4E9ZA

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with quinuclidine bph-651 in the s1 site
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 118
structure length 284
sequence length 284
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4e9zA00
1WL0A 3WCHA 4RYPA 3VJAA 2AZJA 4H5DF 2ZCRA 3M0GA 4LFEA 3DYFA 3ACXA 1N20A 2E92A 3ICNA 1YYSA 2AETA 4MC0A 2Q80A 3Q2ZA 4GA3A 5HN7A 5H9DA 3N3LF 3G4DA 1DGPA 2AZKA 1RTRA 3BNYA 4NFIF 3LVSA 5ILJA 2E93A 1HM7A 5B0KA 3N3DA 4EA1A 4H5EF 4LZCA 4KQ5A 3M01A 5EASA 4LA6A 2Q9YA 3ACYA 3M00A 3CP6A 5B0MA 3V1VA 3VJ8A 4P0VA 4NKEA 1FPSA 1WMWA 5IK9A 3M02A 4QXSF 4P0XA 3WC9A 2F92F 3WE9A 1YYTA 5DW7A 4E1EA 3SDTA 3WSAA 4LZ0A 3QQVA 3QKCA 5ER8A 3Q1OA 5IVGA 5ILKA 5JUZF 5IL3A 3ACWA 5ILZA 4DWGA 3RYEA 5DHIA 3WSBA 5IMIA 3TFPA 1N21A 2OGDA 4LFVF 5EATA 3ZMCA 3N1VF 4MC3A 4KPDA 2F89F 3N49F 3KROB 4LOBA 5EAUA 3N46F 3WCJA 3WJNA 5JV1F 2E8UA 3N0FA 1YHMA 3OYRA 3OACA 4KVIA 4F6XA 3UCAA 2PS8A 5DHKA 1ZW5A 4UMJA 3WCFA 4OGUA 3WJOA 3WCDA 3SDUA 3IBAA 3S4JA 4LLSA 1VG4A 3P41A 4KPJA 3WEJA 3ZL6A 3LMDA 5JV0F 2F8ZF 4LPGF 5CG6A 2ZEVA 2ZEUA 2Z7IA 2H8OA 1YYRA 2OPMA 5IKAA 5IM1A 2Z78A 3NRIA 2VF6A 3WJKA 5B03A 2PS5A 5JV2F 5IK6A 4KQSA 3SAEA 2Q58A 3S9VA 3MZVA 4OMHA 3EGTA 2DH4A 5B0JA 3TC1A 2Z52A 4L2XF 3VJDA 2J5CA 4JZXA 3KRPB 3TS7A 3NPKA 1N23A 2F8CF 5ERNA 3W7FA 3AQBB 3Q2QA 2P1CA 3KB9A 4KQUA 3KBKA 2F94F 2E90A 3BNXA 4JXNA 3ZMBA 2FTZA 3P8LA 1UBXA 4KFAA 3AQ0A 4FJQA 4FP4A 5IK0A 5IMPA 3TFVA 4DI5A 2J1OA 1N1ZA 5IMNA 4EA0A 5A0IA 3ID0A 3ASXA 3PKOA 4NFKF 5DGMF 1YYUA 4GAXA 4LTZA 1PS1A 1RQIA 4RXCA 5JA0F 1YV5A 5CG5A 5B00A 2ZCSA 4JYXA 4NFJF 1WL3A 1V4EA 3OABB 4NKFA 3EFQA 1RQJA 5DGSF 3EZ3A 4JZBA 1HXGA 4DWBA 4QPFA 1YYQA 5E8KA 3LZ9A 3SDQA 3V66A 3P8RA 4N9UA 2Z7HA 3CKEA 3KRFB 4JXYA 3RMGA 3VJBA 3WCCA 1YJ4A 3KROA 4K10A 4WK5A 3WEHA 4E9ZA 1UBYA 4H5CF 5E8HA 3WEGA 2PS7A 4LZ3A 2Z4WA 4LIXA 4KUXA 1WL2A 3WCAA 4DZWA 4XQTF 2RAHA 5HN8A 1WKZA 1KIZA 2OA6A 3LOMA 3WCEA 3WEFA 2Z50A 1JFAA 4LXWA 1HM4A 5ILYA 3KRCA 3LG5A 2Z4VA 4Q23A 5IL8A 3KRAB 3PYBA 2I19A 5C05A 3NF2A 3APZA 5A0JA 3KRCB 3SDRA 4PVXF 5DZ2A 2QISA 3N0GA 3PDEA 2E8VA 3ICKA 3MAVA 4OKMA 2ONGA 5DJPF 4GP2A 3ZCDA 5AHUB 1V4IA 2E8XA 2AEKA 2J1PA 2EWGA 2E91A 4KKMA 1YHLA 4HD1A 5ILDA 3KRPA 2Z4ZA 4XQSF 5DJRF 4RXEA 1YHKA 3WCLA 2ZCOA 4F62A 3N45F 3LJIA 3CC9A 2E94A 5B0LA 1EZFA 3ZOUA 1N22A 3B7LA 1VG2A 4RXDA 3LK5A 3RBMA 3N5HF 4LPHF 3P5PA 4GP1A 4KWDA 3WEKA 1UBVA 3PH7A 1JFGA 4PVYF 5KSXF 3G4FA 4N1ZF 3V1XA 3AQCB 2Z4XA 4P0WA 5EROA 4ZQ8A 2AZLA 1V4KA 2E8WA 1V4JA 1N1BA 3SDVA 2E4OA 5B02A 3WCIA 3ICZA 3N5JF 2O1OA 3OABA 1VG7A 3WCGA 5AFXA 3LEEA 3N6KF 2ZY1A 3VJCA 3P5RA 2ONHA 5ILIA 5IN8A 4NG6A 3DYGA 5A0KA 5DIQF 4KK2A 1WL1A 3KRFA 1HX9A 3WCBA 3ADZA 3LDWA 3AE0A 5AYPA 4F6VA 3PYAA 4KVDA 5HN9A 4XQRF 1DI1A 3ICMA 1V4HA 3DYHA 4MC8A 3LLWA 5E8LA 1YQ7A 3LSNA 4LA5A 3WEIA 1HXCA 2E95A 1KIYA 4KVYA 4DXJA 2OPNA 2ZCQA 3KRAA 5DGNF 2F9KF 1VG6A 4LTVA 3VJ9A 4NUAA 2Q9ZA 3TFNA 4EA2A 4OKZA 3LGKA 3WCMA 4JVJF 5B01A 5B0IA 4DEMF 4KVWA 3M9UA 2PS6A 2E8TA 3NPRA 5DJVF 3IPIA 2FORA 4LFGA 2PS4A 5HNAA 1HXAA 2Z4YA 5ERMA 5ILHA 1N24A 2F7MF 3LGZB 4E9UA 3OACB 5IKHA 4RXAA 1VG3A 5AELA 3RYWA 3VJEA 1UBWA 2AELA 3N1WF 3Q30A 4LUUA 4RNQA 4OMGA 1WY0A 4LLTA 4DHDA 5I1UA
