4EA0A

Crystal structure of dehydrosqualene synthase (crtm) from s. aureus complexed with diphosphate and quinuclidine bph-651
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
284
structure length
284
Chain Sequence
MTMMDMNFKYCHKIMKKHSKSFSYAFDLLPEDQRKAVWAIYAVCRKIDDSIDVYGDIQFLNQIKEDIQSIEKYPYEYHHFQSDRRIMMALQHVAQHKNIAFQSFYNLIDTVYKDQHFTMFETDAELFGYCYGVAGTVGEVLTPILSDHETHQTYDVARRLGESLQLINILRDVGEDFENERIYFSKQRLKQYEVDIAEVYQNGVNNHYIDLWEYYAAIAEKDFRDVMDQIKVFSIEAQPIIELAARIYIEILDEVRQANYTLHERVFVEKRKKAKLFHEINSKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Dehydrosqualene synthase
publication title Head-to-Head Prenyl Tranferases: Anti-Infective Drug Targets.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 120
structure length 284
sequence length 284
chains with identical sequence B
ec nomenclature ec 2.5.1.96: 4,4'-diapophytoene synthase.
pdb deposition date 2012-03-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00494 SQS_PSY Squalene/phytoene synthase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.600.10 Mainly Alpha Orthogonal Bundle Farnesyl Diphosphate Synthase Farnesyl Diphosphate Synthase 4ea0A00
2Z4ZA 3WCMA 3M02A 5IKAA 3ADZA 3ZL6A 3P41A 3SAEA 3N46F 2Q58A 3LEEA 2PS7A 4L2XF 3WEHA 1YYUA 2F94F 3NPKA 5HN8A 5B0IA 4LOBA 5AHUB 4NUAA 4GA3A 4E9UA 3WCGA 1WL3A 2F89F 5IK9A 4N9UA 1YV5A 5IK6A 4P0VA 4LPGF 3LSNA 4NFIF 5B01A 2E93A 4MC0A 1RQJA 1WL1A 1WL2A 3V1VA 3WEGA 5E8LA 3WCIA 5H9DA 3EGTA 4HD1A 1N22A 4WK5A 4F6XA 5ILIA 4LLTA 5EROA 3LGKA 4JVJF 1UBYA 3BNXA 4N1ZF 2AZJA 3G4FA 3ICZA 5ERNA 2FORA 3SDRA 3WCFA 4KK2A 5AELA 3RYWA 1VG3A 1N1BA 4LZCA 4K10A 5ILDA 2AETA 2ONGA 4KPJA 1V4HA 3AQCB 1EZFA 5I1UA 4H5DF 1RQIA 3WCCA 4KPDA 1FPSA 3TC1A 3SDUA 4Q23A 3W7FA 4RXCA 5JUZF 3RBMA 3S4JA 3NRIA 2Z52A 3BNYA 4LA6A 3VJAA 2ZCSA 4RXDA 2ZCRA 1V4JA 4EA0A 3LZ9A 5E8KA 3M0GA 3N3DA 5JA0F 5IN8A 4GAXA 3MAVA 3P5RA 2Z4WA 1YHMA 3KRAB 4LFEA 2E91A 4KQ5A 2E95A 3WEFA 3MZVA 5DHKA 2E94A 3NPRA 3LVSA 2E8XA 5CG6A 1VG6A 1HXGA 3B7LA 2ZEUA 2DH4A 2P1CA 3WSBA 3N1VF 1HXAA 3ASXA 2PS6A 2Q9ZA 3SDVA 5DHIA 4DI5A 3PH7A 1KIZA 4LTVA 3G4DA 4H5CF 4LZ3A 3OACA 2E8UA 1HXCA 2FTZA 5DIQF 2OPMA 3N49F 1JFAA 2OPNA 3VJEA 1N20A 1HM4A 1V4EA 2Z7IA 5EATA 3S9VA 4MC3A 5DGNF 4NFKF 1VG4A 5IKHA 3Q2ZA 3ID0A 3WJKA 3UCAA 3KRFA 2Z78A 1N24A 3M00A 5DJRF 4JYXA 2Z4YA 5B0MA 4GP2A 4ZQ8A 1HX9A 2RAHA 5B03A 5KSXF 2AZKA 4KVDA 5ERMA 3LLWA 3PKOA 4RXEA 3WCAA 3ZCDA 1WKZA 4OKMA 3DYFA 3TFNA 4XQSF 5HN9A 5IL3A 4GP1A 3OYRA 3KB9A 2Q80A 4E9ZA 5DGSF 4OGUA 3P8LA 5ILKA 3AQBB 2OA6A 4KQUA 4DXJA 3AQ0A 4LPHF 2F92F 1JFGA 2OGDA 1WMWA 3WCJA 3N0FA 5A0KA 1V4IA 2J1OA 4KFAA 5A0JA 4LTZA 3KROA 3OABA 1VG7A 2ZY1A 1PS1A 5ILHA 3SDQA 5IK0A 3N5JF 3PYAA 1ZW5A 2Q9YA 5JV1F 3P8RA 5ILYA 3APZA 3PDEA 2Z4VA 2J5CA 3ICNA 3KROB 5IMIA 3OABB 2Z7HA 5ILZA 1WL0A 3N1WF 4F6VA 4NG6A 5DZ2A 3WJOA 4JZBA 3LJIA 5HN7A 3ZMCA 1KIYA 2PS8A 4LFGA 4F62A 2E92A 5DJVF 3N0GA 5JV0F 2E8WA 3N45F 5IL8A 