 4LZ3A 5E8KA 5A0JA 4NFIF 3LVSA 3G4FA 3PH7A 3PYAA 2E91A 4LOBA 2OPMA 5AFXA 4LLSA 3M02A 3N5HF 5B0JA 3TFVA 4NFKF 4LUUA 5DHIA 4XQRF 4JVJF 3ICMA 1YQ7A 5E8HA 4DXJA 3EGTA 4LXWA 1WKZA 3N0GA 5IK0A 2Z7HA 2E8VA 4F62A 3LGKA 1N24A 3OABA 1HM4A 4DZWA 1FPSA 3LGZB 5ILJA 3NRIA 4JZXA 5AELA 2OGDA 1KIYA 4P0VA 1N23A 3NF2A 2Z4ZA 3VJ9A 3V66A 2E95A 3BNYA 3WE9A 3LOMA 3LSNA 1WMWA 4DI5A 1WL3A 5DW7A 5ER8A 1N1ZA 1N22A 4UMJA 4LA5A 3ZMCA 5ERNA 5CG6A 3WSBA 3KRPB 4QPFA 4KVIA 2J5CA 2ZCQA 5IM1A 1V4IA 1DGPA 3WJKA 2AZJA 3G4DA 2DH4A 3KRAB 3P8RA 4EA1A 3ICNA 1YV5A 1N21A 3KRFA 4MC8A 3LK5A 3OACB 4H5EF 3WJNA 1HM7A 3KROB 5IN8A 2F92F 2Q9ZA 1YYSA 3LDWA 3WCLA 3AQBB 4NKEA 3N3DA 4K10A 4KVWA 4NUAA 2Z4YA 4MC3A 3WEIA 3RYWA 4KVDA 2Q9YA 5IK6A 4PVYF 3LMDA 3ICKA
chains in the Genus database with same CATH topology
4GP1A 3AE0A 5ILZA 4GA3A 5DJPF 4KPDA 4RXCA 4LZCA 5C05A 3DYGA 4FJQA 3WEFA 4JZBA 3SDVA 4E9ZA 3N1VF 4DWGA 4NKFA 3N1WF 1N1BA 1UBXA 4JXNA 5AYPA 3WEKA 2ZCSA 4OGUA 5JA0F 5DJVF 3CKEA 5ILKA 3WCFA 2O1OA 3WEHA 3V1XA 4E9UA 5DZ2A 1YYUA 2E93A 4DEMF 1YHMA 2E4OA 2E8XA 3WCHA 2F9KF 4MC0A 5JV2F 4DHDA 3KRCA 5IKAA 4NG6A 5ILHA 5B02A 5IL8A 3LLWA 5EAUA 3N46F 2VF6A 1YYTA 2ZEVA 5AHUB 3QKCA 5ERMA 2F7MF 2J1PA 3ICZA 1HXGA 5DHKA 3RMGA 3WCJA 1EZFA 2PS5A 4EA2A 2EWGA 3KBKA 3DYFA 3M9UA 1UBYA 1JFGA 2E94A 3ASXA 3SDQA 1WY0A 2J1OA 3ID0A 5H9DA 3WCEA 3LJIA 3N45F 5E8LA 4KUXA 5IMIA 5B00A 4KVYA 3NPKA 3APZA 5B01A 2Z52A 3V1VA 4Q23A 4LIXA 3TS7A 5IK9A 3N5JF 5EATA 4LLTA 2E90A 5JV0F 1YYQA 4JYXA 4EA0A 3ACYA 4GP2A 2E92A 3M00A 3AQCB 3WCAA 4LZ0A 3S4JA 3PKOA 3Q1OA 5EROA 3WSAA 2PS7A 2Z4VA 1DI1A 1V4EA 2F8CF 3BNXA 3KRAA 3WEJA 1WL0A 5HNAA 4PVXF 5B0MA 3OACA 2ONGA 3KROA 3P41A 3TC1A 4LFVF 2AELA 3MAVA 3VJCA 2OA6A 3Q2QA 3WCMA 4JXYA 2ZCOA 3M0GA 4RXAA 4LFGA 4RXEA 3PDEA 1YJ4A 4KK2A 3P8LA 2Z4WA 2E8UA 1RQIA 5B0KA 4KPJA 3VJAA 3SAEA 2AEKA 1HX9A 2ONHA 3B7LA 1UBVA 1HXAA 3CP6A 3EFQA 3N6KF 4KQUA 3IBAA 2PS6A 5DGSF 1N20A 5ILDA 3RYEA 3ACWA 2P1CA 4HD1A 4E1EA 3KRCB 2Q58A 3OABB 5EASA 5B0IA 5IVGA 4OKMA 3N49F 1RQJA 4LPGF 2I19A 3WCCA 1V4HA 3ADZA 3ACXA 5HN7A 5IMPA 2PS8A 2Q80A 4FP4A 4KFAA 1V4KA 4OMHA 4OMGA 4LFEA 3Q30A 1HXCA 4H5CF 