chains in the Genus database with same CATH superfamily
1WL0A 3WCHA 4RYPA 3VJAA 2AZJA 4H5DF 2ZCRA 3M0GA 4LFEA 3DYFA 3ACXA 1N20A 2E92A 3ICNA 1YYSA 2AETA 4MC0A 2Q80A 3Q2ZA 4GA3A 5HN7A 5H9DA 3N3LF 3G4DA 1DGPA 2AZKA 1RTRA 3BNYA 4NFIF 3LVSA 5ILJA 2E93A 1HM7A 5B0KA 3N3DA 4EA1A 4H5EF 4LZCA 4KQ5A 3M01A 5EASA 4LA6A 2Q9YA 3ACYA 3M00A 3CP6A 5B0MA 3V1VA 3VJ8A 4P0VA 4NKEA 1FPSA 1WMWA 5IK9A 3M02A 4QXSF 4P0XA 3WC9A 2F92F 3WE9A 1YYTA 5DW7A 4E1EA 3SDTA 3WSAA 4LZ0A 3QQVA 3QKCA 5ER8A 3Q1OA 5IVGA 5ILKA 5JUZF 5IL3A 3ACWA 5ILZA 4DWGA 3RYEA 5DHIA 3WSBA 5IMIA 3TFPA 1N21A 2OGDA 4LFVF 5EATA 3ZMCA 3N1VF 4MC3A 4KPDA 2F89F 3N49F 3KROB 4LOBA 5EAUA 3N46F 3WCJA 3WJNA 5JV1F 2E8UA 3N0FA 1YHMA 3OYRA 3OACA 4KVIA 4F6XA 3UCAA 2PS8A 5DHKA 1ZW5A 4UMJA 3WCFA 4OGUA 3WJOA 3WCDA 3SDUA 3IBAA 3S4JA 4LLSA 1VG4A 3P41A 4KPJA 3WEJA 3ZL6A 3LMDA 5JV0F 2F8ZF 4LPGF 5CG6A 2ZEVA 2ZEUA 2Z7IA 2H8OA 1YYRA 2OPMA 5IKAA 5IM1A 2Z78A 3NRIA 2VF6A 3WJKA 5B03A 2PS5A 5JV2F 5IK6A 4KQSA 3SAEA 2Q58A 3S9VA 3MZVA 4OMHA 3EGTA 2DH4A 5B0JA 3TC1A 2Z52A 4L2XF 3VJDA 2J5CA 4JZXA 3KRPB 3TS7A 3NPKA 1N23A 2F8CF 5ERNA 3W7FA 3AQBB 3Q2QA 2P1CA 3KB9A 4KQUA 3KBKA 2F94F 2E90A 3BNXA 4JXNA 3ZMBA 2FTZA 3P8LA 1UBXA 4KFAA 3AQ0A 4FJQA 4FP4A 5IK0A 5IMPA 3TFVA 4DI5A 2J1OA 1N1ZA 5IMNA 4EA0A 5A0IA 3ID0A 3ASXA 3PKOA 4NFKF 5DGMF 1YYUA 4GAXA 4LTZA 1PS1A 1RQIA 4RXCA 5JA0F 1YV5A 5CG5A 5B00A 2ZCSA 4JYXA 4NFJF 1WL3A 1V4EA 3OABB 4NKFA 3EFQA 1RQJA 5DGSF 3EZ3A 4JZBA 1HXGA 4DWBA 4QPFA 1YYQA 5E8KA 3LZ9A 3SDQA 3V66A 3P8RA 4N9UA 2Z7HA 3CKEA 3KRFB 4JXYA 3RMGA 3VJBA 3WCCA 1YJ4A 3KROA 4K10A 4WK5A 3WEHA 4E9ZA 1UBYA 4H5CF 5E8HA 3WEGA 2PS7A 4LZ3A 2Z4WA 4LIXA 4KUXA 1WL2A 3WCAA 4DZWA 4XQTF 2RAHA 5HN8A 1WKZA 1KIZA 2OA6A 3LOMA 3WCEA 3WEFA 2Z50A 1JFAA 4LXWA 1HM4A 5ILYA 3KRCA 3LG5A 2Z4VA 4Q23A 5IL8A 3KRAB 3PYBA 2I19A 5C05A 3NF2A 3APZA 5A0JA 3KRCB 3SDRA 4PVXF 5DZ2A 2QISA 3N0GA 3PDEA 2E8VA 3ICKA 3MAVA 4OKMA 2ONGA 5DJPF 4GP2A 3ZCDA 5AHUB 1V4IA 2E8XA 2AEKA 2J1PA 2EWGA 2E91A 4KKMA 1YHLA 4HD1A 5ILDA 3KRPA 2Z4ZA 4XQSF 5DJRF 4RXEA 1YHKA 3WCLA 2ZCOA 4F62A 3N45F 3LJIA 3CC9A 2E94A 5B0LA 1EZFA 3ZOUA 1N22A 3B7LA 1VG2A 4RXDA 3LK5A 3RBMA 3N5HF 4LPHF 3P5PA 4GP1A 4KWDA 3WEKA 1UBVA 3PH7A 1JFGA 4PVYF 5KSXF 3G4FA 4N1ZF 3V1XA 3AQCB 2Z4XA 4P0WA 5EROA 4ZQ8A 2AZLA 1V4KA 2E8WA 1V4JA 1N1BA 3SDVA 2E4OA 5B02A 3WCIA 3ICZA 3N5JF 2O1OA 3OABA 1VG7A 3WCGA 5AFXA 3LEEA 3N6KF 2ZY1A 3VJCA 3P5RA 2ONHA 5ILIA 5IN8A 4NG6A 3DYGA 5A0KA 