3TFVA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with bph-1154
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Dual dehydrosqualene/squalene synthase inhibitors: leads for innate immune system-based therapeutics.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 115
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2011-08-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 3tfvA00
3QQVA 3PH7A 3APZA 2AZKA 3N46F 3CKEA 3N49F 3KRCB 4RYPA 3V66A 1N24A 3KB9A 2E8VA 4LTVA 4HD1A 5HN7A 3WJKA 1WL2A 2AELA 3NF2A 5IKAA 3WCBA 2Z7HA 1VG6A 3PDEA 3KBKA 4NUAA 5I1UA 5B0KA 3N0GA 5DJRF 3ZMBA 4XQSF 3LLWA 3SDRA 4LLTA 2Z7IA 5IVGA 4DWBA 1FPSA 4DHDA 5IN8A 3N0FA 3VJAA 3WEFA 3WEIA 1YHLA 4LZ0A 4E9UA 4LXWA 2E91A 2Z4VA 5E8KA 1VG3A 3IPIA 4NG6A 5DW7A 3VJEA 3Q30A 3LJIA 3DYGA 2F94F 4LZCA 4XQTF 3G4DA 5E8HA 3ACXA 4F6VA 5ILZA 4DWGA 2Q9ZA 3WCFA 1DI1A 5JV1F 5IM1A 4P0VA 1YYQA 2OPMA 4OMHA 3TC1A 1N20A 3TS7A 2Z4ZA 3WC9A 2F8CF 2FTZA 5B01A 2PS8A 3S4JA 4KQ5A 4MC3A 5CG6A 3N5JF 2E8UA 5IMIA 2AEKA 1YV5A 1YHMA 4LFEA 2E92A 3WCIA 5ILIA 4UMJA 5DHKA 1WY0A 3EZ3A 1WMWA 2Z4WA 3WCAA 1VG4A 3DYHA 4NFJF 4NKEA 4RXCA 2ONHA 3WEHA 5DGMF 4DXJA 1RQIA 3ACWA 4RXEA 5IKHA 4MC0A 3SDVA 3IBAA 3V1XA 3LSNA 4LPGF 5A0KA 5DJPF 2F89F 4KKMA 5B0JA 3KRPB 1N1ZA 4JVJF 1JFGA 1UBVA 5H9DA 4LUUA 1UBXA 5HN9A 3LDWA 3NRIA 3ZL6A 2ZCOA 5DIQF 5A0IA 5A0JA 5IL8A 3KROB 2E8WA 2PS7A 3ID0A 3P5PA 5ILDA 3QKCA 4KPDA 2E95A 3RMGA 5DJVF 4KQUA 2AZJA 2P1CA 5KSXF 3RYEA 4ZQ8A 3ICMA 3WJOA 5IMPA 4KK2A 3SDUA 1ZW5A 3LVSA 1WL3A 3N5HF 3TFNA 5HN8A 3OYRA 1VG2A 2Z4YA 5JV0F 4H5CF 3MZVA 2PS6A 4L2XF 5EASA 2E4OA 4KVIA 3Q1OA 3EGTA 5EATA 4F62A 4KVWA 5B0MA 5ILYA 3N45F 4EA1A 1HX9A 3DYFA 2PS4A 3WCDA 1YYSA 4LA6A 1V4EA 4Q23A 3WCCA 2Q58A 5IL3A 3WCMA 4F6XA 3N3DA 3AQBB 3P5RA 5IK6A 3W7FA 3WCHA 3KRPA 2Z78A 3WCJA 4GAXA 3ASXA 5B02A 3LEEA 4JZBA 4LA5A 3AQCB 1JFAA 2RAHA 3PKOA 2H8OA 5B00A 2F8ZF 4H5DF 1KIYA 1RTRA 2ZY1A 3N6KF 3KROA 2ONGA 3NPKA 4N9UA 4LOBA 3AE0A 3N1VF 1HXGA 2F9KF 2AETA 2ZCSA 3M00A 4DI5A 3RBMA 4H5EF 4RNQA 5B0LA 3WJNA 3S9VA 4QXSF 1YYUA 3Q2QA 2AZLA 4LIXA 4EA0A 3BNYA 3ICZA 3ZOUA 4GA3A 3LGKA 2DH4A 4LTZA 2E93A 1YQ7A 3ADZA 5CG5A 3LZ9A 3KRAA 1V4JA 3WEKA 4E1EA 3P8RA 3ZMCA 3SDQA 4FP4A 3ICKA 4LFVF 3Q2ZA 4LFGA 3PYBA 3WCGA 5ILJA 2FORA 5C05A 3PYAA 2E90A 5B03A 1DGPA 3VJDA 3LOMA 3V1VA 3TFVA 5AHUB 3P8LA 4GP1A 3M01A 1HXCA 5JV2F 2F92F 1RQJA 3KRFB 4DZWA 2QISA 4LLSA 4NFIF 3P41A 4PVXF 2EWGA 1N21A 5ERNA 2J1OA 4PVYF 5IMNA 3VJ8A 4JZXA 3LMDA 4OMGA 3KRAB 5JA0F 1YJ4A 5DHIA 4OGUA 1V4HA 1EZFA 2Z4XA 5AYPA 2OGDA 3N1WF 3VJ9A 2VF6A 3SDTA 3WEJA 1VG7A 2ZCRA 5E8LA 5JUZF 4P0WA 2E8TA 5DGSF 5HNAA 1WL1A 3AQ0A 5AELA 1UBYA 1KIZA 4MC8A 4E9ZA 3OACA 4LPHF 4GP2A 4DEMF 2ZEUA 4JYXA 4NFKF 4P0XA 3WEGA 4KPJA 3LK5A 2I19A 3NPRA 3TFPA 4KWDA 5IK9A 3SAEA 5ILKA 5B0IA 1V4IA 4KVDA 1N22A 3B7LA 1PS1A 4LZ3A 4KUXA 