4E9UA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with a thiocyanate inhibitor
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 116
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4e9uA00
4KPDA 1HX9A 4DXJA 4OKMA 4KPJA 3BNYA 4JXYA 2E4OA 4DWGA 4DWBA 1HM4A 4F6VA 3LOMA 1RQIA 1UBWA 1YYRA 5DJRF 5B00A 1HXAA 4FP4A 2DH4A 3KRCB 3MAVA 3VJ9A 5JUZF 4LA5A 5DGNF 3WCBA 2Q80A 2J1OA 2E8WA 5IMIA 4DEMF 3TC1A 4OGUA 5JA0F 3WCIA 4JZXA 2PS4A 3B7LA 4LLSA 3N0FA 1ZW5A 3UCAA 4E9ZA 3PYAA 1WKZA 3V1VA 1N21A 4EA1A 5B01A 3ZL6A 3LEEA 5DHIA 3CKEA 3OYRA 3IBAA 2ZCSA 3RMGA 3ACYA 5I1UA 4RXCA 2OGDA 3WCEA 1V4HA 4P0WA 3LGZB 2I19A 3CC9A 2Z4WA 3Q2ZA 3LMDA 3P8RA 3OACB 3N6KF 5B0LA 4XQTF 1DGPA 3LJIA 5H9DA 3G4FA 5IKHA 4H5EF 3M00A 3KRAB 3V66A 5CG5A 3ADZA 3EGTA 2ZCRA 4KVYA 3ACWA 2J5CA 2Z4ZA 2OPMA 3ACXA 4JXNA 1YYQA 2E8XA 4L2XF 3TFNA 3S9VA 1WL0A 3LLWA 3P5RA 2E8VA 4OKZA 3APZA 3WCCA 1V4JA 4E1EA 5AFXA 3SDUA 1YYSA 3LGKA 1N1ZA 3AQ0A 3SDQA 1HXGA 2F8CF 4GP1A 5DJVF 4LA6A 5ILYA 4RXEA 1YYUA 3PYBA 4LZCA 5AYPA 4KQ5A 3BNXA 5EAUA 5DZ2A 3RYEA 4PVXF 2AZJA 5IKAA 3M02A 3LG5A 2Q9ZA 3DYGA 4LTVA 3WEFA 3WCHA 5ER8A 2E90A 2Z7HA 3VJCA 2F9KF 3M9UA 3VJAA 2F92F 3N1WF 3Q1OA 1YYTA 2QISA 5IM1A 3KROB 3ICNA 2O1OA 4DZWA 3NRIA 1YHKA 2PS8A 4KVWA 3VJDA 4LXWA 3PDEA 3IPIA 3G4DA 4NKFA 5IVGA 2H8OA 5HN7A 5DGMF 2J1PA 4GP2A 2ZY1A 3WCMA 3QQVA 3WJOA 4NUAA 4LZ0A 2F94F 1VG7A 3OABB 3PH7A 3WJNA 4PVYF 4F6XA 2VF6A 3TFVA 4GA3A 5ILKA 4JZBA 1RQJA 2Z4XA 4XQSF 4OMGA 3NPKA 2F8ZF 3WCFA 4ZQ8A 5DIQF 3N0GA 4LIXA 4DHDA 4WK5A 2Z50A 3LSNA 2FORA 2E93A 3SDVA 2Q58A 5KSXF 3KRPB 2Q9YA 2F89F 2OA6A 5ILDA 4LPHF 3WCJA 3WC9A 2E8TA 3WCGA 5DHKA 4DI5A 3WEHA 3NF2A 3TS7A 1WY0A 2OPNA 5AHUB 3KRFB 3KRCA 1JFAA 4LZ3A 3SDTA 1N23A 5A0JA 3V1XA 4MC3A 3VJ8A 4LLTA 5IMNA 4KFAA 2Z4VA 4KKMA 2ONHA 4KQUA 5ERNA 5E8LA 3P8LA 3Q2QA 3N5HF 4F62A 5E8HA 4GAXA 1WL3A 3ASXA 4MC8A 2AETA 1N22A 3ID0A 3P41A 3AQCB 5EROA 1KIYA 2E94A 4H5DF 3RYWA 3WCDA 2ZCQA 4RYPA 1VG6A 1VG2A 4N9UA 4JYXA 3VJBA 4QPFA 3QKCA 3EZ3A 3LK5A 3WSAA 3OACA 5ILHA 3KRFA 3WCLA 3N1VF 4RXAA 5B02A 2Z4YA 3LZ9A 1YV5A 2F7MF 4N1ZF 2E91A 5HN8A 1HXCA 5AELA 1N1BA 3KRAA 2ONGA 4LUUA 4RNQA 3AQBB 3TFPA 3EFQA 3SAEA 5ILZA 1PS1A 2P1CA 1YHLA 3DYFA 3ICKA 2FTZA 3NPRA 1UBYA 2Z52A 2Z78A 1V4IA 4XQRF 4KUXA 1WMWA 5DJPF 5B0KA 4K10A 5DW7A 1VG3A 5IL8A 1V4EA 3N3LF 5CG6A 4NFJF 3M0GA 4H5CF 1WL2A 2E8UA 5ERMA 2PS6A 5A0KA 2Z7IA 2PS5A 4LPGF 1HM7A 1YQ7A 5ILIA 3WE9A 3N49F 5B0JA 1EZFA 5A0IA 1VG4A 3P5PA 4QXSF 2AELA 3RBMA 3N45F 3KBKA 3KROA 4EA2A 4RXDA 4P0VA 2RAHA 2ZCOA 4KVIA 3WCAA 5B0IA 2AZLA 1UBVA 3ZMBA 2AZKA 2EWGA 5IK6A 5EATA 1FPSA 3N46F 3ZOUA 5IK0A 4FJQA 3ICZA 3OABA 3WJKA 4NFKF 5JV0F 5IL3A 4HD1A 4KVDA 1YHMA 2PS7A 5C05A 1N24A 3ICMA 3PKOA 3WEGA 3CP6A 5IK9A 4Q23A 4LFEA 3LVSA 3ZCDA 4P0XA 1JFGA 4LFGA 1KIZA 3WSBA 4NKEA 4LOBA 3N3DA 3Q30A 1YJ4A 4KQSA 3AE0A 5JV1F 3KRPA 3W7FA 4NFIF 5HNAA 4E9UA 1RTRA 3SDRA 3KB9A 2ZEUA 4UMJA 4NG6A 3DYHA 4KK2A 3VJEA 3ZMCA 1N20A 5JV2F 1WL1A 4JVJF 5B03A 5E8KA 1UBXA 2E92A 1DI1A 5HN9A 4OMHA 4LTZA 3LDWA 2ZEVA 5IN8A 3WEIA 5B0MA 3S4JA 4EA0A 4LFVF 3MZVA 4KWDA 2E95A 1V4KA 3N5JF 3M01A 3WEKA 5IMPA 2AEKA 3WEJA 5DGSF 5EASA 4MC0A 5ILJA