5DIQF 4KK2A 1WL1A 3KRFA 1HX9A 3WCBA 3ADZA 3LDWA 3AE0A 5AYPA 4F6VA 3PYAA 4KVDA 5HN9A 4XQRF 1DI1A 3ICMA 1V4HA 3DYHA 4MC8A 3LLWA 5E8LA 1YQ7A 3LSNA 4LA5A 3WEIA 1HXCA 2E95A 1KIYA 4KVYA 4DXJA 2OPNA 2ZCQA 3KRAA 5DGNF 2F9KF 1VG6A 4LTVA 3VJ9A 4NUAA 2Q9ZA 3TFNA 4EA2A 4OKZA 3LGKA 3WCMA 4JVJF 5B01A 5B0IA 4DEMF 4KVWA 3M9UA 2PS6A 2E8TA 3NPRA 5DJVF 3IPIA 2FORA 4LFGA 2PS4A 5HNAA 1HXAA 2Z4YA 5ERMA 5ILHA 1N24A 2F7MF 3LGZB 4E9UA 3OACB 5IKHA 4RXAA 1VG3A 5AELA 3RYWA 3VJEA 1UBWA 2AELA 3N1WF 3Q30A 4LUUA 4RNQA 4OMGA 1WY0A 4LLTA 4DHDA 5I1UA
chains in the Genus database with same CATH topology
1WL0A 3WCHA 4RYPA 3VJAA 2AZJA 4H5DF 2ZCRA 3M0GA 4LFEA 3DYFA 3ACXA 1N20A 2E92A 3ICNA 1YYSA 2AETA 4MC0A 2Q80A 3Q2ZA 4GA3A 5HN7A 5H9DA 3N3LF 3G4DA 1DGPA 2AZKA 1RTRA 3BNYA 4NFIF 3LVSA 5ILJA 2E93A 1HM7A 5B0KA 3N3DA 4EA1A 4H5EF 4LZCA 4KQ5A 3M01A 5EASA 4LA6A 2Q9YA 3ACYA 3M00A 3CP6A 5B0MA 3V1VA 3VJ8A 4P0VA 4NKEA 1FPSA 1WMWA 5IK9A 3M02A 4QXSF 4P0XA 3WC9A 2F92F 3WE9A 1YYTA 5DW7A 4E1EA 3SDTA 3WSAA 4LZ0A 3QQVA 3QKCA 5ER8A 3Q1OA 5IVGA 5ILKA 5JUZF 5IL3A 3ACWA 5ILZA 4DWGA 3RYEA 5DHIA 3WSBA 5IMIA 3TFPA 1N21A 2OGDA 4LFVF 5EATA 3ZMCA 3N1VF 4MC3A 4KPDA 2F89F 3N49F 3KROB 4LOBA 5EAUA 3N46F 3WCJA 3WJNA 5JV1F 2E8UA 3N0FA 1YHMA 3OYRA 3OACA 4KVIA 4F6XA 3UCAA 2PS8A 5DHKA 1ZW5A 4UMJA 3WCFA 4OGUA 3WJOA 3WCDA 3SDUA 3IBAA 3S4JA 4LLSA 1VG4A 3P41A 4KPJA 3WEJA 3ZL6A 3LMDA 5JV0F 2F8ZF 4LPGF 5CG6A 2ZEVA 2ZEUA 2Z7IA 2H8OA 1YYRA 2OPMA 5IKAA 5IM1A 2Z78A 3NRIA 2VF6A 3WJKA 5B03A 2PS5A 5JV2F 5IK6A 4KQSA 3SAEA 2Q58A 3S9VA 3MZVA 4OMHA 3EGTA 2DH4A 5B0JA 3TC1A 2Z52A 4L2XF 3VJDA 2J5CA 4JZXA 3KRPB 3TS7A 3NPKA 1N23A 2F8CF 5ERNA 3W7FA 3AQBB 3Q2QA 2P1CA 3KB9A 4KQUA 3KBKA 2F94F 2E90A 3BNXA 4JXNA 3ZMBA 2FTZA 3P8LA 1UBXA 4KFAA 3AQ0A 4FJQA 4FP4A 5IK0A 5IMPA 3TFVA 4DI5A 2J1OA 1N1ZA 5IMNA 4EA0A 5A0IA 3ID0A 3ASXA 3PKOA 4NFKF 5DGMF 1YYUA 4GAXA 4LTZA 1PS1A 1RQIA 4RXCA 5JA0F 1YV5A 5CG5A 5B00A 2ZCSA 4JYXA 4NFJF 1WL3A 1V4EA 3OABB 4NKFA 3EFQA 1RQJA 5DGSF 3EZ3A 4JZBA 1HXGA 4DWBA 4QPFA 1YYQA 5E8KA 3LZ9A 3SDQA 3V66A 3P8RA 4N9UA 2Z7HA 3CKEA 3KRFB 4JXYA 3RMGA 3VJBA 3WCCA 1YJ4A 3KROA 4K10A 4WK5A 3WEHA 4E9ZA 1UBYA 4H5CF 5E8HA 3WEGA 2PS7A 4LZ3A 2Z4WA 4LIXA 4KUXA 1WL2A 3WCAA 4DZWA 4XQTF 2RAHA 5HN8A 1WKZA 1KIZA 2OA6A 3LOMA 3WCEA 3WEFA 2Z50A 1JFAA 4LXWA 1HM4A 5ILYA 3KRCA 3LG5A 2Z4VA 4Q23A 5IL8A 3KRAB 3PYBA 2I19A 5C05A 3NF2A 3APZA 5A0JA 3KRCB 3SDRA 4PVXF 5DZ2A 2QISA 3N0GA 3PDEA 2E8VA 3ICKA 3MAVA 4OKMA 2ONGA 5DJPF 4GP2A 3ZCDA 5AHUB 1V4IA 2E8XA 2AEKA 2J1PA 2EWGA 2E91A 4KKMA 1YHLA 4HD1A 5ILDA 3KRPA 2Z4ZA 4XQSF 5DJRF 4RXEA 1YHKA 3WCLA 2ZCOA 4F62A 3N45F 3LJIA 3CC9A 2E94A 5B0LA 1EZFA 3ZOUA 1N22A 3B7LA 1VG2A 4RXDA 3LK5A 3RBMA 3N5HF 4LPHF 3P5PA 4GP1A 4KWDA 3WEKA 1UBVA 3PH7A 1JFGA 4PVYF 5KSXF 3G4FA 4N1ZF 3V1XA 3AQCB 2Z4XA 4P0WA 5EROA 4ZQ8A 2AZLA 1V4KA 