5CG5A 5B00A 3ACWA 3TS7A 2ONHA 3VJ8A 3WCEA 4QPFA 2I19A 3WCHA 2ZEVA 3WEIA 4LA5A 4MC8A 4KQSA 3WEKA 4KWDA 3CP6A 3QKCA 3ZOUA 4P0XA 3RYEA 3Q2QA 3LDWA 4UMJA 3CC9A 4JZXA 3KRCA 2PS4A 3V66A 5AYPA 4NKFA 2F8CF 3LK5A 2F8ZF 2AELA 2E8TA 3OACB 4QXSF 4DHDA 4OMHA 3ZMBA 5B02A 3Q1OA 2E90A 5DW7A 3LG5A 3N6KF 3WSAA 1N21A 3KRCB 1DI1A 5A0IA 1YHLA 4FP4A 1VG2A 5C05A 5E8HA 1RTRA 2AZLA 3N3LF 3KRFB 3EFQA 3WC9A 4DZWA 4FJQA 4JXNA 4JXYA 4KVYA 5DGMF 3RMGA 4E1EA 1YJ4A 5IMNA 4RNQA 3VJBA 1N1ZA 3NF2A 3KRPA 1V4KA 4XQRF 3WCDA 4KVIA 4RYPA 5EAUA 1UBWA 3N5HF 4LLSA 3PYBA 4LZ0A 2O1OA 4RXAA 2PS5A 4OKZA 3WE9A 1YYQA 2H8OA 4PVXF 4H5EF 3KRPB 1WY0A 3AE0A 5IVGA 3SDTA 1YYSA 3WCLA 3EZ3A 4DEMF 3ICKA 3LGZB 1YYTA 3DYGA 3IBAA 2ZCQA 4KVWA 3Q30A 3ACXA 1UBVA 2Z4XA 3IPIA 4NKEA 4DWBA 2J1PA 3V1XA 1YYRA 3KRAA 4PVYF 3TFPA 3VJDA 4LIXA 1N23A 2EWGA 5AFXA 5IMPA 4OMGA 5DJPF 5IM1A 3TFVA 5B0KA 2E4OA 3ICMA 3WJNA 1YQ7A 1DGPA 5ER8A 3LMDA 2Z50A 3M9UA 2F7MF 4KUXA 4LFVF 5HNAA 2QISA 3QQVA 3M01A 4LXWA 4DWGA 2E8VA 3ACYA 3WEJA 4LUUA 4KKMA 3LOMA 1UBXA 2F9KF 4NFJF 1HM7A 5B0JA 5B0LA 1YHKA 5EASA 4P0WA 4EA2A 3VJ9A 5JV2F 2AEKA 2ZCOA 2VF6A 3P5PA 5ILJA 3VJCA 3KBKA 4XQTF 3DYHA 3WCBA 4EA1A 3CKEA
chains in the Genus database with same CATH superfamily
2Z4ZA 3WCMA 3M02A 5IKAA 3ADZA 3ZL6A 3P41A 3SAEA 3N46F 2Q58A 3LEEA 2PS7A 4L2XF 3WEHA 1YYUA 2F94F 3NPKA 5HN8A 5B0IA 4LOBA 5AHUB 4NUAA 4GA3A 4E9UA 3WCGA 1WL3A 2F89F 5IK9A 4N9UA 1YV5A 5IK6A 4P0VA 4LPGF 3LSNA 4NFIF 5B01A 2E93A 4MC0A 1RQJA 1WL1A 1WL2A 3V1VA 3WEGA 5E8LA 3WCIA 5H9DA 3EGTA 4HD1A 1N22A 4WK5A 4F6XA 5ILIA 4LLTA 5EROA 3LGKA 4JVJF 1UBYA 3BNXA 4N1ZF 2AZJA 3G4FA 3ICZA 5ERNA 2FORA 3SDRA 3WCFA 4KK2A 5AELA 3RYWA 1VG3A 1N1BA 4LZCA 4K10A 5ILDA 2AETA 2ONGA 4KPJA 1V4HA 3AQCB 1EZFA 5I1UA 4H5DF 1RQIA 3WCCA 4KPDA 1FPSA 3TC1A 3SDUA 4Q23A 3W7FA 4RXCA 5JUZF 3RBMA 3S4JA 3NRIA 2Z52A 3BNYA 4LA6A 3VJAA 2ZCSA 4RXDA 2ZCRA 1V4JA 4EA0A 3LZ9A 5E8KA 3M0GA 3N3DA 5JA0F 5IN8A 4GAXA 3MAVA 3P5RA 2Z4WA 1YHMA 3KRAB 4LFEA 2E91A 4KQ5A 2E95A 3WEFA 3MZVA 5DHKA 2E94A 3NPRA 3LVSA 2E8XA 5CG6A 1VG6A 1HXGA 3B7LA 2ZEUA 2DH4A 2P1CA 3WSBA 3N1VF 1HXAA 3ASXA 2PS6A 2Q9ZA 3SDVA 5DHIA 4DI5A 3PH7A 1KIZA 4LTVA 3G4DA 4H5CF 4LZ3A 3OACA 2E8UA 1HXCA 2FTZA 5DIQF 2OPMA 3N49F 1JFAA 2OPNA 3VJEA 1N20A 1HM4A 1V4EA 2Z7IA 5EATA 3S9VA 4MC3A 5DGNF 4NFKF 1VG4A 5IKHA 3Q2ZA 3ID0A 3WJKA 3UCAA 3KRFA 2Z78A 1N24A 3M00A 5DJRF 4JYXA 2Z4YA 5B0MA 4GP2A 4ZQ8A 1HX9A 2RAHA 5B03A 5KSXF 2AZKA 4KVDA 5ERMA 3LLWA 3PKOA 4RXEA 3WCAA 3ZCDA 1WKZA 4OKMA 3DYFA 3TFNA 4XQSF 5HN9A 5IL3A 4GP1A 3OYRA 3KB9A 2Q80A 4E9ZA 5DGSF 4OGUA 3P8LA 5ILKA 3AQBB 2OA6A 4KQUA 4DXJA 3AQ0A 4LPHF 2F92F 1JFGA 2OGDA 1WMWA 3WCJA 3N0FA 5A0KA 1V4IA 2J1OA 4KFAA 5A0JA 4LTZA 3KROA 3OABA 1VG7A 2ZY1A 1PS1A 5ILHA 3SDQA 5IK0A 3N5JF 3PYAA 1ZW5A 2Q9YA 5JV1F 3P8RA 5ILYA 3APZA 3PDEA 2Z4VA 2J5CA 3ICNA 3KROB 5IMIA 3OABB 2Z7HA 5ILZA 1WL0A 3N1WF 4F6VA 4NG6A 5DZ2A 3WJOA 4JZBA 3LJIA 5HN7A 3ZMCA 1KIYA 2PS8A 4LFGA 