2ZEVA 3WSBA 4EA2A 4KVYA 3RYWA 3M9UA 4N1ZF 2O1OA 4KQSA 3OABA 3CP6A 3ACYA 5EROA 5EAUA 1HM7A 4WK5A 4NKFA 3CC9A 3WCEA 2OA6A 3LG5A 3BNXA 3KRFA 4RXAA 3ZCDA 4K10A 3VJCA 1YYRA 2J5CA 4QPFA 2PS5A 3WE9A 3WSAA 3UCAA 4JXNA 1WKZA 5DZ2A 5ERMA 3KRCA 1YYTA 4FJQA 3MAVA 3OACB 3WCLA 4KFAA 1N1BA 5ILHA 2Z50A 2Q80A 1HXAA 2J1PA 3EFQA 4RXDA 5DGNF 2OPNA 2Z52A 1WL0A 5AFXA 2F7MF 4XQRF 3G4FA 3M0GA 4OKMA 2E94A 3VJBA 3N3LF 2E8XA 3OABB 1YHKA 1N23A 5IK0A 1V4KA 2ZCQA 5ER8A 4OKZA 2Q9YA 3M02A 1HM4A 3ICNA 4JXYA 1UBWA 3LGZB
chains in the Genus database with same CATH superfamily
3QQVA 3PH7A 3APZA 2AZKA 3N46F 3CKEA 3N49F 3KRCB 4RYPA 3V66A 1N24A 3KB9A 2E8VA 4LTVA 4HD1A 5HN7A 3WJKA 1WL2A 2AELA 3NF2A 5IKAA 3WCBA 2Z7HA 1VG6A 3PDEA 3KBKA 4NUAA 5I1UA 5B0KA 3N0GA 5DJRF 3ZMBA 4XQSF 3LLWA 3SDRA 4LLTA 2Z7IA 5IVGA 4DWBA 1FPSA 4DHDA 5IN8A 3N0FA 3VJAA 3WEFA 3WEIA 1YHLA 4LZ0A 4E9UA 4LXWA 2E91A 2Z4VA 5E8KA 1VG3A 3IPIA 4NG6A 5DW7A 3VJEA 3Q30A 3LJIA 3DYGA 2F94F 4LZCA 4XQTF 3G4DA 5E8HA 3ACXA 4F6VA 5ILZA 4DWGA 2Q9ZA 3WCFA 1DI1A 5JV1F 5IM1A 4P0VA 1YYQA 2OPMA 4OMHA 3TC1A 1N20A 3TS7A 2Z4ZA 3WC9A 2F8CF 2FTZA 5B01A 2PS8A 3S4JA 4KQ5A 4MC3A 5CG6A 3N5JF 2E8UA 5IMIA 2AEKA 1YV5A 1YHMA 4LFEA 2E92A 3WCIA 5ILIA 4UMJA 5DHKA 1WY0A 3EZ3A 1WMWA 2Z4WA 3WCAA 1VG4A 3DYHA 4NFJF 4NKEA 4RXCA 2ONHA 3WEHA 5DGMF 4DXJA 1RQIA 3ACWA 4RXEA 5IKHA 4MC0A 3SDVA 3IBAA 3V1XA 3LSNA 4LPGF 5A0KA 5DJPF 2F89F 4KKMA 5B0JA 3KRPB 1N1ZA 4JVJF 1JFGA 1UBVA 5H9DA 4LUUA 1UBXA 5HN9A 3LDWA 3NRIA 3ZL6A 2ZCOA 5DIQF 5A0IA 5A0JA 5IL8A 3KROB 2E8WA 2PS7A 3ID0A 3P5PA 5ILDA 3QKCA 4KPDA 2E95A 3RMGA 5DJVF 4KQUA 2AZJA 2P1CA 5KSXF 3RYEA 4ZQ8A 3ICMA 3WJOA 5IMPA 4KK2A 3SDUA 1ZW5A 3LVSA 1WL3A 3N5HF 3TFNA 5HN8A 3OYRA 1VG2A 2Z4YA 5JV0F 4H5CF 3MZVA 2PS6A 4L2XF 5EASA 2E4OA 4KVIA 3Q1OA 3EGTA 5EATA 4F62A 4KVWA 5B0MA 5ILYA 3N45F 4EA1A 1HX9A 3DYFA 2PS4A 3WCDA 1YYSA 4LA6A 1V4EA 4Q23A 3WCCA 2Q58A 5IL3A 3WCMA 4F6XA 3N3DA 3AQBB 3P5RA 5IK6A 3W7FA 3WCHA 3KRPA 2Z78A 3WCJA 4GAXA 3ASXA 5B02A 3LEEA 4JZBA 4LA5A 3AQCB 1JFAA 2RAHA 3PKOA 2H8OA 5B00A 2F8ZF 4H5DF 1KIYA 1RTRA 2ZY1A 3N6KF 3KROA 2ONGA 3NPKA 4N9UA 4LOBA 3AE0A 3N1VF 1HXGA 2F9KF 2AETA 2ZCSA 3M00A 4DI5A 3RBMA 4H5EF 4RNQA 5B0LA 3WJNA 3S9VA 4QXSF 1YYUA 3Q2QA 2AZLA 4LIXA 4EA0A 3BNYA 3ICZA 3ZOUA 4GA3A 3LGKA 2DH4A 4LTZA 2E93A 1YQ7A 3ADZA 5CG5A 3LZ9A 3KRAA 1V4JA 3WEKA 4E1EA 3P8RA 3ZMCA 3SDQA 4FP4A 3ICKA 4LFVF 3Q2ZA 4LFGA 3PYBA 3WCGA 5ILJA 2FORA 5C05A 3PYAA 2E90A 5B03A 1DGPA 3VJDA 3LOMA 3V1VA 3TFVA 5AHUB 3P8LA 4GP1A 3M01A 1HXCA 5JV2F 2F92F 1RQJA 3KRFB 4DZWA 2QISA 4LLSA 4NFIF 3P41A 4PVXF 2EWGA 1N21A 5ERNA 2J1OA 4PVYF 5IMNA 3VJ8A 4JZXA 3LMDA 4OMGA 3KRAB 5JA0F 1YJ4A 5DHIA 4OGUA 1V4HA 1EZFA 2Z4XA 5AYPA 2OGDA 3N1WF 3VJ9A 2VF6A 3SDTA 3WEJA 1VG7A 2ZCRA 5E8LA 5JUZF 4P0WA 2E8TA 5DGSF 5HNAA 1WL1A 3AQ0A 5AELA 1UBYA 1KIZA 4MC8A 4E9ZA 3OACA 4LPHF 4GP2A 