2E8WA 1V4JA 1N1BA 3SDVA 2E4OA 5B02A 3WCIA 3ICZA 3N5JF 2O1OA 3OABA 1VG7A 3WCGA 5AFXA 3LEEA 3N6KF 2ZY1A 3VJCA 3P5RA 2ONHA 5ILIA 5IN8A 4NG6A 3DYGA 5A0KA 5DIQF 4KK2A 1WL1A 3KRFA 1HX9A 3WCBA 3ADZA 3LDWA 3AE0A 5AYPA 4F6VA 3PYAA 4KVDA 5HN9A 4XQRF 1DI1A 3ICMA 1V4HA 3DYHA 4MC8A 3LLWA 5E8LA 1YQ7A 3LSNA 4LA5A 3WEIA 1HXCA 2E95A 1KIYA 4KVYA 4DXJA 2OPNA 2ZCQA 3KRAA 5DGNF 2F9KF 1VG6A 4LTVA 3VJ9A 4NUAA 2Q9ZA 3TFNA 4EA2A 4OKZA 3LGKA 3WCMA 4JVJF 5B01A 5B0IA 4DEMF 4KVWA 3M9UA 2PS6A 2E8TA 3NPRA 5DJVF 3IPIA 2FORA 4LFGA 2PS4A 5HNAA 1HXAA 2Z4YA 5ERMA 5ILHA 1N24A 2F7MF 3LGZB 4E9UA 3OACB 5IKHA 4RXAA 1VG3A 5AELA 3RYWA 3VJEA 1UBWA 2AELA 3N1WF 3Q30A 4LUUA 4RNQA 4OMGA 1WY0A 4LLTA 4DHDA 5I1UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WL0 A;  3WCH A;  4RYP A;  3VJA A;  2AZJ A;  4H5D F;  2ZCR A;  3M0G A;  4LFE A;  3DYF A;  3ACX A;  1N20 A;  2E92 A;  3ICN A;  1YYS A;  2AET A;  4MC0 A;  2Q80 A;  3Q2Z A;  4GA3 A;  5HN7 A;  5H9D A;  3N3L F;  3G4D A;  1DGP A;  2AZK A;  1RTR A;  3BNY A;  4NFI F;  3LVS A;  5ILJ A;  2E93 A;  1HM7 A;  5B0K A;  3N3D A;  4EA1 A;  4H5E F;  4LZC A;  4KQ5 A;  3M01 A;  5EAS A;  4LA6 A;  2Q9Y A;  3ACY A;  3M00 A;  3CP6 A;  5B0M A;  3V1V A;  3VJ8 A;  4P0V A;  4NKE A;  1FPS A;  1WMW A;  5IK9 A;  3M02 A;  4QXS F;  4P0X A;  3WC9 A;  2F92 F;  3WE9 A;  1YYT A;  5DW7 A;  4E1E A;  3SDT A;  3WSA A;  4LZ0 A;  3QQV A;  3QKC A;  5ER8 A;  3Q1O A;  5IVG A;  5ILK A;  5JUZ F;  5IL3 A;  3ACW A;  5ILZ A;  4DWG A;  3RYE A;  5DHI A;  3WSB A;  5IMI A;  3TFP A;  1N21 A;  2OGD A;  4LFV F;  5EAT A;  3ZMC A;  3N1V F;  4MC3 A;  4KPD A;  2F89 F;  3N49 F;  3KRO B;  4LOB A;  5EAU A;  3N46 F;  3WCJ A;  3WJN A;  5JV1 F;  2E8U A;  3N0F A;  1YHM A;  3OYR A;  3OAC A;  4KVI A;  4F6X A;  3UCA A;  2PS8 A;  5DHK A;  1ZW5 A;  4UMJ A;  3WCF A;  4OGU A;  3WJO A;  3WCD A;  3SDU A;  3IBA A;  3S4J A;  4LLS A;  1VG4 A;  3P41 A;  4KPJ A;  3WEJ A;  3ZL6 A;  3LMD A;  5JV0 F;  2F8Z F;  4LPG F;  5CG6 A;  2ZEV A;  2ZEU A;  2Z7I A;  2H8O A;  1YYR A;  2OPM A;  5IKA A;  5IM1 A;  2Z78 A;  3NRI A;  2VF6 A;  3WJK A;  5B03 A;  2PS5 A;  5JV2 F;  5IK6 A;  4KQS A;  3SAE A;  2Q58 A;  3S9V A;  3MZV A;  4OMH A;  3EGT A;  2DH4 A;  5B0J A;  3TC1 A;  2Z52 A;  4L2X F;  3VJD A;  2J5C A;  4JZX A;  3KRP B;  3TS7 A;  3NPK A;  1N23 A;  2F8C F;  5ERN A;  3W7F A;  3AQB B;  3Q2Q A;  2P1C A;  3KB9 A;  4KQU A;  3KBK A;  2F94 F;  2E90 A;  3BNX A;  4JXN A;  3ZMB A;  2FTZ A;  3P8L A;  1UBX A;  4KFA A;  3AQ0 A;  4FJQ A;  4FP4 A;  5IK0 A;  5IMP A;  3TFV A;  4DI5 A;  2J1O A;  1N1Z A;  5IMN A;  4EA0 A;  5A0I A;  3ID0 A;  3ASX A;  3PKO A;  4NFK F;  5DGM F;  1YYU A;  4GAX A;  4LTZ A;  1PS1 A;  1RQI A;  4RXC A;  5JA0 F;  1YV5 A;  5CG5 A;  5B00 A;  2ZCS A;  4JYX A;  4NFJ F;  1WL3 A;  1V4E A;  3OAB B;  4NKF A;  3EFQ A;  