4F62A 2E92A 5DJVF 3N0GA 5JV0F 2E8WA 3N45F 5IL8A 5CG5A 5B00A 3ACWA 3TS7A 2ONHA 3VJ8A 3WCEA 4QPFA 2I19A 3WCHA 2ZEVA 3WEIA 4LA5A 4MC8A 4KQSA 3WEKA 4KWDA 3CP6A 3QKCA 3ZOUA 4P0XA 3RYEA 3Q2QA 3LDWA 4UMJA 3CC9A 4JZXA 3KRCA 2PS4A 3V66A 5AYPA 4NKFA 2F8CF 3LK5A 2F8ZF 2AELA 2E8TA 3OACB 4QXSF 4DHDA 4OMHA 3ZMBA 5B02A 3Q1OA 2E90A 5DW7A 3LG5A 3N6KF 3WSAA 1N21A 3KRCB 1DI1A 5A0IA 1YHLA 4FP4A 1VG2A 5C05A 5E8HA 1RTRA 2AZLA 3N3LF 3KRFB 3EFQA 3WC9A 4DZWA 4FJQA 4JXNA 4JXYA 4KVYA 5DGMF 3RMGA 4E1EA 1YJ4A 5IMNA 4RNQA 3VJBA 1N1ZA 3NF2A 3KRPA 1V4KA 4XQRF 3WCDA 4KVIA 4RYPA 5EAUA 1UBWA 3N5HF 4LLSA 3PYBA 4LZ0A 2O1OA 4RXAA 2PS5A 4OKZA 3WE9A 1YYQA 2H8OA 4PVXF 4H5EF 3KRPB 1WY0A 3AE0A 5IVGA 3SDTA 1YYSA 3WCLA 3EZ3A 4DEMF 3ICKA 3LGZB 1YYTA 3DYGA 3IBAA 2ZCQA 4KVWA 3Q30A 3ACXA 1UBVA 2Z4XA 3IPIA 4NKEA 4DWBA 2J1PA 3V1XA 1YYRA 3KRAA 4PVYF 3TFPA 3VJDA 4LIXA 1N23A 2EWGA 5AFXA 5IMPA 4OMGA 5DJPF 5IM1A 3TFVA 5B0KA 2E4OA 3ICMA 3WJNA 1YQ7A 1DGPA 5ER8A 3LMDA 2Z50A 3M9UA 2F7MF 4KUXA 4LFVF 5HNAA 2QISA 3QQVA 3M01A 4LXWA 4DWGA 2E8VA 3ACYA 3WEJA 4LUUA 4KKMA 3LOMA 1UBXA 2F9KF 4NFJF 1HM7A 5B0JA 5B0LA 1YHKA 5EASA 4P0WA 4EA2A 3VJ9A 5JV2F 2AEKA 2ZCOA 2VF6A 3P5PA 5ILJA 3VJCA 3KBKA 4XQTF 3DYHA 3WCBA 4EA1A 3CKEA
chains in the Genus database with same CATH topology
2Z4ZA 3WCMA 3M02A 5IKAA 3ADZA 3ZL6A 3P41A 3SAEA 3N46F 2Q58A 3LEEA 2PS7A 4L2XF 3WEHA 1YYUA 2F94F 3NPKA 5HN8A 5B0IA 4LOBA 5AHUB 4NUAA 4GA3A 4E9UA 3WCGA 1WL3A 2F89F 5IK9A 4N9UA 1YV5A 5IK6A 4P0VA 4LPGF 3LSNA 4NFIF 5B01A 2E93A 4MC0A 1RQJA 1WL1A 1WL2A 3V1VA 3WEGA 5E8LA 3WCIA 5H9DA 3EGTA 4HD1A 1N22A 4WK5A 4F6XA 5ILIA 4LLTA 5EROA 3LGKA 4JVJF 1UBYA 3BNXA 4N1ZF 2AZJA 3G4FA 3ICZA 5ERNA 2FORA 3SDRA 3WCFA 4KK2A 5AELA 3RYWA 1VG3A 1N1BA 4LZCA 4K10A 5ILDA 2AETA 2ONGA 4KPJA 1V4HA 3AQCB 1EZFA 5I1UA 4H5DF 1RQIA 3WCCA 4KPDA 1FPSA 3TC1A 3SDUA 4Q23A 3W7FA 4RXCA 5JUZF 3RBMA 3S4JA 3NRIA 2Z52A 3BNYA 4LA6A 3VJAA 2ZCSA 4RXDA 2ZCRA 1V4JA 4EA0A 3LZ9A 5E8KA 3M0GA 3N3DA 5JA0F 5IN8A 4GAXA 3MAVA 3P5RA 2Z4WA 1YHMA 3KRAB 4LFEA 2E91A 4KQ5A 2E95A 3WEFA 3MZVA 5DHKA 2E94A 3NPRA 3LVSA 2E8XA 5CG6A 1VG6A 1HXGA 3B7LA 2ZEUA 2DH4A 2P1CA 3WSBA 3N1VF 1HXAA 3ASXA 2PS6A 2Q9ZA 3SDVA 5DHIA 4DI5A 3PH7A 1KIZA 4LTVA 3G4DA 4H5CF 4LZ3A 3OACA 2E8UA 1HXCA 2FTZA 5DIQF 2OPMA 3N49F 1JFAA 2OPNA 3VJEA 1N20A 1HM4A 1V4EA 2Z7IA 5EATA 3S9VA 4MC3A 5DGNF 4NFKF 1VG4A 5IKHA 3Q2ZA 3ID0A 3WJKA 3UCAA 3KRFA 2Z78A 1N24A 3M00A 5DJRF 4JYXA 2Z4YA 5B0MA 4GP2A 4ZQ8A 1HX9A 2RAHA 5B03A 5KSXF 2AZKA 4KVDA 5ERMA 3LLWA 3PKOA 4RXEA 3WCAA 3ZCDA 1WKZA 4OKMA 3DYFA 3TFNA 4XQSF 5HN9A 5IL3A 4GP1A 3OYRA 3KB9A 2Q80A 4E9ZA 5DGSF 4OGUA 3P8LA 5ILKA 3AQBB 2OA6A 4KQUA 4DXJA 3AQ0A 4LPHF 2F92F 1JFGA 2OGDA 1WMWA 3WCJA 3N0FA 5A0KA 1V4IA 2J1OA 4KFAA 5A0JA 4LTZA 3KROA 3OABA 1VG7A 2ZY1A 1PS1A 5ILHA 3SDQA 5IK0A 3N5JF 3PYAA 1ZW5A 2Q9YA 5JV1F 3P8RA 5ILYA 3APZA 3PDEA 2Z4VA 2J5CA 3ICNA 3KROB 5IMIA 3OABB 2Z7HA 5ILZA 1WL0A 3N1WF 4F6VA 4NG6A 5DZ2A 