3WCIA 4GAXA 5IKHA 1YYRA 3DYHA 4LPHF 5ILYA 2Z50A 3AQ0A 1JFAA 4NFJF 4KKMA 5I1UA 2QISA 4QXSF 4XQTF 4L2XF 4LTVA 4F6XA 4KQSA 2ZY1A 1VG7A 5KSXF 3VJEA 3SDTA 3WCDA 1RTRA 1YHLA 2ZCRA 5DGMF 5DJRF 5B0LA 4P0WA 2FORA 4RNQA 3P5RA 2PS4A 4LA6A 5HN9A 3PYBA 1VG6A 3NPRA 3ZL6A 1WL1A 3ZMBA 3RBMA 3KRFB 2F8ZF 5A0KA 5JV1F 2F89F 2AZLA 1PS1A 3CC9A 5CG5A 1YHKA 3WJOA 3S9VA 3KRPA 4N9UA 4OKZA 3VJ8A 3WCGA 2RAHA 2FTZA 4KWDA 4ZQ8A 5ILIA 3LZ9A 4H5DF 4KQ5A 2H8OA 5B03A 3WC9A 4P0XA 3SDUA 1ZW5A 3OYRA 3TFPA 2F94F 5HN8A 4WK5A 5DGNF 2Z78A 1VG2A 5IL3A 2Z7IA 3IPIA 3WEGA 1VG4A 3WCBA 3ZCDA 3P5PA 3M01A 4RXDA 4RYPA 4F6VA 3QQVA 4DWBA 2AZKA 1V4JA 1WL2A 3VJDA 3LEEA 2OPNA 3W7FA 3Q2ZA 4N1ZF 4LTZA 4XQSF 3KB9A 5DIQF 2AETA 1KIZA 3MZVA 3ZOUA 2Z4XA 3EZ3A 2ZEUA 3N0FA 5A0IA 2E8WA 5JUZF 2E8TA 3SDRA 3LG5A 3VJBA 5IMNA 3UCAA 1UBWA 3N3LF 1VG3A 3TFNA 4LZ3A 5E8KA 5A0JA 4NFIF 3LVSA 3G4FA 3PH7A 3PYAA 2E91A 4LOBA 2OPMA 5AFXA 4LLSA 3M02A 3N5HF 5B0JA 3TFVA 4NFKF 4LUUA 5DHIA 4XQRF 4JVJF 3ICMA 1YQ7A 5E8HA 4DXJA 3EGTA 4LXWA 1WKZA 3N0GA 5IK0A 2Z7HA 2E8VA 4F62A 3LGKA 1N24A 3OABA 1HM4A 4DZWA 1FPSA 3LGZB 5ILJA 3NRIA 4JZXA 5AELA 2OGDA 1KIYA 4P0VA 1N23A 3NF2A 2Z4ZA 3VJ9A 3V66A 2E95A 3BNYA 3WE9A 3LOMA 3LSNA 1WMWA 4DI5A 1WL3A 5DW7A 5ER8A 1N1ZA 1N22A 4UMJA 4LA5A 3ZMCA 5ERNA 5CG6A 3WSBA 3KRPB 4QPFA 4KVIA 2J5CA 2ZCQA 5IM1A 1V4IA 1DGPA 3WJKA 2AZJA 3G4DA 2DH4A 3KRAB 3P8RA 4EA1A 3ICNA 1YV5A 1N21A 3KRFA 4MC8A 3LK5A 3OACB 4H5EF 3WJNA 1HM7A 3KROB 5IN8A 2F92F 2Q9ZA 1YYSA 3LDWA 3WCLA 3AQBB 4NKEA 3N3DA 4K10A 4KVWA 4NUAA 2Z4YA 4MC3A 3WEIA 3RYWA 4KVDA 2Q9YA 5IK6A 4PVYF 3LMDA 3ICKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GP1 A;  3AE0 A;  5ILZ A;  4GA3 A;  5DJP F;  4KPD A;  4RXC A;  4LZC A;  5C05 A;  3DYG A;  4FJQ A;  3WEF A;  4JZB A;  3SDV A;  4E9Z A;  3N1V F;  4DWG A;  4NKF A;  3N1W F;  1N1B A;  1UBX A;  4JXN A;  5AYP A;  3WEK A;  2ZCS A;  4OGU A;  5JA0 F;  5DJV F;  3CKE A;  5ILK A;  3WCF A;  2O1O A;  3WEH A;  3V1X A;  4E9U A;  5DZ2 A;  1YYU A;  2E93 A;  4DEM F;  1YHM A;  2E4O A;  2E8X A;  3WCH A;  2F9K F;  4MC0 A;  5JV2 F;  4DHD A;  3KRC A;  5IKA A;  4NG6 A;  5ILH A;  5B02 A;  