1RQJ A;  5DGS F;  3EZ3 A;  4JZB A;  1HXG A;  4DWB A;  4QPF A;  1YYQ A;  5E8K A;  3LZ9 A;  3SDQ A;  3V66 A;  3P8R A;  4N9U A;  2Z7H A;  3CKE A;  3KRF B;  4JXY A;  3RMG A;  3VJB A;  3WCC A;  1YJ4 A;  3KRO A;  4K10 A;  4WK5 A;  3WEH A;  4E9Z A;  1UBY A;  4H5C F;  5E8H A;  3WEG A;  2PS7 A;  4LZ3 A;  2Z4W A;  4LIX A;  4KUX A;  1WL2 A;  3WCA A;  4DZW A;  4XQT F;  2RAH A;  5HN8 A;  1WKZ A;  1KIZ A;  2OA6 A;  3LOM A;  3WCE A;  3WEF A;  2Z50 A;  1JFA A;  4LXW A;  1HM4 A;  5ILY A;  3KRC A;  3LG5 A;  2Z4V A;  4Q23 A;  5IL8 A;  3KRA B;  3PYB A;  2I19 A;  5C05 A;  3NF2 A;  3APZ A;  5A0J A;  3KRC B;  3SDR A;  4PVX F;  5DZ2 A;  2QIS A;  3N0G A;  3PDE A;  2E8V A;  3ICK A;  3MAV A;  4OKM A;  2ONG A;  5DJP F;  4GP2 A;  3ZCD A;  5AHU B;  1V4I A;  2E8X A;  2AEK A;  2J1P A;  2EWG A;  2E91 A;  4KKM A;  1YHL A;  4HD1 A;  5ILD A;  3KRP A;  2Z4Z A;  4XQS F;  5DJR F;  4RXE A;  1YHK A;  3WCL A;  2ZCO A;  4F62 A;  3N45 F;  3LJI A;  3CC9 A;  2E94 A;  5B0L A;  1EZF A;  3ZOU A;  1N22 A;  3B7L A;  1VG2 A;  4RXD A;  3LK5 A;  3RBM A;  3N5H F;  4LPH F;  3P5P A;  4GP1 A;  4KWD A;  3WEK A;  1UBV A;  3PH7 A;  1JFG A;  4PVY F;  5KSX F;  3G4F A;  4N1Z F;  3V1X A;  3AQC B;  2Z4X A;  4P0W A;  5ERO A;  4ZQ8 A;  2AZL A;  1V4K A;  2E8W A;  1V4J A;  1N1B A;  3SDV A;  2E4O A;  5B02 A;  3WCI A;  3ICZ A;  3N5J F;  2O1O A;  3OAB A;  1VG7 A;  3WCG A;  5AFX A;  3LEE A;  3N6K F;  2ZY1 A;  3VJC A;  3P5R A;  2ONH A;  5ILI A;  5IN8 A;  4NG6 A;  3DYG A;  5A0K A;  5DIQ F;  4KK2 A;  1WL1 A;  3KRF A;  1HX9 A;  3WCB A;  3ADZ A;  3LDW A;  3AE0 A;  5AYP A;  4F6V A;  3PYA A;  4KVD A;  5HN9 A;  4XQR F;  1DI1 A;  3ICM A;  1V4H A;  3DYH A;  4MC8 A;  3LLW A;  5E8L A;  1YQ7 A;  3LSN A;  4LA5 A;  3WEI A;  1HXC A;  2E95 A;  1KIY A;  4KVY A;  4DXJ A;  2OPN A;  2ZCQ A;  3KRA A;  5DGN F;  2F9K F;  1VG6 A;  4LTV A;  3VJ9 A;  4NUA A;  2Q9Z A;  3TFN A;  4EA2 A;  4OKZ A;  3LGK A;  3WCM A;  4JVJ F;  5B01 A;  5B0I A;  4DEM F;  4KVW A;  3M9U A;  2PS6 A;  2E8T A;  3NPR A;  5DJV F;  3IPI A;  2FOR A;  4LFG A;  2PS4 A;  5HNA A;  1HXA A;  2Z4Y A;  5ERM A;  5ILH A;  1N24 A;  2F7M F;  3LGZ B;  4E9U A;  3OAC B;  5IKH A;  4RXA A;  1VG3 A;  5AEL A;  3RYW A;  3VJE A;  1UBW A;  2AEL A;  3N1W F;  3Q30 A;  4LUU A;  4RNQ A;  4OMG A;  1WY0 A;  4LLT A;  4DHD A;  5I1U A; 
#chains in the Genus database with same CATH topology
 1WL0 A;  3WCH A;  4RYP A;  3VJA A;  2AZJ A;  4H5D F;  2ZCR A;  3M0G A;  4LFE A;  3DYF A;  3ACX A;  1N20 A;  2E92 A;  3ICN A;  1YYS A;  2AET A;  4MC0 A;  2Q80 A;  3Q2Z A;  4GA3 A;  5HN7 A;  5H9D A;  3N3L F;  3G4D A;  1DGP A;  2AZK A;  1RTR A;  3BNY A;  4NFI F;  3LVS A;  5ILJ A;  2E93 A;  1HM7 A;  5B0K A;  3N3D A;  4EA1 A;  4H5E F;  4LZC A;  4KQ5 A;  3M01 A;  5EAS A;  4LA6 A;  2Q9Y A;  3ACY A;  3M00 A;  3CP6 