3WJOA 4JZBA 3LJIA 5HN7A 3ZMCA 1KIYA 2PS8A 4LFGA 4F62A 2E92A 5DJVF 3N0GA 5JV0F 2E8WA 3N45F 5IL8A 5CG5A 5B00A 3ACWA 3TS7A 2ONHA 3VJ8A 3WCEA 4QPFA 2I19A 3WCHA 2ZEVA 3WEIA 4LA5A 4MC8A 4KQSA 3WEKA 4KWDA 3CP6A 3QKCA 3ZOUA 4P0XA 3RYEA 3Q2QA 3LDWA 4UMJA 3CC9A 4JZXA 3KRCA 2PS4A 3V66A 5AYPA 4NKFA 2F8CF 3LK5A 2F8ZF 2AELA 2E8TA 3OACB 4QXSF 4DHDA 4OMHA 3ZMBA 5B02A 3Q1OA 2E90A 5DW7A 3LG5A 3N6KF 3WSAA 1N21A 3KRCB 1DI1A 5A0IA 1YHLA 4FP4A 1VG2A 5C05A 5E8HA 1RTRA 2AZLA 3N3LF 3KRFB 3EFQA 3WC9A 4DZWA 4FJQA 4JXNA 4JXYA 4KVYA 5DGMF 3RMGA 4E1EA 1YJ4A 5IMNA 4RNQA 3VJBA 1N1ZA 3NF2A 3KRPA 1V4KA 4XQRF 3WCDA 4KVIA 4RYPA 5EAUA 1UBWA 3N5HF 4LLSA 3PYBA 4LZ0A 2O1OA 4RXAA 2PS5A 4OKZA 3WE9A 1YYQA 2H8OA 4PVXF 4H5EF 3KRPB 1WY0A 3AE0A 5IVGA 3SDTA 1YYSA 3WCLA 3EZ3A 4DEMF 3ICKA 3LGZB 1YYTA 3DYGA 3IBAA 2ZCQA 4KVWA 3Q30A 3ACXA 1UBVA 2Z4XA 3IPIA 4NKEA 4DWBA 2J1PA 3V1XA 1YYRA 3KRAA 4PVYF 3TFPA 3VJDA 4LIXA 1N23A 2EWGA 5AFXA 5IMPA 4OMGA 5DJPF 5IM1A 3TFVA 5B0KA 2E4OA 3ICMA 3WJNA 1YQ7A 1DGPA 5ER8A 3LMDA 2Z50A 3M9UA 2F7MF 4KUXA 4LFVF 5HNAA 2QISA 3QQVA 3M01A 4LXWA 4DWGA 2E8VA 3ACYA 3WEJA 4LUUA 4KKMA 3LOMA 1UBXA 2F9KF 4NFJF 1HM7A 5B0JA 5B0LA 1YHKA 5EASA 4P0WA 4EA2A 3VJ9A 5JV2F 2AEKA 2ZCOA 2VF6A 3P5PA 5ILJA 3VJCA 3KBKA 4XQTF 3DYHA 3WCBA 4EA1A 3CKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z4Z A;  3WCM A;  3M02 A;  5IKA A;  3ADZ A;  3ZL6 A;  3P41 A;  3SAE A;  3N46 F;  2Q58 A;  3LEE A;  2PS7 A;  4L2X F;  3WEH A;  1YYU A;  2F94 F;  3NPK A;  5HN8 A;  5B0I A;  4LOB A;  5AHU B;  4NUA A;  4GA3 A;  4E9U A;  3WCG A;  1WL3 A;  2F89 F;  5IK9 A;  4N9U A;  1YV5 A;  5IK6 A;  4P0V A;  4LPG F;  3LSN A;  4NFI F;  5B01 A;  2E93 A;  4MC0 A;  1RQJ A;  1WL1 A;  1WL2 A;  3V1V A;  3WEG A;  5E8L A;  3WCI A;  5H9D A;  3EGT A;  4HD1 A;  1N22 A;  4WK5 A;  4F6X A;  5ILI A;  4LLT A;  5ERO A;  3LGK A;  4JVJ F;  1UBY A;  3BNX A;  4N1Z F;  2AZJ A;  3G4F A;  3ICZ A;  5ERN A;  2FOR A;  3SDR A;  3WCF A;  4KK2 A;  5AEL A;  3RYW A;  1VG3 A;  1N1B A;  4LZC A;  4K10 A;  5ILD A;  2AET A;  2ONG A;  4KPJ A;  1V4H A;  3AQC B;  1EZF A;  5I1U A;  4H5D F;  1RQI A;  3WCC A;  4KPD A;  1FPS A;  3TC1 A;  3SDU A;  4Q23 A;  3W7F A;  4RXC A;  5JUZ F;  3RBM A;  3S4J A;  3NRI A;  2Z52 A;  3BNY A;  4LA6 A;  3VJA A;  2ZCS A;  4RXD A;  2ZCR A;  1V4J A;  4EA0 A;  3LZ9 A;  5E8K A;  3M0G A;  3N3D A;  5JA0 F;  5IN8 A;  4GAX A;  3MAV A;  3P5R A;  2Z4W A;  1YHM A;  3KRA B;  4LFE A;  2E91 A;  4KQ5 A;  2E95 A;  3WEF A;  3MZV A;  5DHK A;  2E94 A;  3NPR A;  3LVS A;  2E8X A;  5CG6 A;  1VG6 A;  1HXG A;  3B7L A;  2ZEU A;  2DH4 A;  2P1C A;  3WSB A;  3N1V F;  1HXA A;  3ASX A;  2PS6 A;  2Q9Z A;  3SDV A;  5DHI A;  4DI5 A;  3PH7 A;  1KIZ A;  4LTV A;  3G4D A;  4H5C F;  4LZ3 A;  3OAC A;  2E8U A;  1HXC A;  2FTZ A;  5DIQ F;  2OPM A;  3N49 F;  1JFA A;  2OPN A;  3VJE A;  1N20 A;  1HM4 A;  1V4E A;  2Z7I A;  5EAT A;  3S9V A;  4MC3 A;  5DGN F;  4NFK F;  1VG4 