4DEMF 2ZEUA 4JYXA 4NFKF 4P0XA 3WEGA 4KPJA 3LK5A 2I19A 3NPRA 3TFPA 4KWDA 5IK9A 3SAEA 5ILKA 5B0IA 1V4IA 4KVDA 1N22A 3B7LA 1PS1A 4LZ3A 4KUXA 2ZEVA 3WSBA 4EA2A 4KVYA 3RYWA 3M9UA 4N1ZF 2O1OA 4KQSA 3OABA 3CP6A 3ACYA 5EROA 5EAUA 1HM7A 4WK5A 4NKFA 3CC9A 3WCEA 2OA6A 3LG5A 3BNXA 3KRFA 4RXAA 3ZCDA 4K10A 3VJCA 1YYRA 2J5CA 4QPFA 2PS5A 3WE9A 3WSAA 3UCAA 4JXNA 1WKZA 5DZ2A 5ERMA 3KRCA 1YYTA 4FJQA 3MAVA 3OACB 3WCLA 4KFAA 1N1BA 5ILHA 2Z50A 2Q80A 1HXAA 2J1PA 3EFQA 4RXDA 5DGNF 2OPNA 2Z52A 1WL0A 5AFXA 2F7MF 4XQRF 3G4FA 3M0GA 4OKMA 2E94A 3VJBA 3N3LF 2E8XA 3OABB 1YHKA 1N23A 5IK0A 1V4KA 2ZCQA 5ER8A 4OKZA 2Q9YA 3M02A 1HM4A 3ICNA 4JXYA 1UBWA 3LGZB
chains in the Genus database with same CATH topology
3QQVA 3PH7A 3APZA 2AZKA 3N46F 3CKEA 3N49F 3KRCB 4RYPA 3V66A 1N24A 3KB9A 2E8VA 4LTVA 4HD1A 5HN7A 3WJKA 1WL2A 2AELA 3NF2A 5IKAA 3WCBA 2Z7HA 1VG6A 3PDEA 3KBKA 4NUAA 5I1UA 5B0KA 3N0GA 5DJRF 3ZMBA 4XQSF 3LLWA 3SDRA 4LLTA 2Z7IA 5IVGA 4DWBA 1FPSA 4DHDA 5IN8A 3N0FA 3VJAA 3WEFA 3WEIA 1YHLA 4LZ0A 4E9UA 4LXWA 2E91A 2Z4VA 5E8KA 1VG3A 3IPIA 4NG6A 5DW7A 3VJEA 3Q30A 3LJIA 3DYGA 2F94F 4LZCA 4XQTF 3G4DA 5E8HA 3ACXA 4F6VA 5ILZA 4DWGA 2Q9ZA 3WCFA 1DI1A 5JV1F 5IM1A 4P0VA 1YYQA 2OPMA 4OMHA 3TC1A 1N20A 3TS7A 2Z4ZA 3WC9A 2F8CF 2FTZA 5B01A 2PS8A 3S4JA 4KQ5A 4MC3A 5CG6A 3N5JF 2E8UA 5IMIA 2AEKA 1YV5A 1YHMA 4LFEA 2E92A 3WCIA 5ILIA 4UMJA 5DHKA 1WY0A 3EZ3A 1WMWA 2Z4WA 3WCAA 1VG4A 3DYHA 4NFJF 4NKEA 4RXCA 2ONHA 3WEHA 5DGMF 4DXJA 1RQIA 3ACWA 4RXEA 5IKHA 4MC0A 3SDVA 3IBAA 3V1XA 3LSNA 4LPGF 5A0KA 5DJPF 2F89F 4KKMA 5B0JA 3KRPB 1N1ZA 4JVJF 1JFGA 1UBVA 5H9DA 4LUUA 1UBXA 5HN9A 3LDWA 3NRIA 3ZL6A 2ZCOA 5DIQF 5A0IA 5A0JA 5IL8A 3KROB 2E8WA 2PS7A 3ID0A 3P5PA 5ILDA 3QKCA 4KPDA 2E95A 3RMGA 5DJVF 4KQUA 2AZJA 2P1CA 5KSXF 3RYEA 4ZQ8A 3ICMA 3WJOA 5IMPA 4KK2A 3SDUA 1ZW5A 3LVSA 1WL3A 3N5HF 3TFNA 5HN8A 3OYRA 1VG2A 2Z4YA 5JV0F 4H5CF 3MZVA 2PS6A 4L2XF 5EASA 2E4OA 4KVIA 3Q1OA 3EGTA 5EATA 4F62A 4KVWA 5B0MA 5ILYA 3N45F 4EA1A 1HX9A 3DYFA 2PS4A 3WCDA 1YYSA 4LA6A 1V4EA 4Q23A 3WCCA 2Q58A 5IL3A 3WCMA 4F6XA 3N3DA 3AQBB 3P5RA 5IK6A 3W7FA 3WCHA 3KRPA 2Z78A 3WCJA 4GAXA 3ASXA 5B02A 3LEEA 4JZBA 4LA5A 3AQCB 1JFAA 2RAHA 3PKOA 2H8OA 5B00A 2F8ZF 4H5DF 1KIYA 1RTRA 2ZY1A 3N6KF 3KROA 2ONGA 3NPKA 4N9UA 4LOBA 3AE0A 3N1VF 1HXGA 2F9KF 2AETA 2ZCSA 3M00A 4DI5A 3RBMA 4H5EF 4RNQA 5B0LA 3WJNA 3S9VA 4QXSF 1YYUA 3Q2QA 2AZLA 4LIXA 4EA0A 3BNYA 3ICZA 3ZOUA 4GA3A 3LGKA 2DH4A 4LTZA 2E93A 1YQ7A 3ADZA 5CG5A 3LZ9A 3KRAA 1V4JA 3WEKA 4E1EA 3P8RA 3ZMCA 3SDQA 4FP4A 3ICKA 4LFVF 3Q2ZA 4LFGA 3PYBA 3WCGA 5ILJA 2FORA 5C05A 3PYAA 2E90A 5B03A 1DGPA 3VJDA 3LOMA 3V1VA 3TFVA 5AHUB 3P8LA 4GP1A 3M01A 1HXCA 5JV2F 2F92F 1RQJA 3KRFB 4DZWA 2QISA 4LLSA 4NFIF 3P41A 4PVXF 2EWGA 1N21A 5ERNA 2J1OA 4PVYF 5IMNA 3VJ8A 4JZXA 3LMDA 4OMGA 3KRAB 5JA0F 1YJ4A 5DHIA 4OGUA 1V4HA 1EZFA 2Z4XA 5AYPA 2OGDA 3N1WF 