A;  5B0M A;  3V1V A;  3VJ8 A;  4P0V A;  4NKE A;  1FPS A;  1WMW A;  5IK9 A;  3M02 A;  4QXS F;  4P0X A;  3WC9 A;  2F92 F;  3WE9 A;  1YYT A;  5DW7 A;  4E1E A;  3SDT A;  3WSA A;  4LZ0 A;  3QQV A;  3QKC A;  5ER8 A;  3Q1O A;  5IVG A;  5ILK A;  5JUZ F;  5IL3 A;  3ACW A;  5ILZ A;  4DWG A;  3RYE A;  5DHI A;  3WSB A;  5IMI A;  3TFP A;  1N21 A;  2OGD A;  4LFV F;  5EAT A;  3ZMC A;  3N1V F;  4MC3 A;  4KPD A;  2F89 F;  3N49 F;  3KRO B;  4LOB A;  5EAU A;  3N46 F;  3WCJ A;  3WJN A;  5JV1 F;  2E8U A;  3N0F A;  1YHM A;  3OYR A;  3OAC A;  4KVI A;  4F6X A;  3UCA A;  2PS8 A;  5DHK A;  1ZW5 A;  4UMJ A;  3WCF A;  4OGU A;  3WJO A;  3WCD A;  3SDU A;  3IBA A;  3S4J A;  4LLS A;  1VG4 A;  3P41 A;  4KPJ A;  3WEJ A;  3ZL6 A;  3LMD A;  5JV0 F;  2F8Z F;  4LPG F;  5CG6 A;  2ZEV A;  2ZEU A;  2Z7I A;  2H8O A;  1YYR A;  2OPM A;  5IKA A;  5IM1 A;  2Z78 A;  3NRI A;  2VF6 A;  3WJK A;  5B03 A;  2PS5 A;  5JV2 F;  5IK6 A;  4KQS A;  3SAE A;  2Q58 A;  3S9V A;  3MZV A;  4OMH A;  3EGT A;  2DH4 A;  5B0J A;  3TC1 A;  2Z52 A;  4L2X F;  3VJD A;  2J5C A;  4JZX A;  3KRP B;  3TS7 A;  3NPK A;  1N23 A;  2F8C F;  5ERN A;  3W7F A;  3AQB B;  3Q2Q A;  2P1C A;  3KB9 A;  4KQU A;  3KBK A;  2F94 F;  2E90 A;  3BNX A;  4JXN A;  3ZMB A;  2FTZ A;  3P8L A;  1UBX A;  4KFA A;  3AQ0 A;  4FJQ A;  4FP4 A;  5IK0 A;  5IMP A;  3TFV A;  4DI5 A;  2J1O A;  1N1Z A;  5IMN A;  4EA0 A;  5A0I A;  3ID0 A;  3ASX A;  3PKO A;  4NFK F;  5DGM F;  1YYU A;  4GAX A;  4LTZ A;  1PS1 A;  1RQI A;  4RXC A;  5JA0 F;  1YV5 A;  5CG5 A;  5B00 A;  2ZCS A;  4JYX A;  4NFJ F;  1WL3 A;  1V4E A;  3OAB B;  4NKF A;  3EFQ A;  1RQJ A;  5DGS F;  3EZ3 A;  4JZB A;  1HXG A;  4DWB A;  4QPF A;  1YYQ A;  5E8K A;  3LZ9 A;  3SDQ A;  3V66 A;  3P8R A;  4N9U A;  2Z7H A;  3CKE A;  3KRF B;  4JXY A;  3RMG A;  3VJB A;  3WCC A;  1YJ4 A;  3KRO A;  4K10 A;  4WK5 A;  3WEH A;  4E9Z A;  1UBY A;  4H5C F;  5E8H A;  3WEG A;  2PS7 A;  4LZ3 A;  2Z4W A;  4LIX A;  4KUX A;  1WL2 A;  3WCA A;  4DZW A;  4XQT F;  2RAH A;  5HN8 A;  1WKZ A;  1KIZ A;  2OA6 A;  3LOM A;  3WCE A;  3WEF A;  2Z50 A;  1JFA A;  4LXW A;  1HM4 A;  5ILY A;  3KRC A;  3LG5 A;  2Z4V A;  4Q23 A;  5IL8 A;  3KRA B;  3PYB A;  2I19 A;  5C05 A;  3NF2 A;  3APZ A;  5A0J A;  3KRC B;  3SDR A;  4PVX F;  5DZ2 A;  2QIS A;  3N0G A;  3PDE A;  2E8V A;  3ICK A;  3MAV A;  4OKM A;  2ONG A;  5DJP F;  4GP2 A;  3ZCD A;  5AHU B;  1V4I A;  2E8X A;  2AEK A;  2J1P A;  2EWG A;  2E91 A;  4KKM A;  1YHL A;  4HD1 A;  5ILD A;  3KRP A;  2Z4Z A;  4XQS F;  5DJR F;  4RXE A;  1YHK A;  3WCL A;  2ZCO A;  4F62 A;  3N45 F;  3LJI A;  3CC9 A;  2E94 A;  5B0L A;  1EZF A;  3ZOU A;  1N22 A;  3B7L A;  1VG2 A;  4RXD A;  3LK5 A;  3RBM A;  3N5H F;  4LPH F;  3P5P A;  4GP1 A;  4KWD A;  3WEK A;  1UBV A;  3PH7 A;  1JFG A;  4PVY F;  5KSX F;  3G4F A;  4N1Z F;  