A;  5IKH A;  3Q2Z A;  3ID0 A;  3WJK A;  3UCA A;  3KRF A;  2Z78 A;  1N24 A;  3M00 A;  5DJR F;  4JYX A;  2Z4Y A;  5B0M A;  4GP2 A;  4ZQ8 A;  1HX9 A;  2RAH A;  5B03 A;  5KSX F;  2AZK A;  4KVD A;  5ERM A;  3LLW A;  3PKO A;  4RXE A;  3WCA A;  3ZCD A;  1WKZ A;  4OKM A;  3DYF A;  3TFN A;  4XQS F;  5HN9 A;  5IL3 A;  4GP1 A;  3OYR A;  3KB9 A;  2Q80 A;  4E9Z A;  5DGS F;  4OGU A;  3P8L A;  5ILK A;  3AQB B;  2OA6 A;  4KQU A;  4DXJ A;  3AQ0 A;  4LPH F;  2F92 F;  1JFG A;  2OGD A;  1WMW A;  3WCJ A;  3N0F A;  5A0K A;  1V4I A;  2J1O A;  4KFA A;  5A0J A;  4LTZ A;  3KRO A;  3OAB A;  1VG7 A;  2ZY1 A;  1PS1 A;  5ILH A;  3SDQ A;  5IK0 A;  3N5J F;  3PYA A;  1ZW5 A;  2Q9Y A;  5JV1 F;  3P8R A;  5ILY A;  3APZ A;  3PDE A;  2Z4V A;  2J5C A;  3ICN A;  3KRO B;  5IMI A;  3OAB B;  2Z7H A;  5ILZ A;  1WL0 A;  3N1W F;  4F6V A;  4NG6 A;  5DZ2 A;  3WJO A;  4JZB A;  3LJI A;  5HN7 A;  3ZMC A;  1KIY A;  2PS8 A;  4LFG A;  4F62 A;  2E92 A;  5DJV F;  3N0G A;  5JV0 F;  2E8W A;  3N45 F;  5IL8 A;  5CG5 A;  5B00 A;  3ACW A;  3TS7 A;  2ONH A;  3VJ8 A;  3WCE A;  4QPF A;  2I19 A;  3WCH A;  2ZEV A;  3WEI A;  4LA5 A;  4MC8 A;  4KQS A;  3WEK A;  4KWD A;  3CP6 A;  3QKC A;  3ZOU A;  4P0X A;  3RYE A;  3Q2Q A;  3LDW A;  4UMJ A;  3CC9 A;  4JZX A;  3KRC A;  2PS4 A;  3V66 A;  5AYP A;  4NKF A;  2F8C F;  3LK5 A;  2F8Z F;  2AEL A;  2E8T A;  3OAC B;  4QXS F;  4DHD A;  4OMH A;  3ZMB A;  5B02 A;  3Q1O A;  2E90 A;  5DW7 A;  3LG5 A;  3N6K F;  3WSA A;  1N21 A;  3KRC B;  1DI1 A;  5A0I A;  1YHL A;  4FP4 A;  1VG2 A;  5C05 A;  5E8H A;  1RTR A;  2AZL A;  3N3L F;  3KRF B;  3EFQ A;  3WC9 A;  4DZW A;  4FJQ A;  4JXN A;  4JXY A;  4KVY A;  5DGM F;  3RMG A;  4E1E A;  1YJ4 A;  5IMN A;  4RNQ A;  3VJB A;  1N1Z A;  3NF2 A;  3KRP A;  1V4K A;  4XQR F;  3WCD A;  4KVI A;  4RYP A;  5EAU A;  1UBW A;  3N5H F;  4LLS A;  3PYB A;  4LZ0 A;  2O1O A;  4RXA A;  2PS5 A;  4OKZ A;  3WE9 A;  1YYQ A;  2H8O A;  4PVX F;  4H5E F;  3KRP B;  1WY0 A;  3AE0 A;  5IVG A;  3SDT A;  1YYS A;  3WCL A;  3EZ3 A;  4DEM F;  3ICK A;  3LGZ B;  1YYT A;  3DYG A;  3IBA A;  2ZCQ A;  4KVW A;  3Q30 A;  3ACX A;  1UBV A;  2Z4X A;  3IPI A;  4NKE A;  4DWB A;  2J1P A;  3V1X A;  1YYR A;  3KRA A;  4PVY F;  3TFP A;  3VJD A;  4LIX A;  1N23 A;  2EWG A;  5AFX A;  5IMP A;  4OMG A;  5DJP F;  5IM1 A;  3TFV A;  5B0K A;  2E4O A;  3ICM A;  3WJN A;  1YQ7 A;  1DGP A;  5ER8 A;  3LMD A;  2Z50 A;  3M9U A;  2F7M F;  4KUX A;  4LFV F;  5HNA A;  2QIS A;  3QQV A;  3M01 A;  4LXW A;  4DWG A;  2E8V A;  3ACY A;  3WEJ A;  4LUU A;  4KKM A;  3LOM A;  1UBX A;  2F9K F;  4NFJ F;  1HM7 A;  5B0J A;  5B0L A;  1YHK A;  5EAS A;  4P0W A;  4EA2 A;  3VJ9 A;  5JV2 F;  2AEK A;  2ZCO A;  2VF6 A;  3P5P A;  5ILJ A;  3VJC A;  3KBK A;  4XQT F;  3DYH A;  3WCB A;  4EA1 A;  3CKE A; 
#chains in the Genus database with same CATH topology