5IL8 A;  3LLW A;  5EAU A;  3N46 F;  2VF6 A;  1YYT A;  2ZEV A;  5AHU B;  3QKC A;  5ERM A;  2F7M F;  2J1P A;  3ICZ A;  1HXG A;  5DHK A;  3RMG A;  3WCJ A;  1EZF A;  2PS5 A;  4EA2 A;  2EWG A;  3KBK A;  3DYF A;  3M9U A;  1UBY A;  1JFG A;  2E94 A;  3ASX A;  3SDQ A;  1WY0 A;  2J1O A;  3ID0 A;  5H9D A;  3WCE A;  3LJI A;  3N45 F;  5E8L A;  4KUX A;  5IMI A;  5B00 A;  4KVY A;  3NPK A;  3APZ A;  5B01 A;  2Z52 A;  3V1V A;  4Q23 A;  4LIX A;  3TS7 A;  5IK9 A;  3N5J F;  5EAT A;  4LLT A;  2E90 A;  5JV0 F;  1YYQ A;  4JYX A;  4EA0 A;  3ACY A;  4GP2 A;  2E92 A;  3M00 A;  3AQC B;  3WCA A;  4LZ0 A;  3S4J A;  3PKO A;  3Q1O A;  5ERO A;  3WSA A;  2PS7 A;  2Z4V A;  1DI1 A;  1V4E A;  2F8C F;  3BNX A;  3KRA A;  3WEJ A;  1WL0 A;  5HNA A;  4PVX F;  5B0M A;  3OAC A;  2ONG A;  3KRO A;  3P41 A;  3TC1 A;  4LFV F;  2AEL A;  3MAV A;  3VJC A;  2OA6 A;  3Q2Q A;  3WCM A;  4JXY A;  2ZCO A;  3M0G A;  4RXA A;  4LFG A;  4RXE A;  3PDE A;  1YJ4 A;  4KK2 A;  3P8L A;  2Z4W A;  2E8U A;  1RQI A;  5B0K A;  4KPJ A;  3VJA A;  3SAE A;  2AEK A;  1HX9 A;  2ONH A;  3B7L A;  1UBV A;  1HXA A;  3CP6 A;  3EFQ A;  3N6K F;  4KQU A;  3IBA A;  2PS6 A;  5DGS F;  1N20 A;  5ILD A;  3RYE A;  3ACW A;  2P1C A;  4HD1 A;  4E1E A;  3KRC B;  2Q58 A;  3OAB B;  5EAS A;  5B0I A;  5IVG A;  4OKM A;  3N49 F;  1RQJ A;  4LPG F;  2I19 A;  3WCC A;  1V4H A;  3ADZ A;  3ACX A;  5HN7 A;  5IMP A;  2PS8 A;  2Q80 A;  4FP4 A;  4KFA A;  1V4K A;  4OMH A;  4OMG A;  4LFE A;  3Q30 A;  1HXC A;  4H5C F;  3WCI A;  4GAX A;  5IKH A;  1YYR A;  3DYH A;  4LPH F;  5ILY A;  2Z50 A;  3AQ0 A;  1JFA A;  4NFJ F;  4KKM A;  5I1U A;  2QIS A;  4QXS F;  4XQT F;  4L2X F;  4LTV A;  4F6X A;  4KQS A;  2ZY1 A;  1VG7 A;  5KSX F;  3VJE A;  3SDT A;  3WCD A;  1RTR A;  1YHL A;  2ZCR A;  5DGM F;  5DJR F;  5B0L A;  4P0W A;  2FOR A;  4RNQ A;  3P5R A;  2PS4 A;  4LA6 A;  5HN9 A;  3PYB A;  1VG6 A;  3NPR A;  3ZL6 A;  1WL1 A;  3ZMB A;  3RBM A;  3KRF B;  2F8Z F;  5A0K A;  5JV1 F;  2F89 F;  2AZL A;  1PS1 A;  3CC9 A;  5CG5 A;  1YHK A;  3WJO A;  3S9V A;  3KRP A;  4N9U A;  4OKZ A;  3VJ8 A;  3WCG A;  2RAH A;  2FTZ A;  4KWD A;  4ZQ8 A;  