chains in the Genus database with same CATH superfamily
4KPDA 1HX9A 4DXJA 4OKMA 4KPJA 3BNYA 4JXYA 2E4OA 4DWGA 4DWBA 1HM4A 4F6VA 3LOMA 1RQIA 1UBWA 1YYRA 5DJRF 5B00A 1HXAA 4FP4A 2DH4A 3KRCB 3MAVA 3VJ9A 5JUZF 4LA5A 5DGNF 3WCBA 2Q80A 2J1OA 2E8WA 5IMIA 4DEMF 3TC1A 4OGUA 5JA0F 3WCIA 4JZXA 2PS4A 3B7LA 4LLSA 3N0FA 1ZW5A 3UCAA 4E9ZA 3PYAA 1WKZA 3V1VA 1N21A 4EA1A 5B01A 3ZL6A 3LEEA 5DHIA 3CKEA 3OYRA 3IBAA 2ZCSA 3RMGA 3ACYA 5I1UA 4RXCA 2OGDA 3WCEA 1V4HA 4P0WA 3LGZB 2I19A 3CC9A 2Z4WA 3Q2ZA 3LMDA 3P8RA 3OACB 3N6KF 5B0LA 4XQTF 1DGPA 3LJIA 5H9DA 3G4FA 5IKHA 4H5EF 3M00A 3KRAB 3V66A 5CG5A 3ADZA 3EGTA 2ZCRA 4KVYA 3ACWA 2J5CA 2Z4ZA 2OPMA 3ACXA 4JXNA 1YYQA 2E8XA 4L2XF 3TFNA 3S9VA 1WL0A 3LLWA 3P5RA 2E8VA 4OKZA 3APZA 3WCCA 1V4JA 4E1EA 5AFXA 3SDUA 1YYSA 3LGKA 1N1ZA 3AQ0A 3SDQA 1HXGA 2F8CF 4GP1A 5DJVF 4LA6A 5ILYA 4RXEA 1YYUA 3PYBA 4LZCA 5AYPA 4KQ5A 3BNXA 5EAUA 5DZ2A 3RYEA 4PVXF 2AZJA 5IKAA 3M02A 3LG5A 2Q9ZA 3DYGA 4LTVA 3WEFA 3WCHA 5ER8A 2E90A 2Z7HA 3VJCA 2F9KF 3M9UA 3VJAA 2F92F 3N1WF 3Q1OA 1YYTA 2QISA 5IM1A 3KROB 3ICNA 2O1OA 4DZWA 3NRIA 1YHKA 2PS8A 4KVWA 3VJDA 4LXWA 3PDEA 3IPIA 3G4DA 4NKFA 5IVGA 2H8OA 5HN7A 5DGMF 2J1PA 4GP2A 2ZY1A 3WCMA 3QQVA 3WJOA 4NUAA 4LZ0A 2F94F 1VG7A 3OABB 3PH7A 3WJNA 4PVYF 4F6XA 2VF6A 3TFVA 4GA3A 5ILKA 4JZBA 1RQJA 2Z4XA 4XQSF 4OMGA 3NPKA 2F8ZF 3WCFA 4ZQ8A 5DIQF 3N0GA 4LIXA 4DHDA 4WK5A 2Z50A 3LSNA 2FORA 2E93A 3SDVA 2Q58A 5KSXF 3KRPB 2Q9YA 2F89F 2OA6A 5ILDA 4LPHF 3WCJA 3WC9A 2E8TA 3WCGA 5DHKA 4DI5A 3WEHA 3NF2A 3TS7A 1WY0A 2OPNA 5AHUB 3KRFB 3KRCA 1JFAA 4LZ3A 3SDTA 1N23A 5A0JA 3V1XA 4MC3A 3VJ8A 4LLTA 5IMNA 4KFAA 2Z4VA 4KKMA 2ONHA 4KQUA 5ERNA 5E8LA 3P8LA 3Q2QA 3N5HF 4F62A 5E8HA 4GAXA 1WL3A 3ASXA 4MC8A 2AETA 1N22A 3ID0A 3P41A 3AQCB 5EROA 1KIYA 2E94A 4H5DF 3RYWA 3WCDA 2ZCQA 4RYPA 1VG6A 1VG2A 4N9UA 4JYXA 3VJBA 4QPFA 3QKCA 3EZ3A 3LK5A 3WSAA 3OACA 5ILHA 3KRFA 3WCLA 3N1VF 4RXAA 5B02A 2Z4YA 3LZ9A 1YV5A 2F7MF 4N1ZF 2E91A 5HN8A 1HXCA 5AELA 1N1BA 3KRAA 2ONGA 4LUUA 4RNQA 3AQBB 3TFPA 3EFQA 3SAEA 5ILZA 1PS1A 2P1CA 1YHLA 3DYFA 3ICKA 2FTZA 3NPRA 1UBYA 2Z52A 2Z78A 1V4IA 4XQRF 4KUXA 1WMWA 5DJPF 5B0KA 4K10A 5DW7A 1VG3A 5IL8A 1V4EA 3N3LF 5CG6A 4NFJF 3M0GA 4H5CF 1WL2A 2E8UA 5ERMA 2PS6A 5A0KA 2Z7IA 2PS5A 4LPGF 1HM7A 1YQ7A 5ILIA 3WE9A 3N49F 5B0JA 1EZFA 5A0IA 1VG4A 3P5PA 4QXSF 2AELA 3RBMA 3N45F 3KBKA 3KROA 4EA2A 4RXDA 4P0VA 2RAHA 2ZCOA 4KVIA 3WCAA 5B0IA 2AZLA 1UBVA 3ZMBA 2AZKA 2EWGA 5IK6A 5EATA 1FPSA 3N46F 3ZOUA 5IK0A 4FJQA 3ICZA 3OABA 3WJKA 