 2Z4Z A;  3WCM A;  3M02 A;  5IKA A;  3ADZ A;  3ZL6 A;  3P41 A;  3SAE A;  3N46 F;  2Q58 A;  3LEE A;  2PS7 A;  4L2X F;  3WEH A;  1YYU A;  2F94 F;  3NPK A;  5HN8 A;  5B0I A;  4LOB A;  5AHU B;  4NUA A;  4GA3 A;  4E9U A;  3WCG A;  1WL3 A;  2F89 F;  5IK9 A;  4N9U A;  1YV5 A;  5IK6 A;  4P0V A;  4LPG F;  3LSN A;  4NFI F;  5B01 A;  2E93 A;  4MC0 A;  1RQJ A;  1WL1 A;  1WL2 A;  3V1V A;  3WEG A;  5E8L A;  3WCI A;  5H9D A;  3EGT A;  4HD1 A;  1N22 A;  4WK5 A;  4F6X A;  5ILI A;  4LLT A;  5ERO A;  3LGK A;  4JVJ F;  1UBY A;  3BNX A;  4N1Z F;  2AZJ A;  3G4F A;  3ICZ A;  5ERN A;  2FOR A;  3SDR A;  3WCF A;  4KK2 A;  5AEL A;  3RYW A;  1VG3 A;  1N1B A;  4LZC A;  4K10 A;  5ILD A;  2AET A;  2ONG A;  4KPJ A;  1V4H A;  3AQC B;  1EZF A;  5I1U A;  4H5D F;  1RQI A;  3WCC A;  4KPD A;  1FPS A;  3TC1 A;  3SDU A;  4Q23 A;  3W7F A;  4RXC A;  5JUZ F;  3RBM A;  3S4J A;  3NRI A;  2Z52 A;  3BNY A;  4LA6 A;  3VJA A;  2ZCS A;  4RXD A;  2ZCR A;  1V4J A;  4EA0 A;  3LZ9 A;  5E8K A;  3M0G A;  3N3D A;  5JA0 F;  5IN8 A;  4GAX A;  3MAV A;  3P5R A;  2Z4W A;  1YHM A;  3KRA B;  4LFE A;  2E91 A;  4KQ5 A;  2E95 A;  3WEF A;  3MZV A;  5DHK A;  2E94 A;  3NPR A;  3LVS A;  2E8X A;  5CG6 A;  1VG6 A;  1HXG A;  3B7L A;  2ZEU A;  2DH4 A;  2P1C A;  3WSB A;  3N1V F;  1HXA A;  3ASX A;  2PS6 A;  2Q9Z A;  3SDV A;  5DHI A;  4DI5 A;  3PH7 A;  1KIZ A;  4LTV A;  3G4D A;  4H5C F;  4LZ3 A;  3OAC A;  2E8U A;  1HXC A;  2FTZ A;  5DIQ F;  2OPM A;  3N49 F;  1JFA A;  2OPN A;  3VJE A;  1N20 A;  1HM4 A;  1V4E A;  2Z7I A;  5EAT A;  3S9V A;  4MC3 A;  5DGN F;  4NFK F;  1VG4 A;  5IKH A;  3Q2Z A;  3ID0 A;  3WJK A;  3UCA A;  3KRF A;  2Z78 A;  1N24 A;  3M00 A;  5DJR F;  4JYX A;  2Z4Y A;  5B0M A;  4GP2 A;  4ZQ8 A;  1HX9 A;  2RAH A;  5B03 A;  5KSX F;  2AZK A;  4KVD A;  5ERM A;  3LLW A;  3PKO A;  4RXE A;  3WCA A;  3ZCD A;  1WKZ A;  4OKM A;  3DYF A;  3TFN A;  4XQS F;  5HN9 A;  5IL3 A;  4GP1 A;  3OYR A;  3KB9 A;  2Q80 A;  4E9Z A;  5DGS F;  4OGU A;  3P8L A;  5ILK A;  3AQB B;  2OA6 A;  4KQU A;  4DXJ A;  3AQ0 A;  4LPH F;  2F92 F;  1JFG A;  2OGD A;  1WMW A;  3WCJ A;  3N0F A;  5A0K A;  1V4I A;  2J1O A;  4KFA A;  5A0J A;  4LTZ A;  3KRO A;  3OAB A;  1VG7 A;  2ZY1 A;  1PS1 A;  5ILH A;  3SDQ A;  5IK0 A;  3N5J F;  3PYA A;  1ZW5 A;  2Q9Y A;  5JV1 F;  3P8R A;  5ILY A;  3APZ A;  3PDE A;  2Z4V A;  2J5C A;  3ICN A;  3KRO B;  5IMI A;  3OAB B;  2Z7H A;  5ILZ A;  1WL0 A;  3N1W F;  4F6V A;  4NG6 A;  5DZ2 A;  3WJO A;  4JZB A;  3LJI A;  5HN7 A;  3ZMC A;  1KIY A;  2PS8 A;  4LFG A;  4F62 A;  2E92 A;  5DJV F;  3N0G A;  5JV0 F;  2E8W A;  3N45 F;  5IL8 A;  5CG5 A;  5B00 A;  3ACW A;  3TS7 A;  2ONH A;  3VJ8 A;  3WCE A;  4QPF A;  2I19 A;  3WCH A;  2ZEV A;  3WEI A;  4LA5 A;  4MC8 A;  4KQS A;  3WEK A;  4KWD A;  3CP6 A;  3QKC A;  3ZOU A;  4P0X A;  3RYE A;  3Q2Q A;  3LDW A;  4UMJ A;  3CC9 A;  4JZX A;  3KRC A;  2PS4 A;  3V66 A;  5AYP A;  4NKF A;  2F8C F;  3LK5 A;  2F8Z F;  2AEL A;  2E8T A;  3OAC B;  4QXS F;  4DHD A;  4OMH A;  3ZMB A;  5B02 