5ILI A;  3LZ9 A;  4H5D F;  4KQ5 A;  2H8O A;  5B03 A;  3WC9 A;  4P0X A;  3SDU A;  1ZW5 A;  3OYR A;  3TFP A;  2F94 F;  5HN8 A;  4WK5 A;  5DGN F;  2Z78 A;  1VG2 A;  5IL3 A;  2Z7I A;  3IPI A;  3WEG A;  1VG4 A;  3WCB A;  3ZCD A;  3P5P A;  3M01 A;  4RXD A;  4RYP A;  4F6V A;  3QQV A;  4DWB A;  2AZK A;  1V4J A;  1WL2 A;  3VJD A;  3LEE A;  2OPN A;  3W7F A;  3Q2Z A;  4N1Z F;  4LTZ A;  4XQS F;  3KB9 A;  5DIQ F;  2AET A;  1KIZ A;  3MZV A;  3ZOU A;  2Z4X A;  3EZ3 A;  2ZEU A;  3N0F A;  5A0I A;  2E8W A;  5JUZ F;  2E8T A;  3SDR A;  3LG5 A;  3VJB A;  5IMN A;  3UCA A;  1UBW A;  3N3L F;  1VG3 A;  3TFN A;  4LZ3 A;  5E8K A;  5A0J A;  4NFI F;  3LVS A;  3G4F A;  3PH7 A;  3PYA A;  2E91 A;  4LOB A;  2OPM A;  5AFX A;  4LLS A;  3M02 A;  3N5H F;  5B0J A;  3TFV A;  4NFK F;  4LUU A;  5DHI A;  4XQR F;  4JVJ F;  3ICM A;  1YQ7 A;  5E8H A;  4DXJ A;  3EGT A;  4LXW A;  1WKZ A;  3N0G A;  5IK0 A;  2Z7H A;  2E8V A;  4F62 A;  3LGK A;  1N24 A;  3OAB A;  1HM4 A;  4DZW A;  1FPS A;  3LGZ B;  5ILJ A;  3NRI A;  4JZX A;  5AEL A;  2OGD A;  1KIY A;  4P0V A;  1N23 A;  3NF2 A;  2Z4Z A;  3VJ9 A;  3V66 A;  2E95 A;  3BNY A;  3WE9 A;  3LOM A;  3LSN A;  1WMW A;  4DI5 A;  1WL3 A;  5DW7 A;  5ER8 A;  1N1Z A;  1N22 A;  4UMJ A;  4LA5 A;  3ZMC A;  5ERN A;  5CG6 A;  3WSB A;  3KRP B;  4QPF A;  4KVI A;  2J5C A;  2ZCQ A;  5IM1 A;  1V4I A;  1DGP A;  3WJK A;  2AZJ A;  3G4D A;  2DH4 A;  3KRA B;  3P8R A;  4EA1 A;  3ICN A;  1YV5 A;  1N21 A;  3KRF A;  4MC8 A;  3LK5 A;  3OAC B;  4H5E F;  3WJN A;  1HM7 A;  3KRO B;  5IN8 A;  2F92 F;  2Q9Z A;  1YYS A;  3LDW A;  3WCL A;  3AQB B;  4NKE A;  3N3D A;  4K10 A;  4KVW A;  4NUA A;  2Z4Y A;  4MC3 A;  3WEI A;  3RYW A;  4KVD A;  2Q9Y A;  5IK6 A;  4PVY F;  3LMD A;  3ICK A; 
#chains in the Genus database with same CATH topology
 4GP1 A;  3AE0 A;  5ILZ A;  4GA3 A;  5DJP F;  4KPD A;  4RXC A;  4LZC A;  5C05 A;  3DYG A;  4FJQ A;  3WEF A;  4JZB A;  3SDV A;  4E9Z A;  3N1V F;  4DWG A;  4NKF A;  3N1W F;  1N1B A;  1UBX A;  4JXN A;  5AYP A;  3WEK A;  2ZCS A;  4OGU A;  5JA0 F;  5DJV F;  3CKE A;  5ILK A;  3WCF A;  2O1O A;  3WEH A;  3V1X A;  4E9U