4NFKF 5JV0F 5IL3A 4HD1A 4KVDA 1YHMA 2PS7A 5C05A 1N24A 3ICMA 3PKOA 3WEGA 3CP6A 5IK9A 4Q23A 4LFEA 3LVSA 3ZCDA 4P0XA 1JFGA 4LFGA 1KIZA 3WSBA 4NKEA 4LOBA 3N3DA 3Q30A 1YJ4A 4KQSA 3AE0A 5JV1F 3KRPA 3W7FA 4NFIF 5HNAA 4E9UA 1RTRA 3SDRA 3KB9A 2ZEUA 4UMJA 4NG6A 3DYHA 4KK2A 3VJEA 3ZMCA 1N20A 5JV2F 1WL1A 4JVJF 5B03A 5E8KA 1UBXA 2E92A 1DI1A 5HN9A 4OMHA 4LTZA 3LDWA 2ZEVA 5IN8A 3WEIA 5B0MA 3S4JA 4EA0A 4LFVF 3MZVA 4KWDA 2E95A 1V4KA 3N5JF 3M01A 3WEKA 5IMPA 2AEKA 3WEJA 5DGSF 5EASA 4MC0A 5ILJA
chains in the Genus database with same CATH topology
4KPDA 1HX9A 4DXJA 4OKMA 4KPJA 3BNYA 4JXYA 2E4OA 4DWGA 4DWBA 1HM4A 4F6VA 3LOMA 1RQIA 1UBWA 1YYRA 5DJRF 5B00A 1HXAA 4FP4A 2DH4A 3KRCB 3MAVA 3VJ9A 5JUZF 4LA5A 5DGNF 3WCBA 2Q80A 2J1OA 2E8WA 5IMIA 4DEMF 3TC1A 4OGUA 5JA0F 3WCIA 4JZXA 2PS4A 3B7LA 4LLSA 3N0FA 1ZW5A 3UCAA 4E9ZA 3PYAA 1WKZA 3V1VA 1N21A 4EA1A 5B01A 3ZL6A 3LEEA 5DHIA 3CKEA 3OYRA 3IBAA 2ZCSA 3RMGA 3ACYA 5I1UA 4RXCA 2OGDA 3WCEA 1V4HA 4P0WA 3LGZB 2I19A 3CC9A 2Z4WA 3Q2ZA 3LMDA 3P8RA 3OACB 3N6KF 5B0LA 4XQTF 1DGPA 3LJIA 5H9DA 3G4FA 5IKHA 4H5EF 3M00A 3KRAB 3V66A 5CG5A 3ADZA 3EGTA 2ZCRA 4KVYA 3ACWA 2J5CA 2Z4ZA 2OPMA 3ACXA 4JXNA 1YYQA 2E8XA 4L2XF 3TFNA 3S9VA 1WL0A 3LLWA 3P5RA 2E8VA 4OKZA 3APZA 3WCCA 1V4JA 4E1EA 5AFXA 3SDUA 1YYSA 3LGKA 1N1ZA 3AQ0A 3SDQA 1HXGA 2F8CF 4GP1A 5DJVF 4LA6A 5ILYA 4RXEA 1YYUA 3PYBA 4LZCA 5AYPA 4KQ5A 3BNXA 5EAUA 5DZ2A 3RYEA 4PVXF 2AZJA 5IKAA 3M02A 3LG5A 2Q9ZA 3DYGA 4LTVA 3WEFA 3WCHA 5ER8A 2E90A 2Z7HA 3VJCA 2F9KF 3M9UA 3VJAA 2F92F 3N1WF 3Q1OA 1YYTA 2QISA 5IM1A 3KROB 3ICNA 2O1OA 4DZWA 3NRIA 1YHKA 2PS8A 4KVWA 3VJDA 4LXWA 3PDEA 3IPIA 3G4DA 4NKFA 5IVGA 2H8OA 5HN7A 5DGMF 2J1PA 4GP2A 2ZY1A 3WCMA 3QQVA 3WJOA 4NUAA 4LZ0A 2F94F 1VG7A 3OABB 3PH7A 3WJNA 4PVYF 4F6XA 2VF6A 3TFVA 4GA3A 5ILKA 4JZBA 1RQJA 2Z4XA 4XQSF 4OMGA 3NPKA 2F8ZF 3WCFA 4ZQ8A 5DIQF 3N0GA 4LIXA 4DHDA 4WK5A 2Z50A 3LSNA 2FORA 2E93A 3SDVA 2Q58A 5KSXF 3KRPB 2Q9YA 2F89F 2OA6A 5ILDA 4LPHF 3WCJA 3WC9A 2E8TA 3WCGA 5DHKA 4DI5A 3WEHA 3NF2A 3TS7A 1WY0A 2OPNA 5AHUB 3KRFB 3KRCA 1JFAA 4LZ3A 3SDTA 1N23A 5A0JA 3V1XA 4MC3A 3VJ8A 4LLTA 5IMNA 4KFAA 2Z4VA 4KKMA 2ONHA 4KQUA 5ERNA 5E8LA 3P8LA 3Q2QA 3N5HF 4F62A 5E8HA 4GAXA 1WL3A 3ASXA 4MC8A 2AETA 1N22A 3ID0A 3P41A 3AQCB 5EROA 1KIYA 2E94A 4H5DF 3RYWA 3WCDA 2ZCQA 4RYPA 1VG6A 1VG2A 4N9UA 4JYXA 3VJBA 4QPFA 3QKCA 3EZ3A 3LK5A 3WSAA 3OACA 5ILHA 3KRFA 3WCLA 3N1VF 4RXAA 5B02A 2Z4YA 3LZ9A 1YV5A 2F7MF 4N1ZF 2E91A 5HN8A 1HXCA 5AELA 1N1BA 3KRAA 2ONGA 4LUUA 4RNQA 3AQBB 3TFPA 3EFQA 3SAEA 5ILZA 1PS1A 2P1CA 1YHLA 3DYFA 3ICKA 2FTZA 3NPRA 1UBYA 2Z52A 2Z78A 1V4IA 4XQRF 4KUXA 1WMWA 5DJPF 5B0KA 4K10A 5DW7A 1VG3A 5IL8A 1V4EA 3N3LF 5CG6A 4NFJF 3M0GA 4H5CF 1WL2A 2E8UA 5ERMA 2PS6A 5A0KA 2Z7IA 2PS5A 4LPGF 1HM7A 1YQ7A 5ILIA 3WE9A 3N49F 5B0JA 1EZFA 5A0IA 1VG4A 3P5PA 4QXSF 2AELA 