3V1X A;  3AQC B;  2Z4X A;  4P0W A;  5ERO A;  4ZQ8 A;  2AZL A;  1V4K A;  2E8W A;  1V4J A;  1N1B A;  3SDV A;  2E4O A;  5B02 A;  3WCI A;  3ICZ A;  3N5J F;  2O1O A;  3OAB A;  1VG7 A;  3WCG A;  5AFX A;  3LEE A;  3N6K F;  2ZY1 A;  3VJC A;  3P5R A;  2ONH A;  5ILI A;  5IN8 A;  4NG6 A;  3DYG A;  5A0K A;  5DIQ F;  4KK2 A;  1WL1 A;  3KRF A;  1HX9 A;  3WCB A;  3ADZ A;  3LDW A;  3AE0 A;  5AYP A;  4F6V A;  3PYA A;  4KVD A;  5HN9 A;  4XQR F;  1DI1 A;  3ICM A;  1V4H A;  3DYH A;  4MC8 A;  3LLW A;  5E8L A;  1YQ7 A;  3LSN A;  4LA5 A;  3WEI A;  1HXC A;  2E95 A;  1KIY A;  4KVY A;  4DXJ A;  2OPN A;  2ZCQ A;  3KRA A;  5DGN F;  2F9K F;  1VG6 A;  4LTV A;  3VJ9 A;  4NUA A;  2Q9Z A;  3TFN A;  4EA2 A;  4OKZ A;  3LGK A;  3WCM A;  4JVJ F;  5B01 A;  5B0I A;  4DEM F;  4KVW A;  3M9U A;  2PS6 A;  2E8T A;  3NPR A;  5DJV F;  3IPI A;  2FOR A;  4LFG A;  2PS4 A;  5HNA A;  1HXA A;  2Z4Y A;  5ERM A;  5ILH A;  1N24 A;  2F7M F;  3LGZ B;  4E9U A;  3OAC B;  5IKH A;  4RXA A;  1VG3 A;  5AEL A;  3RYW A;  3VJE A;  1UBW A;  2AEL A;  3N1W F;  3Q30 A;  4LUU A;  4RNQ A;  4OMG A;  1WY0 A;  4LLT A;  4DHD A;  5I1U A; 
#chains in the Genus database with same CATH homology
 1WL0 A;  3WCH A;  4RYP A;  3VJA A;  2AZJ A;  4H5D F;  2ZCR A;  3M0G A;  4LFE A;  3DYF A;  3ACX A;  1N20 A;  2E92 A;  3ICN A;  1YYS A;  2AET A;  4MC0 A;  2Q80 A;  3Q2Z A;  4GA3 A;  5HN7 A;  5H9D A;  3N3L F;  3G4D A;  1DGP A;  2AZK A;  1RTR A;  3BNY A;  4NFI F;  3LVS A;  5ILJ A;  2E93 A;  1HM7 A;  5B0K A;  3N3D A;  4EA1 A;  4H5E F;  4LZC A;  4KQ5 A;  3M01 A;  5EAS A;  4LA6 A;  2Q9Y A;  3ACY A;  3M00 A;  3CP6 A;  5B0M A;  3V1V A;  3VJ8 A;  4P0V A;  4NKE A;  1FPS A;  1WMW A;  5IK9 A;  3M02 A;  4QXS F;  4P0X A;  3WC9 A;  2F92 F;  3WE9 A;  1YYT A;  5DW7 A;  4E1E A;  3SDT A;  3WSA A;  4LZ0 A;  3QQV A;  3QKC A;  5ER8 A;  3Q1O A;  5IVG A;  5ILK A;  5JUZ F;  5IL3 A;  3ACW A;  5ILZ A;  4DWG A;  3RYE A;  5DHI A;  3WSB A;  5IMI A;  3TFP A;  1N21 A;  2OGD A;  4LFV F;  5EAT A;  3ZMC A;  3N1V F;  4MC3 A;  4KPD A;  2F89 F;  3N49 F;  3KRO B;  4LOB A;  5EAU A;  3N46 F;  3WCJ A;  3WJN A;  5JV1 F;  2E8U A;  3N0F A;  1YHM A;  3OYR A;  3OAC A;  4KVI A;  4F6X A;  3UCA A;  2PS8 A;  5DHK A;  1ZW5 A;  4UMJ A;  3WCF A;  4OGU A;  3WJO A;  3WCD A;  3SDU A;  3IBA A;  3S4J A;  4LLS A;  1VG4 A;  3P41 A;  4KPJ A;  3WEJ A;  3ZL6 A;  3LMD A;  5JV0 F;  2F8Z F;  4LPG F;  5CG6 A;  2ZEV A;  2ZEU A;  2Z7I A;  2H8O A;  1YYR A;  2OPM A;  5IKA A;  5IM1 A;  2Z78 A;  3NRI A;  2VF6 A;  3WJK A;  5B03 A;  2PS5 A;  5JV2 F;  5IK6 A;  4KQS A;  3SAE A;  2Q58 A;  3S9V A;  3MZV A;  4OMH A;  3EGT A;  2DH4 A;  5B0J A;  3TC1 A;  2Z52 A;  4L2X F;  3VJD A;  2J5C A;  4JZX A;  3KRP B;  3TS7 A;  3NPK A;  1N23 A;  2F8C F;  5ERN A;  3W7F A;  3AQB B;  3Q2Q A;  2P1C A;  3KB9 A;  