A;  5DZ2 A;  1YYU A;  2E93 A;  4DEM F;  1YHM A;  2E4O A;  2E8X A;  3WCH A;  2F9K F;  4MC0 A;  5JV2 F;  4DHD A;  3KRC A;  5IKA A;  4NG6 A;  5ILH A;  5B02 A;  5IL8 A;  3LLW A;  5EAU A;  3N46 F;  2VF6 A;  1YYT A;  2ZEV A;  5AHU B;  3QKC A;  5ERM A;  2F7M F;  2J1P A;  3ICZ A;  1HXG A;  5DHK A;  3RMG A;  3WCJ A;  1EZF A;  2PS5 A;  4EA2 A;  2EWG A;  3KBK A;  3DYF A;  3M9U A;  1UBY A;  1JFG A;  2E94 A;  3ASX A;  3SDQ A;  1WY0 A;  2J1O A;  3ID0 A;  5H9D A;  3WCE A;  3LJI A;  3N45 F;  5E8L A;  4KUX A;  5IMI A;  5B00 A;  4KVY A;  3NPK A;  3APZ A;  5B01 A;  2Z52 A;  3V1V A;  4Q23 A;  4LIX A;  3TS7 A;  5IK9 A;  3N5J F;  5EAT A;  4LLT A;  2E90 A;  5JV0 F;  1YYQ A;  4JYX A;  4EA0 A;  3ACY A;  4GP2 A;  2E92 A;  3M00 A;  3AQC B;  3WCA A;  4LZ0 A;  3S4J A;  3PKO A;  3Q1O A;  5ERO A;  3WSA A;  2PS7 A;  2Z4V A;  1DI1 A;  1V4E A;  2F8C F;  3BNX A;  3KRA A;  3WEJ A;  1WL0 A;  5HNA A;  4PVX F;  5B0M A;  3OAC A;  2ONG A;  3KRO A;  3P41 A;  3TC1 A;  4LFV F;  2AEL A;  3MAV A;  3VJC A;  2OA6 A;  3Q2Q A;  3WCM A;  4JXY A;  2ZCO A;  3M0G A;  4RXA A;  4LFG A;  4RXE A;  3PDE A;  1YJ4 A;  4KK2 A;  3P8L A;  2Z4W A;  2E8U A;  1RQI A;  5B0K A;  4KPJ A;  3VJA A;  3SAE A;  2AEK A;  1HX9 A;  2ONH A;  3B7L A;  1UBV A;  1HXA A;  3CP6 A;  3EFQ A;  3N6K F;  4KQU A;  3IBA A;  2PS6 A;  5DGS F;  1N20 A;  5ILD A;  3RYE A;  3ACW A;  2P1C A;  4HD1 A;  4E1E A;  3KRC B;  2Q58 A;  3OAB B;  5EAS A;  5B0I A;  5IVG A;  4OKM A;  3N49 F;  1RQJ A;  4LPG F;  2I19 A;  3WCC A;  1V4H A;  3ADZ A;  3ACX A;  5HN7 A;  5IMP A;  2PS8 A;  2Q80 A;  4FP4 A;  4KFA A;  1V4K A;  4OMH A;  4OMG A;  4LFE A;  3Q30 A;  1HXC A;  4H5C F;  3WCI A;  4GAX A;  5IKH A;  1YYR A;  3DYH A;  4LPH F;  5ILY A;  2Z50 A;  3AQ0 A;  1JFA A;  4NFJ F;  4KKM A;  5I1U A;  2QIS A;  4QXS F;  4XQT F;  4L2X F;  4LTV A;  4F6X A;  4KQS A;  2ZY1 A;  1VG7 A;  5KSX F;  3VJE A;  3SDT A;  3WCD A;  1RTR A;  1YHL A;  2ZCR A;  5DGM F;  5DJR F;  5B0L A;  4P0W A;  2FOR A;  4RNQ A;  3P5R A;  2PS4 A;  4LA6 A;  5HN9 A;  3PYB A;  1VG6 A;  3NPR A;  3ZL6 A;  1WL1 A;  3ZMB A;  3RBM A;  3KRF B;  2F8Z F;  5A0K A;  5JV1 