3RBMA 3N45F 3KBKA 3KROA 4EA2A 4RXDA 4P0VA 2RAHA 2ZCOA 4KVIA 3WCAA 5B0IA 2AZLA 1UBVA 3ZMBA 2AZKA 2EWGA 5IK6A 5EATA 1FPSA 3N46F 3ZOUA 5IK0A 4FJQA 3ICZA 3OABA 3WJKA 4NFKF 5JV0F 5IL3A 4HD1A 4KVDA 1YHMA 2PS7A 5C05A 1N24A 3ICMA 3PKOA 3WEGA 3CP6A 5IK9A 4Q23A 4LFEA 3LVSA 3ZCDA 4P0XA 1JFGA 4LFGA 1KIZA 3WSBA 4NKEA 4LOBA 3N3DA 3Q30A 1YJ4A 4KQSA 3AE0A 5JV1F 3KRPA 3W7FA 4NFIF 5HNAA 4E9UA 1RTRA 3SDRA 3KB9A 2ZEUA 4UMJA 4NG6A 3DYHA 4KK2A 3VJEA 3ZMCA 1N20A 5JV2F 1WL1A 4JVJF 5B03A 5E8KA 1UBXA 2E92A 1DI1A 5HN9A 4OMHA 4LTZA 3LDWA 2ZEVA 5IN8A 3WEIA 5B0MA 3S4JA 4EA0A 4LFVF 3MZVA 4KWDA 2E95A 1V4KA 3N5JF 3M01A 3WEKA 5IMPA 2AEKA 3WEJA 5DGSF 5EASA 4MC0A 5ILJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPD A;  1HX9 A;  4DXJ A;  4OKM A;  4KPJ A;  3BNY A;  4JXY A;  2E4O A;  4DWG A;  4DWB A;  1HM4 A;  4F6V A;  3LOM A;  1RQI A;  1UBW A;  1YYR A;  5DJR F;  5B00 A;  1HXA A;  4FP4 A;  2DH4 A;  3KRC B;  3MAV A;  3VJ9 A;  5JUZ F;  4LA5 A;  5DGN F;  3WCB A;  2Q80 A;  2J1O A;  2E8W A;  5IMI A;  4DEM F;  3TC1 A;  4OGU A;  5JA0 F;  3WCI A;  4JZX A;  2PS4 A;  3B7L A;  4LLS A;  3N0F A;  1ZW5 A;  3UCA A;  4E9Z A;  3PYA A;  1WKZ A;  3V1V A;  1N21 A;  4EA1 A;  5B01 A;  3ZL6 A;  3LEE A;  5DHI A;  3CKE A;  3OYR A;  3IBA A;  2ZCS A;  3RMG A;  3ACY A;  5I1U A;  4RXC A;  2OGD A;  3WCE A;  1V4H A;  4P0W A;  3LGZ B;  2I19 A;  3CC9 A;  2Z4W A;  3Q2Z A;  3LMD A;  3P8R A;  3OAC B;  3N6K F;  5B0L A;  4XQT F;  1DGP A;  3LJI A;  5H9D A;  3G4F A;  5IKH A;  4H5E F;  3M00 A;  3KRA B;  3V66 A;  5CG5 A;  3ADZ A;  3EGT A;  2ZCR A;  4KVY A;  3ACW A;  2J5C A;  2Z4Z A;  2OPM A;  3ACX A;  4JXN A;  1YYQ A;  2E8X A;  4L2X F;  3TFN A;  3S9V A;  1WL0 A;  3LLW A;  3P5R A;  2E8V A;  4OKZ A;  3APZ A;  3WCC A;  1V4J A;  4E1E A;  5AFX A;  3SDU A;  1YYS A;  3LGK A;  1N1Z A;  3AQ0 A;  3SDQ A;  1HXG A;  2F8C F;  4GP1 A;  5DJV F;  4LA6 A;  5ILY A;  4RXE A;  1YYU A;  3PYB A;  4LZC A;  5AYP A;  4KQ5 A;  3BNX A;  5EAU A;  5DZ2 A;  3RYE A;  4PVX F;  2AZJ A;  5IKA A;  3M02 A;  3LG5 A;  2Q9Z A;  3DYG A;  4LTV A;  3WEF A;  3WCH A;  5ER8 A;  2E90 A;  2Z7H A;  3VJC A;  2F9K F;  3M9U A;  3VJA A;  2F92 F;  3N1W F;  3Q1O A;  1YYT A;  2QIS A;  5IM1 A;  3KRO B;  3ICN A;  2O1O A;  4DZW A;  3NRI A;  1YHK A;  2PS8 A;  4KVW A;  3VJD A;  4LXW A;  3PDE A;  3IPI A;  3G4D A;  4NKF A;  5IVG A;  2H8O A;  5HN7 A;  5DGM F;  2J1P A;  4GP2 A;  2ZY1 A;  3WCM A;  3QQV A;  3WJO A;  4NUA A;  4LZ0 A;  2F94 F;  1VG7 A;  3OAB B;  3PH7 A;  3WJN A;  4PVY F;  4F6X A;  2VF6 A;  3TFV A;  4GA3 A;  5ILK A;  4JZB A;  1RQJ A;  2Z4X A;  4XQS F;  4OMG A;  3NPK A;  2F8Z F;  3WCF A;  4ZQ8 A;  5DIQ F;  3N0G A;  4LIX A;  4DHD A;  4WK5 A;  2Z50 A;  3LSN A;  2FOR A;  2E93 A;  3SDV A;  2Q58 A;  5KSX F;  3KRP B;  2Q9Y A;  2F89 F;  2OA6 A;  5ILD A;  