A;  3Q1O A;  2E90 A;  5DW7 A;  3LG5 A;  3N6K F;  3WSA A;  1N21 A;  3KRC B;  1DI1 A;  5A0I A;  1YHL A;  4FP4 A;  1VG2 A;  5C05 A;  5E8H A;  1RTR A;  2AZL A;  3N3L F;  3KRF B;  3EFQ A;  3WC9 A;  4DZW A;  4FJQ A;  4JXN A;  4JXY A;  4KVY A;  5DGM F;  3RMG A;  4E1E A;  1YJ4 A;  5IMN A;  4RNQ A;  3VJB A;  1N1Z A;  3NF2 A;  3KRP A;  1V4K A;  4XQR F;  3WCD A;  4KVI A;  4RYP A;  5EAU A;  1UBW A;  3N5H F;  4LLS A;  3PYB A;  4LZ0 A;  2O1O A;  4RXA A;  2PS5 A;  4OKZ A;  3WE9 A;  1YYQ A;  2H8O A;  4PVX F;  4H5E F;  3KRP B;  1WY0 A;  3AE0 A;  5IVG A;  3SDT A;  1YYS A;  3WCL A;  3EZ3 A;  4DEM F;  3ICK A;  3LGZ B;  1YYT A;  3DYG A;  3IBA A;  2ZCQ A;  4KVW A;  3Q30 A;  3ACX A;  1UBV A;  2Z4X A;  3IPI A;  4NKE A;  4DWB A;  2J1P A;  3V1X A;  1YYR A;  3KRA A;  4PVY F;  3TFP A;  3VJD A;  4LIX A;  1N23 A;  2EWG A;  5AFX A;  5IMP A;  4OMG A;  5DJP F;  5IM1 A;  3TFV A;  5B0K A;  2E4O A;  3ICM A;  3WJN A;  1YQ7 A;  1DGP A;  5ER8 A;  3LMD A;  2Z50 A;  3M9U A;  2F7M F;  4KUX A;  4LFV F;  5HNA A;  2QIS A;  3QQV A;  3M01 A;  4LXW A;  4DWG A;  2E8V A;  3ACY A;  3WEJ A;  4LUU A;  4KKM A;  3LOM A;  1UBX A;  2F9K F;  4NFJ F;  1HM7 A;  5B0J A;  5B0L A;  1YHK A;  5EAS A;  4P0W A;  4EA2 A;  3VJ9 A;  5JV2 F;  2AEK A;  2ZCO A;  2VF6 A;  3P5P A;  5ILJ A;  3VJC A;  3KBK A;  4XQT F;  3DYH A;  3WCB A;  4EA1 A;  3CKE A; 
#chains in the Genus database with same CATH homology
 2Z4Z A;  3WCM A;  3M02 A;  5IKA A;  3ADZ A;  3ZL6 A;  3P41 A;  3SAE A;  3N46 F;  2Q58 A;  3LEE A;  2PS7 A;  4L2X F;  3WEH A;  1YYU A;  2F94 F;  3NPK A;  5HN8 A;  5B0I A;  4LOB A;  5AHU B;  4NUA A;  4GA3 A;  4E9U A;  3WCG A;  1WL3 A;  2F89 F;  5IK9 A;  4N9U A;  1YV5 A;  5IK6 A;  4P0V A;  4LPG F;  3LSN A;  4NFI F;  5B01 A;  2E93 A;  4MC0 A;  1RQJ A;  1WL1 A;  1WL2 A;  3V1V A;  3WEG A;  5E8L A;  3WCI A;  5H9D A;  3EGT A;  4HD1 A;  1N22 A;  4WK5 A;  4F6X A;  5ILI A;  4LLT A;  5ERO A;  3LGK A;  4JVJ F;  1UBY A;  3BNX A;  4N1Z F;  2AZJ A;  3G4F A;  3ICZ A;  5ERN A;  2FOR A;  3SDR A;  3WCF A;  4KK2 A;  5AEL A;  3RYW A;  1VG3 A;  1N1B A;  4LZC A;  4K10 A;  5ILD A;  2AET A;  2ONG A;  4KPJ A;  1V4H A;  3AQC B;  1EZF A;  5I1U A;  4H5D F;  1RQI A;  3WCC A;  4KPD A;  1FPS A;  3TC1 A;  3SDU A;  4Q23 A;  3W7F A;  4RXC A;  5JUZ F;  3RBM A;  3S4J A;  3NRI A;  2Z52 A;  3BNY A;  4LA6 A;  3VJA A;  2ZCS A;  4RXD A;  2ZCR A;  1V4J A;  4EA0 A;  3LZ9 A;  5E8K A;  3M0G A;  3N3D A;  5JA0 F;  5IN8 A;  4GAX A;  3MAV A;  3P5R A;  2Z4W A;  1YHM A;  3KRA B;  4LFE A;  2E91 A;  4KQ5 A;  2E95 A;  3WEF A;  3MZV A;  5DHK A;  2E94 A;  3NPR A;  3LVS A;  2E8X A;  5CG6 A;  1VG6 A;  1HXG A;  3B7L A;  2ZEU A;  2DH4 A;  2P1C A;  3WSB A;  3N1V F;  1HXA A;  3ASX A;  2PS6 A;  2Q9Z A;  3SDV A;  5DHI A;  4DI5 A;  3PH7 A;  1KIZ A;  4LTV A;  3G4D A;  4H5C F;  4LZ3 A;  3OAC A;  2E8U A;  1HXC A;  2FTZ A;  5DIQ F;  2OPM A;  3N49 F;  1JFA A;  2OPN A;  3VJE A;  