4KQU A;  3KBK A;  2F94 F;  2E90 A;  3BNX A;  4JXN A;  3ZMB A;  2FTZ A;  3P8L A;  1UBX A;  4KFA A;  3AQ0 A;  4FJQ A;  4FP4 A;  5IK0 A;  5IMP A;  3TFV A;  4DI5 A;  2J1O A;  1N1Z A;  5IMN A;  4EA0 A;  5A0I A;  3ID0 A;  3ASX A;  3PKO A;  4NFK F;  5DGM F;  1YYU A;  4GAX A;  4LTZ A;  1PS1 A;  1RQI A;  4RXC A;  5JA0 F;  1YV5 A;  5CG5 A;  5B00 A;  2ZCS A;  4JYX A;  4NFJ F;  1WL3 A;  1V4E A;  3OAB B;  4NKF A;  3EFQ A;  1RQJ A;  5DGS F;  3EZ3 A;  4JZB A;  1HXG A;  4DWB A;  4QPF A;  1YYQ A;  5E8K A;  3LZ9 A;  3SDQ A;  3V66 A;  3P8R A;  4N9U A;  2Z7H A;  3CKE A;  3KRF B;  4JXY A;  3RMG A;  3VJB A;  3WCC A;  1YJ4 A;  3KRO A;  4K10 A;  4WK5 A;  3WEH A;  4E9Z A;  1UBY A;  4H5C F;  5E8H A;  3WEG A;  2PS7 A;  4LZ3 A;  2Z4W A;  4LIX A;  4KUX A;  1WL2 A;  3WCA A;  4DZW A;  4XQT F;  2RAH A;  5HN8 A;  1WKZ A;  1KIZ A;  2OA6 A;  3LOM A;  3WCE A;  3WEF A;  2Z50 A;  1JFA A;  4LXW A;  1HM4 A;  5ILY A;  3KRC A;  3LG5 A;  2Z4V A;  4Q23 A;  5IL8 A;  3KRA B;  3PYB A;  2I19 A;  5C05 A;  3NF2 A;  3APZ A;  5A0J A;  3KRC B;  3SDR A;  4PVX F;  5DZ2 A;  2QIS A;  3N0G A;  3PDE A;  2E8V A;  3ICK A;  3MAV A;  4OKM A;  2ONG A;  5DJP F;  4GP2 A;  3ZCD A;  5AHU B;  1V4I A;  2E8X A;  2AEK A;  2J1P A;  2EWG A;  2E91 A;  4KKM A;  1YHL A;  4HD1 A;  5ILD A;  3KRP A;  2Z4Z A;  4XQS F;  5DJR F;  4RXE A;  1YHK A;  3WCL A;  2ZCO A;  4F62 A;  3N45 F;  3LJI A;  3CC9 A;  2E94 A;  5B0L A;  1EZF A;  3ZOU A;  1N22 A;  3B7L A;  1VG2 A;  4RXD A;  3LK5 A;  3RBM A;  3N5H F;  4LPH F;  3P5P A;  4GP1 A;  4KWD A;  3WEK A;  1UBV A;  3PH7 A;  1JFG A;  4PVY F;  5KSX F;  3G4F A;  4N1Z F;  3V1X A;  3AQC B;  2Z4X A;  4P0W A;  5ERO A;  4ZQ8 A;  2AZL A;  1V4K A;  2E8W A;  1V4J A;  1N1B A;  3SDV A;  2E4O A;  5B02 A;  3WCI A;  3ICZ A;  3N5J F;  2O1O A;  3OAB A;  1VG7 A;  3WCG A;  5AFX A;  3LEE A;  3N6K F;  2ZY1 A;  3VJC A;  3P5R A;  2ONH A;  5ILI A;  5IN8 A;  4NG6 A;  3DYG A;  5A0K A;  5DIQ F;  4KK2 A;  1WL1 A;  3KRF A;  1HX9 A;  3WCB A;  3ADZ A;  3LDW A;  3AE0 A;  5AYP A;  4F6V A;  3PYA A;  4KVD A;  5HN9 A;  4XQR F;  1DI1 A;  3ICM A;  1V4H A;  3DYH A;  4MC8 A;  3LLW A;  5E8L A;  1YQ7 A;  3LSN A;  4LA5 A;  3WEI A;  1HXC A;  2E95 A;  1KIY A;  4KVY A;  4DXJ A;  2OPN A;  2ZCQ A;  3KRA A;  5DGN F;  2F9K F;  1VG6 A;  4LTV A;  3VJ9 A;  4NUA A;  2Q9Z A;  3TFN A;  4EA2 A;  4OKZ A;  3LGK A;  3WCM A;  4JVJ F;  5B01 A;  5B0I A;  4DEM F;  4KVW A;  3M9U A;  2PS6 A;  2E8T A;  3NPR A;  5DJV F;  3IPI A;  2FOR A;  4LFG A;  2PS4 A;  5HNA A;  1HXA A;  2Z4Y A;  5ERM A;  5ILH A;  1N24 A;  2F7M F;  3LGZ B;  4E9U A;  3OAC B;  5IKH A;  4RXA A;  1VG3 A;  5AEL A;  3RYW A;  3VJE A;  1UBW A;  2AEL A;  3N1W F;  3Q30 A;  4LUU A;  4RNQ A;  4OMG A;  1WY0 A;  4LLT A;  4DHD A;  5I1U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...