4LPH F;  3WCJ A;  3WC9 A;  2E8T A;  3WCG A;  5DHK A;  4DI5 A;  3WEH A;  3NF2 A;  3TS7 A;  1WY0 A;  2OPN A;  5AHU B;  3KRF B;  3KRC A;  1JFA A;  4LZ3 A;  3SDT A;  1N23 A;  5A0J A;  3V1X A;  4MC3 A;  3VJ8 A;  4LLT A;  5IMN A;  4KFA A;  2Z4V A;  4KKM A;  2ONH A;  4KQU A;  5ERN A;  5E8L A;  3P8L A;  3Q2Q A;  3N5H F;  4F62 A;  5E8H A;  4GAX A;  1WL3 A;  3ASX A;  4MC8 A;  2AET A;  1N22 A;  3ID0 A;  3P41 A;  3AQC B;  5ERO A;  1KIY A;  2E94 A;  4H5D F;  3RYW A;  3WCD A;  2ZCQ A;  4RYP A;  1VG6 A;  1VG2 A;  4N9U A;  4JYX A;  3VJB A;  4QPF A;  3QKC A;  3EZ3 A;  3LK5 A;  3WSA A;  3OAC A;  5ILH A;  3KRF A;  3WCL A;  3N1V F;  4RXA A;  5B02 A;  2Z4Y A;  3LZ9 A;  1YV5 A;  2F7M F;  4N1Z F;  2E91 A;  5HN8 A;  1HXC A;  5AEL A;  1N1B A;  3KRA A;  2ONG A;  4LUU A;  4RNQ A;  3AQB B;  3TFP A;  3EFQ A;  3SAE A;  5ILZ A;  1PS1 A;  2P1C A;  1YHL A;  3DYF A;  3ICK A;  2FTZ A;  3NPR A;  1UBY A;  2Z52 A;  2Z78 A;  1V4I A;  4XQR F;  4KUX A;  1WMW A;  5DJP F;  5B0K A;  4K10 A;  5DW7 A;  1VG3 A;  5IL8 A;  1V4E A;  3N3L F;  5CG6 A;  4NFJ F;  3M0G A;  4H5C F;  1WL2 A;  2E8U A;  5ERM A;  2PS6 A;  5A0K A;  2Z7I A;  2PS5 A;  4LPG F;  1HM7 A;  1YQ7 A;  5ILI A;  3WE9 A;  3N49 F;  5B0J A;  1EZF A;  5A0I A;  1VG4 A;  3P5P A;  4QXS F;  2AEL A;  3RBM A;  3N45 F;  3KBK A;  3KRO A;  4EA2 A;  4RXD A;  4P0V A;  2RAH A;  2ZCO A;  4KVI A;  3WCA A;  5B0I A;  2AZL A;  1UBV A;  3ZMB A;  2AZK A;  2EWG A;  5IK6 A;  5EAT A;  1FPS A;  3N46 F;  3ZOU A;  5IK0 A;  4FJQ A;  3ICZ A;  3OAB A;  3WJK A;  4NFK F;  5JV0 F;  5IL3 A;  4HD1 A;  4KVD A;  1YHM A;  2PS7 A;  5C05 A;  1N24 A;  3ICM A;  3PKO A;  3WEG A;  3CP6 A;  5IK9 A;  4Q23 A;  4LFE A;  3LVS A;  3ZCD A;  4P0X A;  1JFG A;  4LFG A;  1KIZ A;  3WSB A;  4NKE A;  4LOB A;  3N3D A;  3Q30 A;  1YJ4 A;  4KQS A;  3AE0 A;  5JV1 F;  3KRP A;  3W7F A;  4NFI F;  5HNA A;  4E9U A;  1RTR A;  3SDR A;  3KB9 A;  2ZEU A;  4UMJ A;  4NG6 A;  3DYH A;  4KK2 A;  3VJE A;  3ZMC A;  1N20 A;  5JV2 F;  1WL1 A;  4JVJ F;  5B03 A;  5E8K A;  1UBX A;  2E92 A;  1DI1 A;  5HN9 A;  4OMH A;  4LTZ A;  3LDW A;  2ZEV A;  5IN8 A;  3WEI A;  5B0M A;  3S4J A;  4EA0 A;  4LFV F;  3MZV A;  4KWD A;  2E95 A;  1V4K A;  3N5J F;  3M01 A;  3WEK A;  5IMP A;  2AEK A;  3WEJ A;  5DGS F;  5EAS A;  4MC0 A;  5ILJ A; 
#chains in the Genus database with same CATH topology
 4KPD A;  1HX9 A;  4DXJ A;  4OKM A;  4KPJ A;  3BNY A;  4JXY A;  2E4O A;  4DWG A;  4DWB A;  1HM4 A;  4F6V A;  3LOM A;  1RQI A;  1UBW A;  1YYR A;  5DJR F;  5B00 A;  1HXA A;  4FP4 A;  2DH4 A;  3KRC B;  3MAV A;  3VJ9 A;  5JUZ F;  4LA5 A;  5DGN F;  3WCB A;  2Q80 A;  2J1O A;  2E8W A;  5IMI A;  4DEM F;  3TC1 A;  4OGU A;  5JA0 F;  3WCI A;  4JZX A;  2PS4 A;  3B7L A;  4LLS A;  3N0F A;  1ZW5 A;  3UCA A;  4E9Z A;  3PYA A;  1WKZ A;  3V1V