F;  2F89 F;  2AZL A;  1PS1 A;  3CC9 A;  5CG5 A;  1YHK A;  3WJO A;  3S9V A;  3KRP A;  4N9U A;  4OKZ A;  3VJ8 A;  3WCG A;  2RAH A;  2FTZ A;  4KWD A;  4ZQ8 A;  5ILI A;  3LZ9 A;  4H5D F;  4KQ5 A;  2H8O A;  5B03 A;  3WC9 A;  4P0X A;  3SDU A;  1ZW5 A;  3OYR A;  3TFP A;  2F94 F;  5HN8 A;  4WK5 A;  5DGN F;  2Z78 A;  1VG2 A;  5IL3 A;  2Z7I A;  3IPI A;  3WEG A;  1VG4 A;  3WCB A;  3ZCD A;  3P5P A;  3M01 A;  4RXD A;  4RYP A;  4F6V A;  3QQV A;  4DWB A;  2AZK A;  1V4J A;  1WL2 A;  3VJD A;  3LEE A;  2OPN A;  3W7F A;  3Q2Z A;  4N1Z F;  4LTZ A;  4XQS F;  3KB9 A;  5DIQ F;  2AET A;  1KIZ A;  3MZV A;  3ZOU A;  2Z4X A;  3EZ3 A;  2ZEU A;  3N0F A;  5A0I A;  2E8W A;  5JUZ F;  2E8T A;  3SDR A;  3LG5 A;  3VJB A;  5IMN A;  3UCA A;  1UBW A;  3N3L F;  1VG3 A;  3TFN A;  4LZ3 A;  5E8K A;  5A0J A;  4NFI F;  3LVS A;  3G4F A;  3PH7 A;  3PYA A;  2E91 A;  4LOB A;  2OPM A;  5AFX A;  4LLS A;  3M02 A;  3N5H F;  5B0J A;  3TFV A;  4NFK F;  4LUU A;  5DHI A;  4XQR F;  4JVJ F;  3ICM A;  1YQ7 A;  5E8H A;  4DXJ A;  3EGT A;  4LXW A;  1WKZ A;  3N0G A;  5IK0 A;  2Z7H A;  2E8V A;  4F62 A;  3LGK A;  1N24 A;  3OAB A;  1HM4 A;  4DZW A;  1FPS A;  3LGZ B;  5ILJ A;  3NRI A;  4JZX A;  5AEL A;  2OGD A;  1KIY A;  4P0V A;  1N23 A;  3NF2 A;  2Z4Z A;  3VJ9 A;  3V66 A;  2E95 A;  3BNY A;  3WE9 A;  3LOM A;  3LSN A;  1WMW A;  4DI5 A;  1WL3 A;  5DW7 A;  5ER8 A;  1N1Z A;  1N22 A;  4UMJ A;  4LA5 A;  3ZMC A;  5ERN A;  5CG6 A;  3WSB A;  3KRP B;  4QPF A;  4KVI A;  2J5C A;  2ZCQ A;  5IM1 A;  1V4I A;  1DGP A;  3WJK A;  2AZJ A;  3G4D A;  2DH4 A;  3KRA B;  3P8R A;  4EA1 A;  3ICN A;  1YV5 A;  1N21 A;  3KRF A;  4MC8 A;  3LK5 A;  3OAC B;  4H5E F;  3WJN A;  1HM7 A;  3KRO B;  5IN8 A;  2F92 F;  2Q9Z A;  1YYS A;  3LDW A;  3WCL A;  3AQB B;  4NKE A;  3N3D A;  4K10 A;  4KVW A;  4NUA A;  2Z4Y A;  4MC3 A;  3WEI A;  3RYW A;  4KVD A;  2Q9Y A;  5IK6 A;  4PVY F;  3LMD A;  3ICK A; 
#chains in the Genus database with same CATH homology