3VJ9A 2VF6A 3SDTA 3WEJA 1VG7A 2ZCRA 5E8LA 5JUZF 4P0WA 2E8TA 5DGSF 5HNAA 1WL1A 3AQ0A 5AELA 1UBYA 1KIZA 4MC8A 4E9ZA 3OACA 4LPHF 4GP2A 4DEMF 2ZEUA 4JYXA 4NFKF 4P0XA 3WEGA 4KPJA 3LK5A 2I19A 3NPRA 3TFPA 4KWDA 5IK9A 3SAEA 5ILKA 5B0IA 1V4IA 4KVDA 1N22A 3B7LA 1PS1A 4LZ3A 4KUXA 2ZEVA 3WSBA 4EA2A 4KVYA 3RYWA 3M9UA 4N1ZF 2O1OA 4KQSA 3OABA 3CP6A 3ACYA 5EROA 5EAUA 1HM7A 4WK5A 4NKFA 3CC9A 3WCEA 2OA6A 3LG5A 3BNXA 3KRFA 4RXAA 3ZCDA 4K10A 3VJCA 1YYRA 2J5CA 4QPFA 2PS5A 3WE9A 3WSAA 3UCAA 4JXNA 1WKZA 5DZ2A 5ERMA 3KRCA 1YYTA 4FJQA 3MAVA 3OACB 3WCLA 4KFAA 1N1BA 5ILHA 2Z50A 2Q80A 1HXAA 2J1PA 3EFQA 4RXDA 5DGNF 2OPNA 2Z52A 1WL0A 5AFXA 2F7MF 4XQRF 3G4FA 3M0GA 4OKMA 2E94A 3VJBA 3N3LF 2E8XA 3OABB 1YHKA 1N23A 5IK0A 1V4KA 2ZCQA 5ER8A 4OKZA 2Q9YA 3M02A 1HM4A 3ICNA 4JXYA 1UBWA 3LGZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QQV A;  3PH7 A;  3APZ A;  2AZK A;  3N46 F;  3CKE A;  3N49 F;  3KRC B;  4RYP A;  3V66 A;  1N24 A;  3KB9 A;  2E8V A;  4LTV A;  4HD1 A;  5HN7 A;  3WJK A;  1WL2 A;  2AEL A;  3NF2 A;  5IKA A;  3WCB A;  2Z7H A;  1VG6 A;  3PDE A;  3KBK A;  4NUA A;  5I1U A;  5B0K A;  3N0G A;  5DJR F;  3ZMB A;  4XQS F;  3LLW A;  3SDR A;  4LLT A;  2Z7I A;  5IVG A;  4DWB A;  1FPS A;  4DHD A;  5IN8 A;  3N0F A;  3VJA A;  3WEF A;  3WEI A;  1YHL A;  4LZ0 A;  4E9U A;  4LXW A;  2E91 A;  2Z4V A;  5E8K A;  1VG3 A;  3IPI A;  4NG6 A;  5DW7 A;  3VJE A;  3Q30 A;  3LJI A;  3DYG A;  2F94 F;  4LZC A;  4XQT F;  3G4D A;  5E8H A;  3ACX A;  4F6V A;  5ILZ A;  4DWG A;  2Q9Z A;  3WCF A;  1DI1 A;  5JV1 F;  5IM1 A;  4P0V A;  1YYQ A;  2OPM A;  4OMH A;  3TC1 A;  1N20 A;  3TS7 A;  2Z4Z A;  3WC9 A;  2F8C F;  2FTZ A;  5B01 A;  2PS8 A;  3S4J A;  4KQ5 A;  4MC3 A;  5CG6 A;  3N5J F;  2E8U A;  5IMI A;  2AEK A;  1YV5 A;  1YHM A;  4LFE A;  2E92 A;  3WCI A;  5ILI A;  4UMJ A;  5DHK A;  1WY0 A;  3EZ3 A;  1WMW A;  2Z4W A;  3WCA A;  1VG4 A;  3DYH A;  4NFJ F;  4NKE A;  4RXC A;  2ONH A;  3WEH A;  5DGM F;  4DXJ A;  1RQI A;  3ACW A;  4RXE A;  5IKH A;  4MC0 A;  3SDV A;  3IBA A;  3V1X A;  3LSN A;  4LPG F;  5A0K A;  5DJP F;  2F89 F;  4KKM A;  5B0J A;  3KRP B;  1N1Z A;  4JVJ F;  1JFG A;  1UBV A;  5H9D A;  4LUU A;  1UBX A;  5HN9 A;  3LDW A;  3NRI A;  3ZL6 A;  2ZCO A;  5DIQ F;  5A0I A;  5A0J A;  5IL8 A;  3KRO B;  2E8W A;  2PS7 A;  3ID0 A;  3P5P A;  5ILD A;  3QKC A;  4KPD A;  2E95 A;  3RMG A;  5DJV F;  4KQU A;  2AZJ A;  2P1C A;  5KSX F;  3RYE A;  4ZQ8 A;  3ICM A;  3WJO A;  5IMP A;  4KK2 A;  3SDU A;  1ZW5 A;  3LVS A;  1WL3 A;  3N5H F;  3TFN A;  5HN8 A;  3OYR A;  1VG2 A;  2Z4Y A;  5JV0 F;  4H5C F;  3MZV A;  2PS6 A;  4L2X F;  5EAS A;  2E4O A;  4KVI A;  3Q1O A;  3EGT A;  5EAT A;  4F62 A;  4KVW A;  5B0M A;  5ILY A;  3N45 F;  4EA1 A;  1HX9 A;  3DYF A;  2PS4 A;  3WCD A;  1YYS A;  4LA6 A;  1V4E A;  4Q23 A;  3WCC A;  2Q58 A;  5IL3 A;  