A;  1N21 A;  4EA1 A;  5B01 A;  3ZL6 A;  3LEE A;  5DHI A;  3CKE A;  3OYR A;  3IBA A;  2ZCS A;  3RMG A;  3ACY A;  5I1U A;  4RXC A;  2OGD A;  3WCE A;  1V4H A;  4P0W A;  3LGZ B;  2I19 A;  3CC9 A;  2Z4W A;  3Q2Z A;  3LMD A;  3P8R A;  3OAC B;  3N6K F;  5B0L A;  4XQT F;  1DGP A;  3LJI A;  5H9D A;  3G4F A;  5IKH A;  4H5E F;  3M00 A;  3KRA B;  3V66 A;  5CG5 A;  3ADZ A;  3EGT A;  2ZCR A;  4KVY A;  3ACW A;  2J5C A;  2Z4Z A;  2OPM A;  3ACX A;  4JXN A;  1YYQ A;  2E8X A;  4L2X F;  3TFN A;  3S9V A;  1WL0 A;  3LLW A;  3P5R A;  2E8V A;  4OKZ A;  3APZ A;  3WCC A;  1V4J A;  4E1E A;  5AFX A;  3SDU A;  1YYS A;  3LGK A;  1N1Z A;  3AQ0 A;  3SDQ A;  1HXG A;  2F8C F;  4GP1 A;  5DJV F;  4LA6 A;  5ILY A;  4RXE A;  1YYU A;  3PYB A;  4LZC A;  5AYP A;  4KQ5 A;  3BNX A;  5EAU A;  5DZ2 A;  3RYE A;  4PVX F;  2AZJ A;  5IKA A;  3M02 A;  3LG5 A;  2Q9Z A;  3DYG A;  4LTV A;  3WEF A;  3WCH A;  5ER8 A;  2E90 A;  2Z7H A;  3VJC A;  2F9K F;  3M9U A;  3VJA A;  2F92 F;  3N1W F;  3Q1O A;  1YYT A;  2QIS A;  5IM1 A;  3KRO B;  3ICN A;  2O1O A;  4DZW A;  3NRI A;  1YHK A;  2PS8 A;  4KVW A;  3VJD A;  4LXW A;  3PDE A;  3IPI A;  3G4D A;  4NKF A;  5IVG A;  2H8O A;  5HN7 A;  5DGM F;  2J1P A;  4GP2 A;  2ZY1 A;  3WCM A;  3QQV A;  3WJO A;  4NUA A;  4LZ0 A;  2F94 F;  1VG7 A;  3OAB B;  3PH7 A;  3WJN A;  4PVY F;  4F6X A;  2VF6 A;  3TFV A;  4GA3 A;  5ILK A;  4JZB A;  1RQJ A;  2Z4X A;  4XQS F;  4OMG A;  3NPK A;  2F8Z F;  3WCF A;  4ZQ8 A;  5DIQ F;  3N0G A;  4LIX A;  4DHD A;  4WK5 A;  2Z50 A;  3LSN A;  2FOR A;  2E93 A;  3SDV A;  2Q58 A;  5KSX F;  3KRP B;  2Q9Y A;  2F89 F;  2OA6 A;  5ILD A;  4LPH F;  3WCJ A;  3WC9 A;  2E8T A;  3WCG A;  5DHK A;  4DI5 A;  3WEH A;  3NF2 A;  3TS7 A;  1WY0 A;  2OPN A;  5AHU B;  3KRF B;  3KRC A;  1JFA A;  4LZ3 A;  3SDT A;  1N23 A;  5A0J A;  3V1X A;  4MC3 A;  3VJ8 A;  4LLT A;  5IMN A;  4KFA A;  2Z4V A;  4KKM A;  2ONH A;  4KQU A;  5ERN A;  5E8L A;  3P8L A;  3Q2Q A;  3N5H F;  4F62 A;  5E8H A;  4GAX A;  1WL3 A;  3ASX A;  4MC8 A;  2AET A;  1N22 A;  3ID0 A;  3P41 A;  3AQC B;  5ERO A;  1KIY A;  2E94 A;  4H5D F;  3RYW A;  3WCD A;  2ZCQ A;  4RYP A;  1VG6 A;  1VG2 A;  4N9U A;  4JYX A;  3VJB A;  4QPF A;  3QKC A;  3EZ3 A;  3LK5 A;  3WSA A;  3OAC A;  5ILH A;  3KRF A;  3WCL A;  3N1V F;  4RXA A;  5B02 A;  2Z4Y A;  3LZ9 A;  1YV5 A;  2F7M F;  4N1Z F;  2E91 A;  5HN8 A;  1HXC A;  5AEL A;  1N1B A;  3KRA A;  2ONG A;  4LUU A;  4RNQ A;  3AQB B;  3TFP A;  3EFQ A;  3SAE A;  5ILZ A;  1PS1 A;  2P1C A;  1YHL A;  3DYF A;  3ICK A;  2FTZ A;  3NPR A;  1UBY A;  2Z52 A;  2Z78 A;  1V4I A;  4XQR F;  4KUX A;  1WMW A;  5DJP F;  5B0K A;  4K10 A;  5DW7 A;  1VG3 A;  5IL8 A;  1V4E A;  3N3L F;  5CG6 A;  4NFJ F;  3M0G A;  4H5C F;  1WL2 A;  2E8U A;  5ERM A;  2PS6 A;  5A0K A;  2Z7I A;  2PS5 A;  4LPG F;  1HM7 