 4GP1 A;  3AE0 A;  5ILZ A;  4GA3 A;  5DJP F;  4KPD A;  4RXC A;  4LZC A;  5C05 A;  3DYG A;  4FJQ A;  3WEF A;  4JZB A;  3SDV A;  4E9Z A;  3N1V F;  4DWG A;  4NKF A;  3N1W F;  1N1B A;  1UBX A;  4JXN A;  5AYP A;  3WEK A;  2ZCS A;  4OGU A;  5JA0 F;  5DJV F;  3CKE A;  5ILK A;  3WCF A;  2O1O A;  3WEH A;  3V1X A;  4E9U A;  5DZ2 A;  1YYU A;  2E93 A;  4DEM F;  1YHM A;  2E4O A;  2E8X A;  3WCH A;  2F9K F;  4MC0 A;  5JV2 F;  4DHD A;  3KRC A;  5IKA A;  4NG6 A;  5ILH A;  5B02 A;  5IL8 A;  3LLW A;  5EAU A;  3N46 F;  2VF6 A;  1YYT A;  2ZEV A;  5AHU B;  3QKC A;  5ERM A;  2F7M F;  2J1P A;  3ICZ A;  1HXG A;  5DHK A;  3RMG A;  3WCJ A;  1EZF A;  2PS5 A;  4EA2 A;  2EWG A;  3KBK A;  3DYF A;  3M9U A;  1UBY A;  1JFG A;  2E94 A;  3ASX A;  3SDQ A;  1WY0 A;  2J1O A;  3ID0 A;  5H9D A;  3WCE A;  3LJI A;  3N45 F;  5E8L A;  4KUX A;  5IMI A;  5B00 A;  4KVY A;  3NPK A;  3APZ A;  5B01 A;  2Z52 A;  3V1V A;  4Q23 A;  4LIX A;  3TS7 A;  5IK9 A;  3N5J F;  5EAT A;  4LLT A;  2E90 A;  5JV0 F;  1YYQ A;  4JYX A;  4EA0 A;  3ACY A;  4GP2 A;  2E92 A;  3M00 A;  3AQC B;  3WCA A;  4LZ0 A;  3S4J A;  3PKO A;  3Q1O A;  5ERO A;  3WSA A;  2PS7 A;  2Z4V A;  1DI1 A;  1V4E A;  2F8C F;  3BNX A;  3KRA A;  3WEJ A;  1WL0 A;  5HNA A;  4PVX F;  5B0M A;  3OAC A;  2ONG A;  3KRO A;  3P41 A;  3TC1 A;  4LFV F;  2AEL A;  3MAV A;  3VJC A;  2OA6 A;  3Q2Q A;  3WCM A;  4JXY A;  2ZCO A;  3M0G A;  4RXA A;  4LFG A;  4RXE A;  3PDE A;  1YJ4 A;  4KK2 A;  3P8L A;  2Z4W A;  2E8U A;  1RQI A;  5B0K A;  4KPJ A;  3VJA A;  3SAE A;  2AEK A;  1HX9 A;  2ONH A;  3B7L A;  1UBV A;  1HXA A;  3CP6 A;  3EFQ A;  3N6K F;  4KQU A;  3IBA A;  2PS6 A;  5DGS F;  1N20 A;  5ILD A;  3RYE A;  3ACW A;  2P1C A;  4HD1 A;  4E1E A;  3KRC B;  2Q58 A;  3OAB B;  5EAS A;  5B0I A;  5IVG A;  4OKM A;  3N49 F;  1RQJ A;  4LPG F;  2I19 A;  3WCC A;  1V4H A;  3ADZ A;  3ACX A;  5HN7 A;  5IMP A;  2PS8 A;  2Q80 A;  4FP4 A;  4KFA A;  1V4K A;  4OMH A;  4OMG A;  4LFE A;  3Q30 A;  1HXC A;  4H5C F;  3WCI A;  4GAX A;  5IKH A;  1YYR A;  3DYH A;  4LPH F;  5ILY A;  2Z50 A;  3AQ0 A;  1JFA A;  4NFJ F;  4KKM A;  5I1U A;  2QIS A;  4QXS F;  4XQT F;  4L2X F;  4LTV A;  4F6X A;  4KQS A;  2ZY1 A;  1VG7 A;  5KSX F;  3VJE A;  3SDT A;  3WCD A;  1RTR A;  1YHL A;  2ZCR A;  5DGM F;  5DJR F;  5B0L A;  