3WCM A;  4F6X A;  3N3D A;  3AQB B;  3P5R A;  5IK6 A;  3W7F A;  3WCH A;  3KRP A;  2Z78 A;  3WCJ A;  4GAX A;  3ASX A;  5B02 A;  3LEE A;  4JZB A;  4LA5 A;  3AQC B;  1JFA A;  2RAH A;  3PKO A;  2H8O A;  5B00 A;  2F8Z F;  4H5D F;  1KIY A;  1RTR A;  2ZY1 A;  3N6K F;  3KRO A;  2ONG A;  3NPK A;  4N9U A;  4LOB A;  3AE0 A;  3N1V F;  1HXG A;  2F9K F;  2AET A;  2ZCS A;  3M00 A;  4DI5 A;  3RBM A;  4H5E F;  4RNQ A;  5B0L A;  3WJN A;  3S9V A;  4QXS F;  1YYU A;  3Q2Q A;  2AZL A;  4LIX A;  4EA0 A;  3BNY A;  3ICZ A;  3ZOU A;  4GA3 A;  3LGK A;  2DH4 A;  4LTZ A;  2E93 A;  1YQ7 A;  3ADZ A;  5CG5 A;  3LZ9 A;  3KRA A;  1V4J A;  3WEK A;  4E1E A;  3P8R A;  3ZMC A;  3SDQ A;  4FP4 A;  3ICK A;  4LFV F;  3Q2Z A;  4LFG A;  3PYB A;  3WCG A;  5ILJ A;  2FOR A;  5C05 A;  3PYA A;  2E90 A;  5B03 A;  1DGP A;  3VJD A;  3LOM A;  3V1V A;  3TFV A;  5AHU B;  3P8L A;  4GP1 A;  3M01 A;  1HXC A;  5JV2 F;  2F92 F;  1RQJ A;  3KRF B;  4DZW A;  2QIS A;  4LLS A;  4NFI F;  3P41 A;  4PVX F;  2EWG A;  1N21 A;  5ERN A;  2J1O A;  4PVY F;  5IMN A;  3VJ8 A;  4JZX A;  3LMD A;  4OMG A;  3KRA B;  5JA0 F;  1YJ4 A;  5DHI A;  4OGU A;  1V4H A;  1EZF A;  2Z4X A;  5AYP A;  2OGD A;  3N1W F;  3VJ9 A;  2VF6 A;  3SDT A;  3WEJ A;  1VG7 A;  2ZCR A;  5E8L A;  5JUZ F;  4P0W A;  2E8T A;  5DGS F;  5HNA A;  1WL1 A;  3AQ0 A;  5AEL A;  1UBY A;  1KIZ A;  4MC8 A;  4E9Z A;  3OAC A;  4LPH F;  4GP2 A;  4DEM F;  2ZEU A;  4JYX A;  4NFK F;  4P0X A;  3WEG A;  4KPJ A;  3LK5 A;  2I19 A;  3NPR A;  3TFP A;  4KWD A;  5IK9 A;  3SAE A;  5ILK A;  5B0I A;  1V4I A;  4KVD A;  1N22 A;  3B7L A;  1PS1 A;  4LZ3 A;  4KUX A;  2ZEV A;  3WSB A;  4EA2 A;  4KVY A;  3RYW A;  3M9U A;  4N1Z F;  2O1O A;  4KQS A;  3OAB A;  3CP6 A;  3ACY A;  5ERO A;  5EAU A;  1HM7 A;  4WK5 A;  4NKF A;  3CC9 A;  3WCE A;  2OA6 A;  3LG5 A;  3BNX A;  3KRF A;  4RXA A;  3ZCD A;  4K10 A;  3VJC A;  1YYR A;  2J5C A;  4QPF A;  2PS5 A;  3WE9 A;  3WSA A;  3UCA A;  4JXN A;  1WKZ A;  5DZ2 A;  5ERM A;  3KRC A;  1YYT A;  4FJQ A;  3MAV A;  3OAC B;  3WCL A;  4KFA A;  1N1B A;  5ILH A;  2Z50 A;  2Q80 A;  1HXA A;  2J1P A;  3EFQ A;  4RXD A;  5DGN F;  2OPN A;  2Z52 A;  1WL0 A;  5AFX A;  2F7M F;  4XQR F;  3G4F A;  3M0G A;  4OKM A;  2E94 A;  3VJB A;  3N3L F;  2E8X A;  3OAB B;  1YHK A;  1N23 A;  5IK0 A;  1V4K A;  2ZCQ A;  5ER8 A;  4OKZ A;  2Q9Y A;  3M02 A;  1HM4 A;  3ICN A;  4JXY A;  1UBW A;  3LGZ B; 
#chains in the Genus database with same CATH topology