A;  1YQ7 A;  5ILI A;  3WE9 A;  3N49 F;  5B0J A;  1EZF A;  5A0I A;  1VG4 A;  3P5P A;  4QXS F;  2AEL A;  3RBM A;  3N45 F;  3KBK A;  3KRO A;  4EA2 A;  4RXD A;  4P0V A;  2RAH A;  2ZCO A;  4KVI A;  3WCA A;  5B0I A;  2AZL A;  1UBV A;  3ZMB A;  2AZK A;  2EWG A;  5IK6 A;  5EAT A;  1FPS A;  3N46 F;  3ZOU A;  5IK0 A;  4FJQ A;  3ICZ A;  3OAB A;  3WJK A;  4NFK F;  5JV0 F;  5IL3 A;  4HD1 A;  4KVD A;  1YHM A;  2PS7 A;  5C05 A;  1N24 A;  3ICM A;  3PKO A;  3WEG A;  3CP6 A;  5IK9 A;  4Q23 A;  4LFE A;  3LVS A;  3ZCD A;  4P0X A;  1JFG A;  4LFG A;  1KIZ A;  3WSB A;  4NKE A;  4LOB A;  3N3D A;  3Q30 A;  1YJ4 A;  4KQS A;  3AE0 A;  5JV1 F;  3KRP A;  3W7F A;  4NFI F;  5HNA A;  4E9U A;  1RTR A;  3SDR A;  3KB9 A;  2ZEU A;  4UMJ A;  4NG6 A;  3DYH A;  4KK2 A;  3VJE A;  3ZMC A;  1N20 A;  5JV2 F;  1WL1 A;  4JVJ F;  5B03 A;  5E8K A;  1UBX A;  2E92 A;  1DI1 A;  5HN9 A;  4OMH A;  4LTZ A;  3LDW A;  2ZEV A;  5IN8 A;  3WEI A;  5B0M A;  3S4J A;  4EA0 A;  4LFV F;  3MZV A;  4KWD A;  2E95 A;  1V4K A;  3N5J F;  3M01 A;  3WEK A;  5IMP A;  2AEK A;  3WEJ A;  5DGS F;  5EAS A;  4MC0 A;  5ILJ A; 
#chains in the Genus database with same CATH homology
 4KPD A;  1HX9 A;  4DXJ A;  4OKM A;  4KPJ A;  3BNY A;  4JXY A;  2E4O A;  4DWG A;  4DWB A;  1HM4 A;  4F6V A;  3LOM A;  1RQI A;  1UBW A;  1YYR A;  5DJR F;  5B00 A;  1HXA A;  4FP4 A;  2DH4 A;  3KRC B;  3MAV A;  3VJ9 A;  5JUZ F;  4LA5 A;  5DGN F;  3WCB A;  2Q80 A;  2J1O A;  2E8W A;  5IMI A;  4DEM F;  3TC1 A;  4OGU A;  5JA0 F;  3WCI A;  4JZX A;  2PS4 A;  3B7L A;  4LLS A;  3N0F A;  1ZW5 A;  3UCA A;  4E9Z A;  3PYA A;  1WKZ A;  3V1V A;  1N21 A;  4EA1 A;  5B01 A;  3ZL6 A;  3LEE A;  5DHI A;  3CKE A;  3OYR A;  3IBA A;  2ZCS A;  3RMG A;  3ACY A;  5I1U A;  4RXC A;  2OGD A;  3WCE A;  1V4H A;  4P0W A;  3LGZ B;  2I19 A;  3CC9 A;  2Z4W A;  3Q2Z A;  3LMD A;  3P8R A;  3OAC B;  3N6K F;  5B0L A;  4XQT F;  1DGP A;  3LJI A;  5H9D A;  3G4F A;  5IKH A;  4H5E F;  3M00 A;  3KRA B;  3V66 A;  5CG5 A;  3ADZ A;  3EGT A;  2ZCR A;  4KVY A;  3ACW A;  2J5C A;  2Z4Z A;  2OPM A;  3ACX A;  4JXN A;  1YYQ A;  2E8X A;  4L2X F;  3TFN A;  3S9V A;  1WL0 A;  3LLW A;  3P5R A;  2E8V A;  4OKZ A;  3APZ A;  3WCC A;  1V4J A;  4E1E A;  5AFX A;  3SDU A;  1YYS A;  3LGK A;  1N1Z A;  3AQ0 A;  3SDQ A;  1HXG A;  2F8C F;  4GP1 A;  5DJV F;  4LA6 A;  5ILY A;  4RXE A;  1YYU A;  3PYB A;  4LZC A;  5AYP A;  4KQ5 A;  3BNX A;  5EAU A;  5DZ2 A;  3RYE A;  4PVX F;  2AZJ A;  5IKA A;  3M02 A;  3LG5 A;  2Q9Z A;  3DYG A;  4LTV A;  3WEF A;  3WCH A;  5ER8 A;  2E90 A;  2Z7H A;  3VJC A;  2F9K F;  3M9U A;  3VJA A;  2F92 F;  3N1W F;  3Q1O A;  1YYT A;  2QIS A;  5IM1 A;  3KRO B;  3ICN A;  2O1O A;  4DZW A;  3NRI A;  1YHK A;  2PS8 A;  4KVW A;  3VJD A;  4LXW A;  3PDE A;  3IPI A;  3G4D A;  4NKF A;  5IVG A;  