4P0W A;  2FOR A;  4RNQ A;  3P5R A;  2PS4 A;  4LA6 A;  5HN9 A;  3PYB A;  1VG6 A;  3NPR A;  3ZL6 A;  1WL1 A;  3ZMB A;  3RBM A;  3KRF B;  2F8Z F;  5A0K A;  5JV1 F;  2F89 F;  2AZL A;  1PS1 A;  3CC9 A;  5CG5 A;  1YHK A;  3WJO A;  3S9V A;  3KRP A;  4N9U A;  4OKZ A;  3VJ8 A;  3WCG A;  2RAH A;  2FTZ A;  4KWD A;  4ZQ8 A;  5ILI A;  3LZ9 A;  4H5D F;  4KQ5 A;  2H8O A;  5B03 A;  3WC9 A;  4P0X A;  3SDU A;  1ZW5 A;  3OYR A;  3TFP A;  2F94 F;  5HN8 A;  4WK5 A;  5DGN F;  2Z78 A;  1VG2 A;  5IL3 A;  2Z7I A;  3IPI A;  3WEG A;  1VG4 A;  3WCB A;  3ZCD A;  3P5P A;  3M01 A;  4RXD A;  4RYP A;  4F6V A;  3QQV A;  4DWB A;  2AZK A;  1V4J A;  1WL2 A;  3VJD A;  3LEE A;  2OPN A;  3W7F A;  3Q2Z A;  4N1Z F;  4LTZ A;  4XQS F;  3KB9 A;  5DIQ F;  2AET A;  1KIZ A;  3MZV A;  3ZOU A;  2Z4X A;  3EZ3 A;  2ZEU A;  3N0F A;  5A0I A;  2E8W A;  5JUZ F;  2E8T A;  3SDR A;  3LG5 A;  3VJB A;  5IMN A;  3UCA A;  1UBW A;  3N3L F;  1VG3 A;  3TFN A;  4LZ3 A;  5E8K A;  5A0J A;  4NFI F;  3LVS A;  3G4F A;  3PH7 A;  3PYA A;  2E91 A;  4LOB A;  2OPM A;  5AFX A;  4LLS A;  3M02 A;  3N5H F;  5B0J A;  3TFV A;  4NFK F;  4LUU A;  5DHI A;  4XQR F;  4JVJ F;  3ICM A;  1YQ7 A;  5E8H A;  4DXJ A;  3EGT A;  4LXW A;  1WKZ A;  3N0G A;  5IK0 A;  2Z7H A;  2E8V A;  4F62 A;  3LGK A;  1N24 A;  3OAB A;  1HM4 A;  4DZW A;  1FPS A;  3LGZ B;  5ILJ A;  3NRI A;  4JZX A;  5AEL A;  2OGD A;  1KIY A;  4P0V A;  1N23 A;  3NF2 A;  2Z4Z A;  3VJ9 A;  3V66 A;  2E95 A;  3BNY A;  3WE9 A;  3LOM A;  3LSN A;  1WMW A;  4DI5 A;  1WL3 A;  5DW7 A;  5ER8 A;  1N1Z A;  1N22 A;  4UMJ A;  4LA5 A;  3ZMC A;  5ERN A;  5CG6 A;  3WSB A;  3KRP B;  4QPF A;  4KVI A;  2J5C A;  2ZCQ A;  5IM1 A;  1V4I A;  1DGP A;  3WJK A;  2AZJ A;  3G4D A;  2DH4 A;  3KRA B;  3P8R A;  4EA1 A;  3ICN A;  1YV5 A;  1N21 A;  3KRF A;  4MC8 A;  3LK5 A;  3OAC B;  4H5E F;  3WJN A;  1HM7 A;  3KRO B;  5IN8 A;  2F92 F;  2Q9Z A;  1YYS A;  3LDW A;  3WCL A;  3AQB B;  4NKE A;  3N3D A;  4K10 A;  4KVW A;  4NUA A;  2Z4Y A;  4MC3 A;  3WEI A;  3RYW A;  4KVD A;  2Q9Y A;  5IK6 A;  4PVY F;  3LMD A;  3ICK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...