 3QQV A;  3PH7 A;  3APZ A;  2AZK A;  3N46 F;  3CKE A;  3N49 F;  3KRC B;  4RYP A;  3V66 A;  1N24 A;  3KB9 A;  2E8V A;  4LTV A;  4HD1 A;  5HN7 A;  3WJK A;  1WL2 A;  2AEL A;  3NF2 A;  5IKA A;  3WCB A;  2Z7H A;  1VG6 A;  3PDE A;  3KBK A;  4NUA A;  5I1U A;  5B0K A;  3N0G A;  5DJR F;  3ZMB A;  4XQS F;  3LLW A;  3SDR A;  4LLT A;  2Z7I A;  5IVG A;  4DWB A;  1FPS A;  4DHD A;  5IN8 A;  3N0F A;  3VJA A;  3WEF A;  3WEI A;  1YHL A;  4LZ0 A;  4E9U A;  4LXW A;  2E91 A;  2Z4V A;  5E8K A;  1VG3 A;  3IPI A;  4NG6 A;  5DW7 A;  3VJE A;  3Q30 A;  3LJI A;  3DYG A;  2F94 F;  4LZC A;  4XQT F;  3G4D A;  5E8H A;  3ACX A;  4F6V A;  5ILZ A;  4DWG A;  2Q9Z A;  3WCF A;  1DI1 A;  5JV1 F;  5IM1 A;  4P0V A;  1YYQ A;  2OPM A;  4OMH A;  3TC1 A;  1N20 A;  3TS7 A;  2Z4Z A;  3WC9 A;  2F8C F;  2FTZ A;  5B01 A;  2PS8 A;  3S4J A;  4KQ5 A;  4MC3 A;  5CG6 A;  3N5J F;  2E8U A;  5IMI A;  2AEK A;  1YV5 A;  1YHM A;  4LFE A;  2E92 A;  3WCI A;  5ILI A;  4UMJ A;  5DHK A;  1WY0 A;  3EZ3 A;  1WMW A;  2Z4W A;  3WCA A;  1VG4 A;  3DYH A;  4NFJ F;  4NKE A;  4RXC A;  2ONH A;  3WEH A;  5DGM F;  4DXJ A;  1RQI A;  3ACW A;  4RXE A;  5IKH A;  4MC0 A;  3SDV A;  3IBA A;  3V1X A;  3LSN A;  4LPG F;  5A0K A;  5DJP F;  2F89 F;  4KKM A;  5B0J A;  3KRP B;  1N1Z A;  4JVJ F;  1JFG A;  1UBV A;  5H9D A;  4LUU A;  1UBX A;  5HN9 A;  3LDW A;  3NRI A;  3ZL6 A;  2ZCO A;  5DIQ F;  5A0I A;  5A0J A;  5IL8 A;  3KRO B;  2E8W A;  2PS7 A;  3ID0 A;  3P5P A;  5ILD A;  3QKC A;  4KPD A;  2E95 A;  3RMG A;  5DJV F;  4KQU A;  2AZJ A;  2P1C A;  5KSX F;  3RYE A;  4ZQ8 A;  3ICM A;  3WJO A;  5IMP A;  4KK2 A;  3SDU A;  1ZW5 A;  3LVS A;  1WL3 A;  3N5H F;  3TFN A;  5HN8 A;  3OYR A;  1VG2 A;  2Z4Y A;  5JV0 F;  4H5C F;  3MZV A;  2PS6 A;  4L2X F;  5EAS A;  2E4O A;  4KVI A;  3Q1O A;  3EGT A;  5EAT A;  4F62 A;  4KVW A;  5B0M A;  5ILY A;  3N45 F;  4EA1 A;  1HX9 A;  3DYF A;  2PS4 A;  3WCD A;  1YYS A;  4LA6 A;  1V4E A;  4Q23 A;  3WCC A;  2Q58 A;  5IL3 A;  3WCM A;  4F6X A;  3N3D A;  3AQB B;  3P5R A;  5IK6 A;  3W7F A;  3WCH A;  3KRP A;  2Z78 A;  3WCJ A;  4GAX A;  3ASX A;  5B02 A;  3LEE A;  4JZB A;  4LA5 A;  3AQC B;  1JFA A;  2RAH A;  3PKO A;  2H8O A;  5B00 A;  2F8Z F;  4H5D F;  1KIY A;  1RTR A;  2ZY1 A;  3N6K F;  3KRO A;  2ONG A;  3NPK A;  4N9U A;  4LOB A;  3AE0 A;  3N1V F;  1HXG A;  2F9K F;  2AET A;  2ZCS A;  3M00 A;  4DI5 A;  3RBM A;  4H5E F;  4RNQ A;  5B0L A;  3WJN A;  3S9V A;  4QXS F;  1YYU A;  3Q2Q A;  2AZL A;  4LIX A;  4EA0 A;  3BNY A;  3ICZ A;  3ZOU A;  4GA3 A;  3LGK A;  2DH4 A;  4LTZ A;  2E93 A;  1YQ7 A;  3ADZ A;  5CG5 A;  3LZ9 A;  3KRA A;  1V4J A;  3WEK A;  4E1E A;  3P8R A;  3ZMC A;  3SDQ A;  4FP4 A;  3ICK A;  4LFV F;  3Q2Z A;  4LFG A;  3PYB A;  3WCG A;  5ILJ A;  2FOR A;  5C05 A;  3PYA A;  2E90 A;  5B03 A;  1DGP A;  3VJD A;  3LOM A;  3V1V A;  3TFV A;  5AHU B;  3P8L A;  4GP1 A;  3M01 A;  1HXC A;  5JV2 F;  2F92 F;  1RQJ A;  3KRF B;  4DZW A;  2QIS A;  4LLS A;  4NFI F;  3P41 A;  4PVX F;  2EWG A;  1N21 A;  5ERN A;  2J1O A;  4PVY F;  5IMN A;  3VJ8 A;  4JZX A;  3LMD A;  4OMG A;  3KRA B;  5JA0 F;  1YJ4 A;  5DHI A;  4OGU A;  1V4H A;  1EZF A;  2Z4X A;  5AYP A;  2OGD A;  3N1W F;  3VJ9 A;  2VF6 A;  3SDT A;  