1N20 A;  1HM4 A;  1V4E A;  2Z7I A;  5EAT A;  3S9V A;  4MC3 A;  5DGN F;  4NFK F;  1VG4 A;  5IKH A;  3Q2Z A;  3ID0 A;  3WJK A;  3UCA A;  3KRF A;  2Z78 A;  1N24 A;  3M00 A;  5DJR F;  4JYX A;  2Z4Y A;  5B0M A;  4GP2 A;  4ZQ8 A;  1HX9 A;  2RAH A;  5B03 A;  5KSX F;  2AZK A;  4KVD A;  5ERM A;  3LLW A;  3PKO A;  4RXE A;  3WCA A;  3ZCD A;  1WKZ A;  4OKM A;  3DYF A;  3TFN A;  4XQS F;  5HN9 A;  5IL3 A;  4GP1 A;  3OYR A;  3KB9 A;  2Q80 A;  4E9Z A;  5DGS F;  4OGU A;  3P8L A;  5ILK A;  3AQB B;  2OA6 A;  4KQU A;  4DXJ A;  3AQ0 A;  4LPH F;  2F92 F;  1JFG A;  2OGD A;  1WMW A;  3WCJ A;  3N0F A;  5A0K A;  1V4I A;  2J1O A;  4KFA A;  5A0J A;  4LTZ A;  3KRO A;  3OAB A;  1VG7 A;  2ZY1 A;  1PS1 A;  5ILH A;  3SDQ A;  5IK0 A;  3N5J F;  3PYA A;  1ZW5 A;  2Q9Y A;  5JV1 F;  3P8R A;  5ILY A;  3APZ A;  3PDE A;  2Z4V A;  2J5C A;  3ICN A;  3KRO B;  5IMI A;  3OAB B;  2Z7H A;  5ILZ A;  1WL0 A;  3N1W F;  4F6V A;  4NG6 A;  5DZ2 A;  3WJO A;  4JZB A;  3LJI A;  5HN7 A;  3ZMC A;  1KIY A;  2PS8 A;  4LFG A;  4F62 A;  2E92 A;  5DJV F;  3N0G A;  5JV0 F;  2E8W A;  3N45 F;  5IL8 A;  5CG5 A;  5B00 A;  3ACW A;  3TS7 A;  2ONH A;  3VJ8 A;  3WCE A;  4QPF A;  2I19 A;  3WCH A;  2ZEV A;  3WEI A;  4LA5 A;  4MC8 A;  4KQS A;  3WEK A;  4KWD A;  3CP6 A;  3QKC A;  3ZOU A;  4P0X A;  3RYE A;  3Q2Q A;  3LDW A;  4UMJ A;  3CC9 A;  4JZX A;  3KRC A;  2PS4 A;  3V66 A;  5AYP A;  4NKF A;  2F8C F;  3LK5 A;  2F8Z F;  2AEL A;  2E8T A;  3OAC B;  4QXS F;  4DHD A;  4OMH A;  3ZMB A;  5B02 A;  3Q1O A;  2E90 A;  5DW7 A;  3LG5 A;  3N6K F;  3WSA A;  1N21 A;  3KRC B;  1DI1 A;  5A0I A;  1YHL A;  4FP4 A;  1VG2 A;  5C05 A;  5E8H A;  1RTR A;  2AZL A;  3N3L F;  3KRF B;  3EFQ A;  3WC9 A;  4DZW A;  4FJQ A;  4JXN A;  4JXY A;  4KVY A;  5DGM F;  3RMG A;  4E1E A;  1YJ4 A;  5IMN A;  4RNQ A;  3VJB A;  1N1Z A;  3NF2 A;  3KRP A;  1V4K A;  4XQR F;  3WCD A;  4KVI A;  4RYP A;  5EAU A;  1UBW A;  3N5H F;  4LLS A;  3PYB A;  4LZ0 A;  2O1O A;  4RXA A;  2PS5 A;  4OKZ A;  3WE9 A;  1YYQ A;  2H8O A;  4PVX F;  4H5E F;  3KRP B;  1WY0 A;  3AE0 A;  5IVG A;  3SDT A;  1YYS A;  3WCL A;  3EZ3 A;  4DEM F;  3ICK A;  3LGZ B;  1YYT A;  3DYG A;  3IBA A;  2ZCQ A;  4KVW A;  3Q30 A;  3ACX A;  1UBV A;  2Z4X A;  3IPI A;  4NKE A;  4DWB A;  2J1P A;  3V1X A;  1YYR A;  3KRA A;  4PVY F;  3TFP A;  3VJD A;  4LIX A;  1N23 A;  2EWG A;  5AFX A;  5IMP A;  4OMG A;  5DJP F;  5IM1 A;  3TFV A;  5B0K A;  2E4O A;  3ICM A;  3WJN A;  1YQ7 A;  1DGP A;  5ER8 A;  3LMD A;  2Z50 A;  3M9U A;  2F7M F;  4KUX A;  4LFV F;  5HNA A;  2QIS A;  3QQV A;  3M01 A;  4LXW A;  4DWG A;  2E8V A;  3ACY A;  3WEJ A;  4LUU A;  4KKM A;  3LOM A;  1UBX A;  2F9K F;  4NFJ F;  1HM7 A;  5B0J A;  5B0L A;  1YHK A;  5EAS A;  4P0W A;  4EA2 A;  3VJ9 A;  5JV2 F;  2AEK A;  2ZCO A;  2VF6 A;  3P5P A;  5ILJ A;  3VJC A;  3KBK A;  4XQT F;  3DYH A;  3WCB A;  4EA1 A;  3CKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...