2H8O A;  5HN7 A;  5DGM F;  2J1P A;  4GP2 A;  2ZY1 A;  3WCM A;  3QQV A;  3WJO A;  4NUA A;  4LZ0 A;  2F94 F;  1VG7 A;  3OAB B;  3PH7 A;  3WJN A;  4PVY F;  4F6X A;  2VF6 A;  3TFV A;  4GA3 A;  5ILK A;  4JZB A;  1RQJ A;  2Z4X A;  4XQS F;  4OMG A;  3NPK A;  2F8Z F;  3WCF A;  4ZQ8 A;  5DIQ F;  3N0G A;  4LIX A;  4DHD A;  4WK5 A;  2Z50 A;  3LSN A;  2FOR A;  2E93 A;  3SDV A;  2Q58 A;  5KSX F;  3KRP B;  2Q9Y A;  2F89 F;  2OA6 A;  5ILD A;  4LPH F;  3WCJ A;  3WC9 A;  2E8T A;  3WCG A;  5DHK A;  4DI5 A;  3WEH A;  3NF2 A;  3TS7 A;  1WY0 A;  2OPN A;  5AHU B;  3KRF B;  3KRC A;  1JFA A;  4LZ3 A;  3SDT A;  1N23 A;  5A0J A;  3V1X A;  4MC3 A;  3VJ8 A;  4LLT A;  5IMN A;  4KFA A;  2Z4V A;  4KKM A;  2ONH A;  4KQU A;  5ERN A;  5E8L A;  3P8L A;  3Q2Q A;  3N5H F;  4F62 A;  5E8H A;  4GAX A;  1WL3 A;  3ASX A;  4MC8 A;  2AET A;  1N22 A;  3ID0 A;  3P41 A;  3AQC B;  5ERO A;  1KIY A;  2E94 A;  4H5D F;  3RYW A;  3WCD A;  2ZCQ A;  4RYP A;  1VG6 A;  1VG2 A;  4N9U A;  4JYX A;  3VJB A;  4QPF A;  3QKC A;  3EZ3 A;  3LK5 A;  3WSA A;  3OAC A;  5ILH A;  3KRF A;  3WCL A;  3N1V F;  4RXA A;  5B02 A;  2Z4Y A;  3LZ9 A;  1YV5 A;  2F7M F;  4N1Z F;  2E91 A;  5HN8 A;  1HXC A;  5AEL A;  1N1B A;  3KRA A;  2ONG A;  4LUU A;  4RNQ A;  3AQB B;  3TFP A;  3EFQ A;  3SAE A;  5ILZ A;  1PS1 A;  2P1C A;  1YHL A;  3DYF A;  3ICK A;  2FTZ A;  3NPR A;  1UBY A;  2Z52 A;  2Z78 A;  1V4I A;  4XQR F;  4KUX A;  1WMW A;  5DJP F;  5B0K A;  4K10 A;  5DW7 A;  1VG3 A;  5IL8 A;  1V4E A;  3N3L F;  5CG6 A;  4NFJ F;  3M0G A;  4H5C F;  1WL2 A;  2E8U A;  5ERM A;  2PS6 A;  5A0K A;  2Z7I A;  2PS5 A;  4LPG F;  1HM7 A;  1YQ7 A;  5ILI A;  3WE9 A;  3N49 F;  5B0J A;  1EZF A;  5A0I A;  1VG4 A;  3P5P A;  4QXS F;  2AEL A;  3RBM A;  3N45 F;  3KBK A;  3KRO A;  4EA2 A;  4RXD A;  4P0V A;  2RAH A;  2ZCO A;  4KVI A;  3WCA A;  5B0I A;  2AZL A;  1UBV A;  3ZMB A;  2AZK A;  2EWG A;  5IK6 A;  5EAT A;  1FPS A;  3N46 F;  3ZOU A;  5IK0 A;  4FJQ A;  3ICZ A;  3OAB A;  3WJK A;  4NFK F;  5JV0 F;  5IL3 A;  4HD1 A;  4KVD A;  1YHM A;  2PS7 A;  5C05 A;  1N24 A;  3ICM A;  3PKO A;  3WEG A;  3CP6 A;  5IK9 A;  4Q23 A;  4LFE A;  3LVS A;  3ZCD A;  4P0X A;  1JFG A;  4LFG A;  1KIZ A;  3WSB A;  4NKE A;  4LOB A;  3N3D A;  3Q30 A;  1YJ4 A;  4KQS A;  3AE0 A;  5JV1 F;  3KRP A;  3W7F A;  4NFI F;  5HNA A;  4E9U A;  1RTR A;  3SDR A;  3KB9 A;  2ZEU A;  4UMJ A;  4NG6 A;  3DYH A;  4KK2 A;  3VJE A;  3ZMC A;  1N20 A;  5JV2 F;  1WL1 A;  4JVJ F;  5B03 A;  5E8K A;  1UBX A;  2E92 A;  1DI1 A;  5HN9 A;  4OMH A;  4LTZ A;  3LDW A;  2ZEV A;  5IN8 A;  3WEI A;  5B0M A;  3S4J A;  4EA0 A;  4LFV F;  3MZV A;  4KWD A;  2E95 A;  1V4K A;  3N5J F;  3M01 A;  3WEK A;  5IMP A;  2AEK A;  3WEJ A;  5DGS F;  5EAS A;  4MC0 A;  5ILJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...