3WEJ A;  1VG7 A;  2ZCR A;  5E8L A;  5JUZ F;  4P0W A;  2E8T A;  5DGS F;  5HNA A;  1WL1 A;  3AQ0 A;  5AEL A;  1UBY A;  1KIZ A;  4MC8 A;  4E9Z A;  3OAC A;  4LPH F;  4GP2 A;  4DEM F;  2ZEU A;  4JYX A;  4NFK F;  4P0X A;  3WEG A;  4KPJ A;  3LK5 A;  2I19 A;  3NPR A;  3TFP A;  4KWD A;  5IK9 A;  3SAE A;  5ILK A;  5B0I A;  1V4I A;  4KVD A;  1N22 A;  3B7L A;  1PS1 A;  4LZ3 A;  4KUX A;  2ZEV A;  3WSB A;  4EA2 A;  4KVY A;  3RYW A;  3M9U A;  4N1Z F;  2O1O A;  4KQS A;  3OAB A;  3CP6 A;  3ACY A;  5ERO A;  5EAU A;  1HM7 A;  4WK5 A;  4NKF A;  3CC9 A;  3WCE A;  2OA6 A;  3LG5 A;  3BNX A;  3KRF A;  4RXA A;  3ZCD A;  4K10 A;  3VJC A;  1YYR A;  2J5C A;  4QPF A;  2PS5 A;  3WE9 A;  3WSA A;  3UCA A;  4JXN A;  1WKZ A;  5DZ2 A;  5ERM A;  3KRC A;  1YYT A;  4FJQ A;  3MAV A;  3OAC B;  3WCL A;  4KFA A;  1N1B A;  5ILH A;  2Z50 A;  2Q80 A;  1HXA A;  2J1P A;  3EFQ A;  4RXD A;  5DGN F;  2OPN A;  2Z52 A;  1WL0 A;  5AFX A;  2F7M F;  4XQR F;  3G4F A;  3M0G A;  4OKM A;  2E94 A;  3VJB A;  3N3L F;  2E8X A;  3OAB B;  1YHK A;  1N23 A;  5IK0 A;  1V4K A;  2ZCQ A;  5ER8 A;  4OKZ A;  2Q9Y A;  3M02 A;  1HM4 A;  3ICN A;  4JXY A;  1UBW A;  3LGZ B; 
#chains in the Genus database with same CATH homology
 3QQV A;  3PH7 A;  3APZ A;  2AZK A;  3N46 F;  3CKE A;  3N49 F;  3KRC B;  4RYP A;  3V66 A;  1N24 A;  3KB9 A;  2E8V A;  4LTV A;  4HD1 A;  5HN7 A;  3WJK A;  1WL2 A;  2AEL A;  3NF2 A;  5IKA A;  3WCB A;  2Z7H A;  1VG6 A;  3PDE A;  3KBK A;  4NUA A;  5I1U A;  5B0K A;  3N0G A;  5DJR F;  3ZMB A;  4XQS F;  3LLW A;  3SDR A;  4LLT A;  2Z7I A;  5IVG A;  4DWB A;  1FPS A;  4DHD A;  5IN8 A;  3N0F A;  3VJA A;  3WEF A;  3WEI A;  1YHL A;  4LZ0 A;  4E9U A;  4LXW A;  2E91 A;  2Z4V A;  5E8K A;  1VG3 A;  3IPI A;  4NG6 A;  5DW7 A;  3VJE A;  3Q30 A;  3LJI A;  3DYG A;  2F94 F;  4LZC A;  4XQT F;  3G4D A;  5E8H A;  3ACX A;  4F6V A;  5ILZ A;  4DWG A;  2Q9Z A;  3WCF A;  1DI1 A;  5JV1 F;  5IM1 A;  4P0V A;  1YYQ A;  2OPM A;  4OMH A;  3TC1 A;  1N20 A;  3TS7 A;  2Z4Z A;  3WC9 A;  2F8C F;  2FTZ A;  5B01 A;  2PS8 A;  3S4J A;  4KQ5 A;  4MC3 A;  5CG6 A;  3N5J F;  2E8U A;  5IMI A;  2AEK A;  1YV5 A;  1YHM A;  4LFE A;  2E92 A;  3WCI A;  5ILI A;  4UMJ A;  5DHK A;  1WY0 A;  3EZ3 A;  1WMW A;  2Z4W A;  3WCA A;  1VG4 A;  3DYH A;  4NFJ F;  4NKE A;  4RXC A;  2ONH A;  3WEH A;  5DGM F;  4DXJ A;  1RQI A;  3ACW A;  4RXE A;  5IKH A;  4MC0 A;  3SDV A;  3IBA A;  3V1X A;  3LSN A;  4LPG F;  5A0K A;  5DJP F;  2F89 F;  4KKM A;  5B0J A;  3KRP B;  1N1Z A;  4JVJ F;  1JFG A;  1UBV A;  5H9D A;  4LUU A;  1UBX A;  5HN9 A;  3LDW A;  3NRI A;  3ZL6 A;  2ZCO A;  5DIQ F;  5A0I A;  5A0J A;  5IL8 A;  3KRO B;  2E8W A;  2PS7 A;  3ID0 A;  3P5P A;  5ILD A;  3QKC A;  4KPD A;  2E95 A;  3RMG A;  5DJV F;  4KQU A;  2AZJ A;  2P1C A;  5KSX F;  3RYE A;  4ZQ8 A;  3ICM A;  3WJO A;  5IMP A;  4KK2 A;  3SDU A;  1ZW5 A;  3LVS A;  1WL3 A;  3N5H F;  3TFN A;  5HN8 A;  3OYR A;  1VG2 A;  2Z4Y A;  5JV0 F;  4H5C F;  3MZV A;  2PS6 A;  4L2X F;  5EAS A;  2E4O A;  4KVI A;  3Q1O A;  3EGT A;  5EAT A;  4F62 A;  4KVW A;  5B0M A;  5ILY A;  3N45 F;  4EA1 A;  1HX9 A;  3DYF A;  2PS4 A;  3WCD A;  1YYS A;  4LA6 A;  1V4E A;  4Q23 A;  3WCC A;  2Q58 A;  5IL3 A;  3WCM A;  4F6X A;  3N3D A;  3AQB B;  3P5R A;  5IK6 A;  3W7F A;  3WCH A;  3KRP A;  2Z78 A;  3WCJ A;  4GAX A;  3ASX A;  5B02 A;  3LEE A;  4JZB A;  4LA5 A;  3AQC B;  1JFA A;  2RAH A;  3PKO A;  2H8O A;  5B00 A;  2F8Z F;  4H5D F;  1KIY A;  1RTR A;  2ZY1 A;  3N6K F;  3KRO A;  2ONG A;  3NPK A;  4N9U A;  4LOB A;  3AE0 A;  3N1V F;  1HXG A;  2F9K F;  2AET A;  2ZCS A;  3M00 A;  4DI5 A;  3RBM A;  4H5E F;  4RNQ A;  5B0L A;  3WJN A;  3S9V A;  4QXS F;  1YYU A;  3Q2Q A;  2AZL A;  4LIX A;  4EA0 A;  3BNY A;  3ICZ A;  3ZOU A;  4GA3 A;  3LGK A;  2DH4 A;  4LTZ A;  2E93 A;  1YQ7 A;  3ADZ A;  5CG5 A;  3LZ9 A;  3KRA A;  1V4J A;  3WEK A;  4E1E A;  3P8R A;  3ZMC A;  3SDQ A;  4FP4 A;  3ICK A;  4LFV F;  3Q2Z A;  4LFG A;  3PYB A;  3WCG A;  5ILJ A;  2FOR A;  5C05 A;  3PYA A;  2E90 A;  5B03 A;  1DGP A;  3VJD A;  3LOM A;  3V1V A;  3TFV A;  5AHU B;  3P8L A;  4GP1 A;  3M01 A;  1HXC A;  5JV2 F;  2F92 F;  1RQJ A;  3KRF B;  4DZW A;  2QIS A;  4LLS A;  4NFI F;  3P41 A;  4PVX F;  2EWG A;  1N21 A;  5ERN A;  2J1O A;  4PVY F;  5IMN A;  3VJ8 A;  4JZX A;  3LMD A;  4OMG A;  3KRA B;  5JA0 F;  1YJ4 A;  5DHI A;  4OGU A;  1V4H A;  1EZF A;  2Z4X A;  5AYP A;  2OGD A;  3N1W F;  3VJ9 A;  2VF6 A;  3SDT A;  3WEJ A;  1VG7 A;  2ZCR A;  5E8L A;  5JUZ F;  4P0W A;  2E8T A;  5DGS F;  5HNA A;  1WL1 A;  3AQ0 A;  5AEL A;  1UBY A;  1KIZ A;  4MC8 A;  4E9Z A;  3OAC A;  4LPH F;  4GP2 A;  4DEM F;  2ZEU A;  4JYX A;  4NFK F;  4P0X A;  3WEG A;  4KPJ A;  3LK5 A;  2I19 A;  3NPR A;  3TFP A;  4KWD A;  5IK9 A;  3SAE A;  5ILK A;  5B0I A;  1V4I A;  4KVD A;  1N22 A;  3B7L A;  1PS1 A;  4LZ3 A;  4KUX A;  2ZEV A;  3WSB A;  4EA2 A;  4KVY A;  3RYW A;  3M9U A;  4N1Z F;  2O1O A;  4KQS A;  3OAB A;  3CP6 A;  3ACY A;  5ERO A;  5EAU A;  1HM7 A;  4WK5 A;  4NKF A;  3CC9 A;  3WCE A;  2OA6 A;  3LG5 A;  3BNX A;  3KRF A;  4RXA A;  3ZCD A;  4K10 A;  3VJC A;  1YYR A;  2J5C A;  4QPF A;  2PS5 A;  3WE9 A;  3WSA A;  3UCA A;  4JXN A;  1WKZ A;  5DZ2 A;  5ERM A;  3KRC A;  1YYT A;  4FJQ A;  3MAV A;  3OAC B;  3WCL A;  4KFA A;  1N1B A;  5ILH A;  2Z50 A;  2Q80 A;  1HXA A;  2J1P A;  3EFQ A;  4RXD A;  5DGN F;  2OPN A;  2Z52 A;  1WL0 A;  5AFX A;  2F7M F;  4XQR F;  3G4F A;  3M0G A;  4OKM A;  2E94 A;  3VJB A;  3N3L F;  2E8X A;  3OAB B;  1YHK A;  1N23 A;  5IK0 A;  1V4K A;  2ZCQ A;  5ER8 A;  4OKZ A;  2Q9Y A;  3M02 A;  1HM4 A;  3ICN A;  4JXY A;  1UBW A;  3LGZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...